BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP020A07 323 bp,

Length=323
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007034941.1|  Kinase family protein / peptidoglycan-bindin...    125   4e-31   Theobroma cacao [chocolate]
ref|XP_008349656.1|  PREDICTED: protein LYK5-like                       114   9e-28   Malus domestica [apple tree]
ref|XP_008224192.1|  PREDICTED: lysM domain receptor-like kinase ...    116   1e-27   Prunus mume [ume]
ref|XP_004288425.1|  PREDICTED: lysM domain receptor-like kinase 4      115   3e-27   Fragaria vesca subsp. vesca
gb|AAL57228.1|  protein kinase-like protein                             107   4e-27   Capsicum annuum
gb|KJB38269.1|  hypothetical protein B456_006G245600                    114   5e-27   Gossypium raimondii
ref|XP_009588827.1|  PREDICTED: protein LYK5-like                       114   5e-27   Nicotiana tomentosiformis
ref|XP_009337287.1|  PREDICTED: lysM domain receptor-like kinase 4      114   7e-27   Pyrus x bretschneideri [bai li]
ref|XP_011027465.1|  PREDICTED: lysM domain receptor-like kinase 4      114   7e-27   Populus euphratica
ref|XP_009762994.1|  PREDICTED: lysM domain receptor-like kinase 4      114   8e-27   Nicotiana sylvestris
ref|XP_008224193.1|  PREDICTED: lysM domain receptor-like kinase ...    113   9e-27   Prunus mume [ume]
ref|XP_007221990.1|  hypothetical protein PRUPE_ppa002872mg             113   1e-26   Prunus persica
ref|XP_006368087.1|  PREDICTED: protein LYK5-like                       106   2e-26   Solanum tuberosum [potatoes]
gb|KDP40268.1|  hypothetical protein JCGZ_02266                         112   3e-26   Jatropha curcas
ref|XP_002311653.2|  hypothetical protein POPTR_0008s16050g             110   8e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011030594.1|  PREDICTED: lysM domain receptor-like kinase 4      110   2e-25   Populus euphratica
ref|XP_004247634.1|  PREDICTED: protein LYK5-like                       109   2e-25   Solanum lycopersicum
ref|XP_006362183.1|  PREDICTED: protein LYK5-like                       109   2e-25   Solanum tuberosum [potatoes]
ref|XP_004247635.1|  PREDICTED: protein LYK5-like                       108   6e-25   Solanum lycopersicum
emb|CAN66762.1|  hypothetical protein VITISV_032728                     106   3e-24   Vitis vinifera
emb|CBI26350.3|  unnamed protein product                                106   3e-24   Vitis vinifera
ref|XP_006362181.1|  PREDICTED: protein LYK5-like                       106   3e-24   Solanum tuberosum [potatoes]
ref|XP_002280070.1|  PREDICTED: lysM domain receptor-like kinase 4      106   3e-24   Vitis vinifera
ref|XP_006362182.1|  PREDICTED: protein LYK5-like                       106   4e-24   Solanum tuberosum [potatoes]
gb|AFK39301.1|  unknown                                                 100   5e-24   Lotus japonicus
ref|XP_010684773.1|  PREDICTED: protein LYK5-like                       104   1e-23   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002315740.2|  hypothetical protein POPTR_0010s08920g             104   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002517029.1|  serine-threonine protein kinase, plant-type,...    103   4e-23   Ricinus communis
emb|CDP20691.1|  unnamed protein product                                102   9e-23   Coffea canephora [robusta coffee]
ref|XP_010105398.1|  Proline-rich receptor-like protein kinase PERK9    102   1e-22   Morus notabilis
gb|ABY75166.1|  putative LysM receptor kinase                         93.6    5e-22   Arachis diogoi
gb|KJB72197.1|  hypothetical protein B456_011G164600                  99.0    1e-21   Gossypium raimondii
dbj|BAO45880.1|  receptor-like protein kinase                         98.6    2e-21   Acacia mangium
ref|XP_003613904.1|  Cysteine-rich receptor-like protein kinase       96.7    1e-20   
gb|AES96862.2|  LysM-domain receptor-like kinase                      96.3    1e-20   Medicago truncatula
ref|XP_011091102.1|  PREDICTED: lysM domain receptor-like kinase 4    95.9    2e-20   Sesamum indicum [beniseed]
gb|KHN15405.1|  Putative receptor-like protein kinase                 95.5    2e-20   Glycine soja [wild soybean]
ref|XP_003518770.1|  PREDICTED: lysM domain receptor-like kinase ...  95.5    3e-20   Glycine max [soybeans]
ref|XP_008366230.1|  PREDICTED: LOW QUALITY PROTEIN: protein LYK5...  94.4    6e-20   
ref|XP_007145934.1|  hypothetical protein PHAVU_007G280200g           93.6    1e-19   Phaseolus vulgaris [French bean]
ref|XP_004134429.1|  PREDICTED: proline-rich receptor-like protei...  93.6    1e-19   
ref|XP_004165057.1|  PREDICTED: proline-rich receptor-like protei...  93.6    1e-19   
gb|KGN56921.1|  hypothetical protein Csa_3G144110                     93.6    1e-19   Cucumis sativus [cucumbers]
ref|XP_004498011.1|  PREDICTED: lysM domain receptor-like kinase ...  92.4    3e-19   Cicer arietinum [garbanzo]
ref|XP_010274212.1|  PREDICTED: protein LYK5-like                     90.9    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008438594.1|  PREDICTED: lysM domain receptor-like kinase 4    90.5    2e-18   Cucumis melo [Oriental melon]
ref|XP_006489496.1|  PREDICTED: lysM domain receptor-like kinase ...  90.1    2e-18   Citrus sinensis [Valencia orange]
ref|XP_006420086.1|  hypothetical protein CICLE_v10004551mg           89.7    3e-18   Citrus clementina
ref|XP_008779539.1|  PREDICTED: protein LYK5-like                     85.1    1e-17   
ref|NP_001140876.1|  uncharacterized protein LOC100272952             84.3    2e-16   Zea mays [maize]
gb|AFW72812.1|  putative lysM-domain receptor-like protein kinase...  84.7    2e-16   Zea mays [maize]
ref|NP_001047747.1|  Os02g0681700                                     81.3    3e-16   
ref|XP_010246324.1|  PREDICTED: protein LYK5-like                     84.0    3e-16   Nelumbo nucifera [Indian lotus]
gb|EEE57585.1|  hypothetical protein OsJ_07939                        81.3    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009380288.1|  PREDICTED: lysM domain receptor-like kinase 4    82.8    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY87082.1|  hypothetical protein OsI_08480                        81.6    2e-15   Oryza sativa Indica Group [Indian rice]
dbj|BAJ88826.1|  predicted protein                                    80.9    4e-15   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ89552.1|  predicted protein                                    80.5    4e-15   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004953457.1|  PREDICTED: lysM domain receptor-like kinase ...  80.5    5e-15   Setaria italica
ref|XP_010024053.1|  PREDICTED: lysM domain receptor-like kinase 4    80.5    5e-15   Eucalyptus grandis [rose gum]
ref|XP_010910680.1|  PREDICTED: LOW QUALITY PROTEIN: lysM domain ...  79.3    1e-14   Elaeis guineensis
ref|XP_006829101.1|  hypothetical protein AMTR_s00001p00263560        78.6    2e-14   Amborella trichopoda
gb|EPS63752.1|  hypothetical protein M569_11034                       77.8    4e-14   Genlisea aurea
gb|KDO53930.1|  hypothetical protein CISIN_1g047377mg                 73.9    6e-14   Citrus sinensis [Valencia orange]
ref|XP_010026876.1|  PREDICTED: receptor-like serine/threonine-pr...  70.1    5e-13   Eucalyptus grandis [rose gum]
ref|XP_003572823.2|  PREDICTED: lysM domain receptor-like kinase 4    65.5    8e-10   Brachypodium distachyon [annual false brome]
gb|EYU33013.1|  hypothetical protein MIMGU_mgv1a009449mg              63.2    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_009400476.1|  PREDICTED: lysM domain receptor-like kinase 4    60.8    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003572131.2|  PREDICTED: receptor-like protein kinase isof...  50.8    7e-05   Brachypodium distachyon [annual false brome]
ref|XP_010235055.1|  PREDICTED: receptor-like protein kinase isof...  50.8    7e-05   Brachypodium distachyon [annual false brome]
ref|XP_004509233.1|  PREDICTED: protein LYK5-like                     49.7    1e-04   Cicer arietinum [garbanzo]
gb|KJB40216.1|  hypothetical protein B456_007G051800                  49.3    2e-04   Gossypium raimondii
gb|KJB69337.1|  hypothetical protein B456_011G017600                  48.9    3e-04   Gossypium raimondii
ref|XP_006351555.1|  PREDICTED: cysteine-rich receptor-like prote...  48.9    3e-04   
ref|XP_010063641.1|  PREDICTED: receptor-like protein kinase          48.1    6e-04   Eucalyptus grandis [rose gum]
ref|XP_010228936.1|  PREDICTED: protein LYK5-like                     47.4    0.001   
ref|XP_009615784.1|  PREDICTED: probable LRR receptor-like serine...  47.4    0.001   Nicotiana tomentosiformis



>ref|XP_007034941.1| Kinase family protein / peptidoglycan-binding LysM domain-containing 
protein [Theobroma cacao]
 gb|EOY05867.1| Kinase family protein / peptidoglycan-binding LysM domain-containing 
protein [Theobroma cacao]
Length=617

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EERK  +VREWMD  L  ESCSMESV +VMAVA+ACLNKDPS+RP+MVDIVYALSKS+D
Sbjct  540  NEERKVKKVREWMDGRLLEESCSMESVISVMAVAIACLNKDPSRRPSMVDIVYALSKSDD  599

Query  105  LFFDVSDDGLSSGPVTAR  52
            LFFDVS+DGLS+ PV AR
Sbjct  600  LFFDVSEDGLSAPPVVAR  617



>ref|XP_008349656.1| PREDICTED: protein LYK5-like [Malus domestica]
Length=326

 Score =   114 bits (284),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EE KA ++REW+D  L  ESCS+ES+ NV+ VA+ACL+KDPSKRPTMVDIVYALSKS+D
Sbjct  249  NEEEKARKLREWVDNELFLESCSIESILNVVTVAIACLHKDPSKRPTMVDIVYALSKSDD  308

Query  105  LFFDVSDDGLSSGPVTAR  52
            LFFD+SD+G S+ PV AR
Sbjct  309  LFFDISDNGSSAPPVRAR  326



>ref|XP_008224192.1| PREDICTED: lysM domain receptor-like kinase 4 isoform X1 [Prunus 
mume]
Length=663

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EE KA ++REW+D  L  ESCSMES+ NV+ VA+AC+++DPSKRP+MVDIVYAL KS+D
Sbjct  580  NEEEKARKLREWVDRELFLESCSMESIVNVVTVAIACVHRDPSKRPSMVDIVYALCKSDD  639

Query  105  LFFDVSDDGLSSGPVTAR  52
            LFFD+SDDGLS+ PV AR
Sbjct  640  LFFDISDDGLSAPPVRAR  657



>ref|XP_004288425.1| PREDICTED: lysM domain receptor-like kinase 4 [Fragaria vesca 
subsp. vesca]
Length=623

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEE K  ++++WMD  L  ESCSMES+ NV+ VAVACL+KDPSKRPTMVDIVYAL KS+D
Sbjct  546  SEEEKLNKLKQWMDKELFLESCSMESIVNVVTVAVACLHKDPSKRPTMVDIVYALCKSDD  605

Query  105  LFFDVSDDGLSSGPVTAR  52
            LFFD+SDDG S+ PV AR
Sbjct  606  LFFDISDDGSSAPPVRAR  623



>gb|AAL57228.1| protein kinase-like protein [Capsicum annuum]
Length=124

 Score =   107 bits (267),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD    RE  +MESV NVM+VA++C+NKDPS+RP MV+IVYALSKS D
Sbjct  47   SEERKVRKLQEWMDESFLREELTMESVVNVMSVAISCVNKDPSRRPGMVEIVYALSKSID  106

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++GLS   VTAR
Sbjct  107  LFSDVSEEGLSPRQVTAR  124



>gb|KJB38269.1| hypothetical protein B456_006G245600 [Gossypium raimondii]
Length=612

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EERK  QVRE+MD CL  +S SME V NVMAVA++CLNKDP+KRP+MVDIVYALSKS+D
Sbjct  535  NEERKERQVREFMDGCLLEQSLSMEGVMNVMAVAISCLNKDPTKRPSMVDIVYALSKSDD  594

Query  105  LFFDVSDDGLSSGPVTAR  52
            L FD S+D LS+ PV AR
Sbjct  595  LVFDESEDSLSAPPVVAR  612



>ref|XP_009588827.1| PREDICTED: protein LYK5-like [Nicotiana tomentosiformis]
Length=634

 Score =   114 bits (285),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD  L RE C+MESV NVM+VA++CLNKDPSKRP+MV+IVYALSKS D
Sbjct  557  SEERKVKKLQEWMDDSLLREECTMESVMNVMSVAISCLNKDPSKRPSMVEIVYALSKSID  616

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF D+S++GLS   VT+R
Sbjct  617  LFSDISEEGLSPRQVTSR  634



>ref|XP_009337287.1| PREDICTED: lysM domain receptor-like kinase 4 [Pyrus x bretschneideri]
Length=628

 Score =   114 bits (284),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+ KA ++REW+D  L  ESCS+ES+ NV+ VA+ACL+KDPSKRPTMVDIVYALSKS+D
Sbjct  551  NEDEKARKLREWVDNELFSESCSVESILNVVTVAIACLHKDPSKRPTMVDIVYALSKSDD  610

Query  105  LFFDVSDDGLSSGPVTAR  52
            LFFDVSDD  S+ PV AR
Sbjct  611  LFFDVSDDASSAPPVRAR  628



>ref|XP_011027465.1| PREDICTED: lysM domain receptor-like kinase 4 [Populus euphratica]
Length=620

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EERK  ++  WMD  L  ESCSMESV N MAVA+ACL++DPSKRP+MVDIVYAL KS+DL
Sbjct  544  EERKVKRLTAWMDKVLLEESCSMESVMNTMAVAIACLHRDPSKRPSMVDIVYALCKSDDL  603

Query  102  FFDVSDDGLSSGPVTAR  52
            F+D+S+DGLS+  VTAR
Sbjct  604  FYDISEDGLSNPQVTAR  620



>ref|XP_009762994.1| PREDICTED: lysM domain receptor-like kinase 4 [Nicotiana sylvestris]
Length=646

 Score =   114 bits (284),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD  L RE C+MESV NVM+VA++CLNKDPSKRP+MV+IVYALSKS D
Sbjct  569  SEERKLKKLQEWMDDSLLREECTMESVMNVMSVAISCLNKDPSKRPSMVEIVYALSKSID  628

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++G S   VTAR
Sbjct  629  LFSDVSEEGFSPRQVTAR  646



>ref|XP_008224193.1| PREDICTED: lysM domain receptor-like kinase 4 isoform X2 [Prunus 
mume]
Length=658

 Score =   113 bits (283),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EE KA ++REW+D  L  ESCSMES+ NV+ VA+AC+++DPSKRP+MVDIVYAL KS+D
Sbjct  580  NEEEKARKLREWVDRELFLESCSMESIVNVVTVAIACVHRDPSKRPSMVDIVYALCKSDD  639

Query  105  LFFDVSDDGLSSGPVTA  55
            LFFD+SDDGLS+ PV A
Sbjct  640  LFFDISDDGLSAPPVRA  656



>ref|XP_007221990.1| hypothetical protein PRUPE_ppa002872mg [Prunus persica]
 gb|EMJ23189.1| hypothetical protein PRUPE_ppa002872mg [Prunus persica]
Length=626

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EE KA ++ EW+D  L  ESCSMES+ NV+ VA+AC+++DPSKRP+MVDIVYAL KS+D
Sbjct  549  NEEEKARKLHEWVDRELFLESCSMESIVNVLTVAIACVHRDPSKRPSMVDIVYALCKSDD  608

Query  105  LFFDVSDDGLSSGPVTAR  52
            LFFD+SDDGLS+ PV AR
Sbjct  609  LFFDISDDGLSAPPVRAR  626



>ref|XP_006368087.1| PREDICTED: protein LYK5-like [Solanum tuberosum]
Length=138

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD  L RE  +MESV NVM VA++CLNKDPS+RP M++IVYALSKS D
Sbjct  61   SEERKVRKLQEWMDESLLREELTMESVVNVMTVAISCLNKDPSRRPGMIEIVYALSKSID  120

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++G S   VTAR
Sbjct  121  LFSDVSEEGPSPRQVTAR  138



>gb|KDP40268.1| hypothetical protein JCGZ_02266 [Jatropha curcas]
Length=618

 Score =   112 bits (279),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EERK  +++E MD  L  ESCSMESV NVM +AVACL++DP++RP+MVDIVYAL KS+D
Sbjct  541  NEERKEHRLKELMDENLLEESCSMESVMNVMTIAVACLHRDPTRRPSMVDIVYALCKSDD  600

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF+D+S+DGLS   VTAR
Sbjct  601  LFYDISEDGLSDPQVTAR  618



>ref|XP_002311653.2| hypothetical protein POPTR_0008s16050g [Populus trichocarpa]
 gb|EEE89020.2| hypothetical protein POPTR_0008s16050g [Populus trichocarpa]
Length=621

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E RK  ++  WMD  L  ESCSMESV N MAVA+ACL++DPSKRP+MVDIVYAL KS+DL
Sbjct  545  ERRKVKRLTAWMDKVLLEESCSMESVMNTMAVAIACLHRDPSKRPSMVDIVYALCKSDDL  604

Query  102  FFDVSDDGLSSGPVTAR  52
            FFD+S+DGLS+  V AR
Sbjct  605  FFDISEDGLSNPQVMAR  621



>ref|XP_011030594.1| PREDICTED: lysM domain receptor-like kinase 4 [Populus euphratica]
Length=619

 Score =   110 bits (274),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EERK  ++  WMD  L  +SCSMESV N MAVA+ACL++DPSKRP+MVDIVYAL K++DL
Sbjct  543  EERKVKRLTLWMDKVLLEQSCSMESVMNAMAVAIACLHRDPSKRPSMVDIVYALCKTDDL  602

Query  102  FFDVSDDGLSSGPVTAR  52
            FFD+S+D LS   VTAR
Sbjct  603  FFDISEDVLSDPQVTAR  619



>ref|XP_004247634.1| PREDICTED: protein LYK5-like [Solanum lycopersicum]
Length=629

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD  L RE   MESV NVM+VA++CLNKDPSKRP M++IVYALSKS D
Sbjct  552  SEERKVRKLQEWMDGSLLREELIMESVVNVMSVAISCLNKDPSKRPGMIEIVYALSKSID  611

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++GLS   VTAR
Sbjct  612  LFTDVSEEGLSPRQVTAR  629



>ref|XP_006362183.1| PREDICTED: protein LYK5-like [Solanum tuberosum]
Length=626

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD  L RE  +MESV NVM+VA++CLNKDPS+RP M++IVYALSKS D
Sbjct  549  SEERKVRKLQEWMDDSLLREELTMESVVNVMSVAISCLNKDPSRRPGMIEIVYALSKSID  608

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++GLS   VTAR
Sbjct  609  LFTDVSEEGLSPRQVTAR  626



>ref|XP_004247635.1| PREDICTED: protein LYK5-like [Solanum lycopersicum]
Length=628

 Score =   108 bits (270),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK ++++EWMD  L RE  ++ESV NVM+VA++CLNKDPS+RP M++IVYALSKS D
Sbjct  551  SEERKVSKLQEWMDESLLREELTIESVVNVMSVAISCLNKDPSRRPGMIEIVYALSKSID  610

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++GLS   VTAR
Sbjct  611  LFSDVSEEGLSPRQVTAR  628



>emb|CAN66762.1| hypothetical protein VITISV_032728 [Vitis vinifera]
Length=591

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+ KA +V++WMD  L RESCSM+SV NVMAVA AC ++DPSKRP+MVDIVYAL K  D 
Sbjct  515  EKVKAKRVKDWMDEGLLRESCSMDSVINVMAVATACTHRDPSKRPSMVDIVYALCKCEDF  574

Query  102  FFDVSDDGLSSGPVTAR  52
            FFD+S+DGL+   V AR
Sbjct  575  FFDISEDGLAPAAVIAR  591



>emb|CBI26350.3| unnamed protein product [Vitis vinifera]
Length=595

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+ KA +V++WMD  L RESCSM+SV NVMAVA AC ++DPSKRP+MVDIVYAL K  D 
Sbjct  519  EKVKAKRVKDWMDEGLLRESCSMDSVINVMAVATACTHRDPSKRPSMVDIVYALCKCEDF  578

Query  102  FFDVSDDGLSSGPVTAR  52
            FFD+S+DGL+   V AR
Sbjct  579  FFDISEDGLAPAAVIAR  595



>ref|XP_006362181.1| PREDICTED: protein LYK5-like [Solanum tuberosum]
Length=625

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD  L RE  +MESV NVM VA++CLNKDPS+RP M++IVYALSKS D
Sbjct  548  SEERKVRKLQEWMDESLLREELTMESVVNVMTVAISCLNKDPSRRPGMIEIVYALSKSID  607

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++G S   VTAR
Sbjct  608  LFSDVSEEGPSPRQVTAR  625



>ref|XP_002280070.1| PREDICTED: lysM domain receptor-like kinase 4 [Vitis vinifera]
Length=622

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+ KA +V++WMD  L RESCSM+SV NVMAVA AC ++DPSKRP+MVDIVYAL K  D 
Sbjct  546  EKVKAKRVKDWMDEGLLRESCSMDSVINVMAVATACTHRDPSKRPSMVDIVYALCKCEDF  605

Query  102  FFDVSDDGLSSGPVTAR  52
            FFD+S+DGL+   V AR
Sbjct  606  FFDISEDGLAPAAVIAR  622



>ref|XP_006362182.1| PREDICTED: protein LYK5-like [Solanum tuberosum]
Length=626

 Score =   106 bits (264),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +++EWMD  L RE  +MESV NVM VA++CLNKDPS+RP M++IVYALSKS D
Sbjct  549  SEERKVRKLQEWMDESLLREELTMESVVNVMTVAISCLNKDPSRRPGMIEIVYALSKSID  608

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF DVS++G S   VTAR
Sbjct  609  LFSDVSEEGPSPRQVTAR  626



>gb|AFK39301.1| unknown [Lotus japonicus]
Length=158

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E  K  ++REW+D  + RE+CSMES+  V+AVA+ACL++DP+KRP++VDIVYALSKS D
Sbjct  81   NEVEKGRRLREWLDKGVLRETCSMESLMGVVAVAIACLHRDPTKRPSIVDIVYALSKSED  140

Query  105  LFFDVSDDGLSSGPVTAR  52
            + FDVSD+G+ S    AR
Sbjct  141  IGFDVSDEGIGSPRAMAR  158



>ref|XP_010684773.1| PREDICTED: protein LYK5-like [Beta vulgaris subsp. vulgaris]
Length=635

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EE K  ++ EWMD    +ES S+E + N+MAVAVAC+N+DPSKRP+MVD+VYAL KS+D
Sbjct  558  TEEEKVGKLMEWMDSFFKKESPSLEGLMNMMAVAVACVNRDPSKRPSMVDVVYALCKSDD  617

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF+D+S + LSS P+ AR
Sbjct  618  LFYDISGNELSSSPLAAR  635



>ref|XP_002315740.2| hypothetical protein POPTR_0010s08920g [Populus trichocarpa]
 gb|EEF01911.2| hypothetical protein POPTR_0010s08920g [Populus trichocarpa]
Length=619

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EERK  ++  WMD  L  +SC MESV N M VA+ACL++DPSKRP+MVDIVYAL K++DL
Sbjct  543  EERKVKRLTPWMDKVLLEQSCLMESVMNAMVVAIACLHRDPSKRPSMVDIVYALCKTDDL  602

Query  102  FFDVSDDGLSSGPVTAR  52
            FFD+S+D LS   V AR
Sbjct  603  FFDISEDVLSDPQVMAR  619



>ref|XP_002517029.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45192.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=615

 Score =   103 bits (256),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EE+K  +++ +MD  L RESCSMES+ +VM VAVACL+KDP+KRP+MVDIVY L KS D
Sbjct  539  NEEKKVKRLKGFMDESLLRESCSMESIIHVMNVAVACLHKDPAKRPSMVDIVYDLCKS-D  597

Query  105  LFFDVSDDGLSSGPVTAR  52
            LFFD+S+DGLS   + AR
Sbjct  598  LFFDISEDGLSDSQIVAR  615



>emb|CDP20691.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+RK  ++REWMD  L +E+ SMESV NVM VA+ACL++DPSKRP+MVDIVYAL KS+D
Sbjct  552  TEDRKVKKMREWMDEYLLKETISMESVVNVMTVALACLSRDPSKRPSMVDIVYALCKSDD  611

Query  105  LFFDVSDDGLS-SGPVTAR  52
            L+FD+S++G S    VTAR
Sbjct  612  LYFDLSEEGSSPRSVVTAR  630



>ref|XP_010105398.1| Proline-rich receptor-like protein kinase PERK9 [Morus notabilis]
 gb|EXC04576.1| Proline-rich receptor-like protein kinase PERK9 [Morus notabilis]
Length=625

 Score =   102 bits (254),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EE K  ++++WMD     ES SM+S+  VMAVAVACL++DPSKRP+MVDIVYAL KS+D
Sbjct  548  NEEEKVKKLKDWMDHNFLEESYSMDSMMGVMAVAVACLHRDPSKRPSMVDIVYALCKSDD  607

Query  105  LFFDVSDDGLSSGPVTAR  52
            LF+D+SDD LS   V AR
Sbjct  608  LFYDISDDTLSGSQVIAR  625



>gb|ABY75166.1| putative LysM receptor kinase [Arachis diogoi]
Length=99

 Score = 93.6 bits (231),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            S+E K  +VREWMD  + +++ SM+S+  V+ +A+ACL+K+PSKRP++VD+VYAL KS+D
Sbjct  22   SDEEKGRRVREWMDKAMLKDTISMDSLLGVLGIAIACLHKEPSKRPSIVDVVYALCKSDD  81

Query  105  LFFDVSDDGLSSGPVTAR  52
              F+ S+DG+ S  VTAR
Sbjct  82   AGFETSEDGIGSPKVTAR  99



>gb|KJB72197.1| hypothetical protein B456_011G164600 [Gossypium raimondii]
Length=615

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SEERK  +V+E+MD  L    C MESV NVM +A+AC+NKDP +RP MVD+VYALS ++D
Sbjct  539  SEERKVKKVKEFMDGGLEGGGCWMESVMNVMGIAIACVNKDPRRRPRMVDVVYALSMTHD  598

Query  105  LFFDVSDDGLS  73
            LFF VS+DGLS
Sbjct  599  LFFHVSEDGLS  609



>dbj|BAO45880.1| receptor-like protein kinase [Acacia mangium]
Length=641

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SE+ K  ++REW+D  L RE+ SMES+  V+ +A+ACL+KDP+KRP+MVDIVYALSKS D
Sbjct  564  SEQEKGMRLREWLDGSLMRETLSMESLMGVLNIALACLHKDPTKRPSMVDIVYALSKSED  623

Query  105  LFFDVSDDGLSSGPVTAR  52
              FD SDD + S  V+AR
Sbjct  624  ANFDTSDDNIGSPLVSAR  641



>ref|XP_003613904.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=660

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+ KA +++EW+D  + +E+CSMES+  V+ VA+ACLN+DPSKRP+++DIVY+LSK  +
Sbjct  583  NEQEKARRLKEWLDRTMLKETCSMESLMGVLHVAIACLNRDPSKRPSIIDIVYSLSKCEE  642

Query  105  LFFDVSDDGLSSGPVTAR  52
              F++SDDG  S  + AR
Sbjct  643  AGFELSDDGFGSERLVAR  660



>gb|AES96862.2| LysM-domain receptor-like kinase [Medicago truncatula]
Length=632

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+ KA +++EW+D  + +E+CSMES+  V+ VA+ACLN+DPSKRP+++DIVY+LSK  +
Sbjct  555  NEQEKARRLKEWLDRTMLKETCSMESLMGVLHVAIACLNRDPSKRPSIIDIVYSLSKCEE  614

Query  105  LFFDVSDDGLSSGPVTAR  52
              F++SDDG  S  + AR
Sbjct  615  AGFELSDDGFGSERLVAR  632



>ref|XP_011091102.1| PREDICTED: lysM domain receptor-like kinase 4 [Sesamum indicum]
Length=609

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  276  RKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFF  97
            ++  ++REWMD  L +ESC+MESVS+V++VA+ACLNKDP++RP+MV+IVYALSKS+D FF
Sbjct  535  KQLTKLREWMDESLLKESCTMESVSSVVSVALACLNKDPARRPSMVEIVYALSKSDDFFF  594

Query  96   DVSDDGLSSGPVTAR  52
            DVS+DG S   V AR
Sbjct  595  DVSEDGFSPRQVVAR  609



>gb|KHN15405.1| Putative receptor-like protein kinase [Glycine soja]
Length=517

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+ K  +++EW+D  + RE+ SMES+   + VA+ACL++DPSKRP+++DIVYALSKS D
Sbjct  440  NEQEKTRRLKEWLDKDILRETFSMESLMGALTVAIACLHRDPSKRPSIMDIVYALSKSED  499

Query  105  LFFDVSDDGLSSGPVTAR  52
            + FD+SDDG+ S  V AR
Sbjct  500  MGFDISDDGIGSPRVIAR  517



>ref|XP_003518770.1| PREDICTED: lysM domain receptor-like kinase 4-like [Glycine max]
Length=625

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+ K  +++EW+D  + RE+ SMES+   + VA+ACL++DPSKRP+++DIVYALSKS D
Sbjct  548  NEQEKTRRLKEWLDKDILRETFSMESLMGALTVAIACLHRDPSKRPSIMDIVYALSKSED  607

Query  105  LFFDVSDDGLSSGPVTAR  52
            + FD+SDDG+ S  V AR
Sbjct  608  MGFDISDDGIGSPRVIAR  625



>ref|XP_008366230.1| PREDICTED: LOW QUALITY PROTEIN: protein LYK5-like [Malus domestica]
Length=626

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 8/86 (9%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMES----VSNVMAVAVACLNKDPSKRPTMVD----IV  130
            +EE KA ++REW+D  L  ESCSMES    V+NV+AVA+ CL+KDPSKRPTMVD    IV
Sbjct  541  NEEEKARKLREWVDNELFLESCSMESKLNVVTNVVAVAITCLHKDPSKRPTMVDMXDDIV  600

Query  129  YALSKSNDLFFDVSDDGLSSGPVTAR  52
            YAL KS+DLFFD+SDDG S+ PV AR
Sbjct  601  YALCKSDDLFFDISDDGSSAPPVRAR  626



>ref|XP_007145934.1| hypothetical protein PHAVU_007G280200g [Phaseolus vulgaris]
 gb|ESW17928.1| hypothetical protein PHAVU_007G280200g [Phaseolus vulgaris]
Length=639

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            SE+ K  ++REW+D  + RE+C MES+  V+ VA+ACL K+ SKRP+++DIVYAL KS D
Sbjct  562  SEQEKVRRLREWLDKDILRETCPMESLMGVLTVAIACLQKEQSKRPSIMDIVYALCKSED  621

Query  105  LFFDVSDDGLSSGPVTAR  52
            L FD+SD G+ S  V AR
Sbjct  622  LGFDISDGGIGSPRVVAR  639



>ref|XP_004134429.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like 
[Cucumis sativus]
Length=640

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+ K   +R W+D  L  +SC MES+ + M VAV+CL KDP+KRP+MV++VYALSK++D 
Sbjct  564  EKDKLESLRSWIDEALFEQSCPMESLMDAMNVAVSCLQKDPTKRPSMVEVVYALSKTDDA  623

Query  102  FFDVSDDGLSSGPVTAR  52
             FD SDD LS+ P+TAR
Sbjct  624  VFDFSDDNLSAPPLTAR  640



>ref|XP_004165057.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like 
[Cucumis sativus]
Length=631

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+ K   +R W+D  L  +SC MES+ + M VAV+CL KDP+KRP+MV++VYALSK++D 
Sbjct  555  EKDKLESLRSWIDEALFEQSCPMESLMDAMNVAVSCLQKDPTKRPSMVEVVYALSKTDDA  614

Query  102  FFDVSDDGLSSGPVTAR  52
             FD SDD LS+ P+TAR
Sbjct  615  VFDFSDDNLSAPPLTAR  631



>gb|KGN56921.1| hypothetical protein Csa_3G144110 [Cucumis sativus]
Length=631

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+ K   +R W+D  L  +SC MES+ + M VAV+CL KDP+KRP+MV++VYALSK++D 
Sbjct  555  EKDKLESLRSWIDEALFEQSCPMESLMDAMNVAVSCLQKDPTKRPSMVEVVYALSKTDDA  614

Query  102  FFDVSDDGLSSGPVTAR  52
             FD SDD LS+ P+TAR
Sbjct  615  VFDFSDDNLSAPPLTAR  631



>ref|XP_004498011.1| PREDICTED: lysM domain receptor-like kinase 4-like [Cicer arietinum]
Length=633

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+ KA +++ W+D  + +E+CSMES+  V+ VA+ACL++DPSKRP+++DIVY LSKS D
Sbjct  556  NEQEKARRLKRWLDEDILKETCSMESLMGVLHVAIACLHRDPSKRPSIMDIVYGLSKSED  615

Query  105  LFFDVSDDGLSSGPVTAR  52
              F++SD+G+ S  + AR
Sbjct  616  TGFELSDEGIGSPRLMAR  633



>ref|XP_010274212.1| PREDICTED: protein LYK5-like [Nelumbo nucifera]
Length=611

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +E+ K  +++ WMD CL  ES S ESV NVMAVA ACL  +PSKRP MVDIVY L KS+ 
Sbjct  534  NEDEKERKLKAWMDSCLVEESGSKESVMNVMAVAQACLQTNPSKRPNMVDIVYMLCKSDA  593

Query  105  LFFDVSDDGLSSGPVTAR  52
            L  D S D LS   +TAR
Sbjct  594  LSLDFSVDSLSFATLTAR  611



>ref|XP_008438594.1| PREDICTED: lysM domain receptor-like kinase 4 [Cucumis melo]
Length=634

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+ K   ++ W+D  L  +SC MES+ + M VAV+CL KDP+KRP+MV++VYALSK+++ 
Sbjct  558  EKDKLESLKSWIDEALFEQSCPMESLMDAMNVAVSCLQKDPTKRPSMVEVVYALSKTDEA  617

Query  102  FFDVSDDGLSSGPVTAR  52
             FD SDD LS+ P+TAR
Sbjct  618  VFDFSDDNLSAPPLTAR  634



>ref|XP_006489496.1| PREDICTED: lysM domain receptor-like kinase 4-like [Citrus sinensis]
Length=625

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EERK  +V+EWMD  L ++S SMESV + M +A+ACL+KDPSKRP+MVDIVYALSKS+D
Sbjct  548  NEERKVKRVKEWMDEILLKDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALSKSDD  607

Query  105  LFFDVSDDGLSSGPVTAR  52
            L  D+SDD LSS  V+AR
Sbjct  608  LLSDISDDALSSSQVSAR  625



>ref|XP_006420086.1| hypothetical protein CICLE_v10004551mg [Citrus clementina]
 gb|ESR33326.1| hypothetical protein CICLE_v10004551mg [Citrus clementina]
Length=625

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            +EERK  +V+EWMD  L ++S SMESV + M +A+ACL+KDPSKRP+MVDIVYALSKS+D
Sbjct  548  NEERKVKRVKEWMDKILLQDSISMESVMSAMGIAIACLHKDPSKRPSMVDIVYALSKSDD  607

Query  105  LFFDVSDDGLSSGPVTAR  52
            L  D+SDD LSS  V+AR
Sbjct  608  LLSDISDDALSSSQVSAR  625



>ref|XP_008779539.1| PREDICTED: protein LYK5-like, partial [Phoenix dactylifera]
Length=250

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = -3

Query  279  ERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLF  100
            +R  A V  WMDP L  +SC +++V  V+ VA ACL +DPSKRPTMVD+ Y LSK+++ F
Sbjct  171  QRTEANVVAWMDPVLREQSCPIDTVVTVLNVAKACLQRDPSKRPTMVDVAYTLSKADEQF  230

Query  99   FDVSDDGLSSG  67
             D S DGLS G
Sbjct  231  SDYSGDGLSVG  241



>ref|NP_001140876.1| uncharacterized protein LOC100272952 [Zea mays]
 gb|ACF84859.1| unknown [Zea mays]
Length=568

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            +ER  A+V  WMDP LA ++C + SV+ V++VA ACL+KDPSKRP+MVD+ Y LSK+++ 
Sbjct  489  DERLEARVAAWMDPALAEQTCPLGSVATVVSVARACLHKDPSKRPSMVDVAYTLSKADEH  548

Query  102  FFDVSDDGLS---SGPVTAR  52
            F D S + +S   SG + AR
Sbjct  549  FADYSGESVSVDGSGEIAAR  568



>gb|AFW72812.1| putative lysM-domain receptor-like protein kinase family protein 
[Zea mays]
Length=647

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            +ER  A+V  WMDP LA ++C + SV+ V++VA ACL+KDPSKRP+MVD+ Y LSK+++ 
Sbjct  568  DERLEARVAAWMDPALAEQTCPLGSVATVVSVARACLHKDPSKRPSMVDVAYTLSKADEH  627

Query  102  FFDVSDDGLS---SGPVTAR  52
            F D S + +S   SG + AR
Sbjct  628  FADYSGESVSVDGSGEIAAR  647



>ref|NP_001047747.1| Os02g0681700 [Oryza sativa Japonica Group]
 dbj|BAD29395.1| putative serine/threonine-specific protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAF09661.1| Os02g0681700 [Oryza sativa Japonica Group]
Length=257

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EER  A+V  WMDP LA ++C   SV++V++VA ACL++DP+KRP+MVD+ Y LSK+++ 
Sbjct  178  EERLEARVAAWMDPALAEQTCPPGSVASVVSVAKACLHRDPAKRPSMVDVAYTLSKADES  237

Query  102  FFDVSDDGL---SSGPVTAR  52
            F D S + +   SSG + AR
Sbjct  238  FGDYSGESVSVASSGGIAAR  257



>ref|XP_010246324.1| PREDICTED: protein LYK5-like [Nelumbo nucifera]
Length=613

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -3

Query  261  VREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVSDD  82
            ++ WMD  L  ESCS +SV NV+ VA ACL K+PSKRP+MVDIVY L KS+DL  D+S+D
Sbjct  544  LKAWMDAFLVGESCSKKSVMNVITVAEACLQKEPSKRPSMVDIVYMLCKSDDLSLDLSED  603

Query  81   GLSSGPVTAR  52
              S   V+AR
Sbjct  604  SKSVTNVSAR  613



>gb|EEE57585.1| hypothetical protein OsJ_07939 [Oryza sativa Japonica Group]
Length=362

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EER  A+V  WMDP LA ++C   SV++V++VA ACL++DP+KRP+MVD+ Y LSK+++ 
Sbjct  283  EERLEARVAAWMDPALAEQTCPPGSVASVVSVAKACLHRDPAKRPSMVDVAYTLSKADES  342

Query  102  FFDVSDDGL---SSGPVTAR  52
            F D S + +   SSG + AR
Sbjct  343  FGDYSGESVSVASSGGIAAR  362



>ref|XP_009380288.1| PREDICTED: lysM domain receptor-like kinase 4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380296.1| PREDICTED: lysM domain receptor-like kinase 4 [Musa acuminata 
subsp. malaccensis]
Length=638

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -3

Query  267  AQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVS  88
            A +  WMDP LA++SC MESV+ VM +A  CL +DPSKRPTMV++ Y LSK+++LF D S
Sbjct  567  ASIMAWMDPVLAKQSCPMESVATVMNIARDCLRRDPSKRPTMVEVAYNLSKADELFSDYS  626

Query  87   DDGLS  73
             D LS
Sbjct  627  ADTLS  631



>gb|EAY87082.1| hypothetical protein OsI_08480 [Oryza sativa Indica Group]
Length=651

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EER  A+V  WMDP LA ++C   SV++V++VA ACL++DP+KRP+MVD+ Y LSK+++ 
Sbjct  572  EERLEARVAAWMDPALAEQTCPPGSVASVVSVAKACLHRDPAKRPSMVDVAYTLSKADES  631

Query  102  FFDVSDDGL---SSGPVTAR  52
            F D S + +   SSG + AR
Sbjct  632  FGDYSGESVSVASSGGIAAR  651



>dbj|BAJ88826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=717

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+R  A+   WMDP LA ++C   SV+ VM VA ACL +DPSKRP+MVD+ Y LS++++ 
Sbjct  638  EDRLEARAAAWMDPVLAEQTCPPGSVATVMGVARACLQRDPSKRPSMVDVAYTLSRADEY  697

Query  102  FFDVSDDGLS---SGPVTAR  52
            F D S + +S   SG + AR
Sbjct  698  FADYSGESVSVDGSGEIAAR  717



>dbj|BAJ89552.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=650

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            E+R  A+   WMDP LA ++C   SV+ VM VA ACL +DPSKRP+MVD+ Y LS++++ 
Sbjct  571  EDRLEARAAAWMDPVLAEQTCPPGSVATVMGVARACLQRDPSKRPSMVDVAYTLSRADEY  630

Query  102  FFDVSDDGLS---SGPVTAR  52
            F D S + +S   SG + AR
Sbjct  631  FADYSGESVSVDGSGEIAAR  650



>ref|XP_004953457.1| PREDICTED: lysM domain receptor-like kinase 4-like [Setaria italica]
Length=647

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            +ER  A+V  WMDP L  ++C   SV++V++VA ACL+KDPSKRP+MVD+ Y LSK+++ 
Sbjct  568  DERLEARVAAWMDPALKEQTCPPGSVASVVSVARACLHKDPSKRPSMVDVAYTLSKADEH  627

Query  102  FFDVSDDGLS---SGPVTAR  52
            F D S + +S   SG + AR
Sbjct  628  FADYSGESVSVDGSGEIAAR  647



>ref|XP_010024053.1| PREDICTED: lysM domain receptor-like kinase 4 [Eucalyptus grandis]
 gb|KCW60460.1| hypothetical protein EUGRSUZ_H03181 [Eucalyptus grandis]
Length=632

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = -3

Query  282  EERKAAQVREWMD-PCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSND  106
            E  KA +++ WMD   LA E+CS ESV++VM++A++CLN+DPSKRP+MV+IVYAL +S+D
Sbjct  555  EIGKAERLKGWMDEGLLADEACSTESVASVMSIAISCLNRDPSKRPSMVEIVYALCRSDD  614

Query  105  LFFDVSDDGLSS  70
            + FD S+D  S+
Sbjct  615  I-FDFSEDASST  625



>ref|XP_010910680.1| PREDICTED: LOW QUALITY PROTEIN: lysM domain receptor-like kinase 
4 [Elaeis guineensis]
Length=650

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -3

Query  273  KAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFD  94
            + A +  W+DP L  +SC ++SV  V+ VA ACL +DPSKRPTMVD+ Y LSK+++   D
Sbjct  573  REANLVAWIDPVLREQSCPVDSVVTVLNVAKACLQRDPSKRPTMVDVAYTLSKADEQLSD  632

Query  93   VSDDGLSSG  67
             S DGLS G
Sbjct  633  YSGDGLSVG  641



>ref|XP_006829101.1| hypothetical protein AMTR_s00001p00263560 [Amborella trichopoda]
 gb|ERM96517.1| hypothetical protein AMTR_s00001p00263560 [Amborella trichopoda]
Length=627

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = -3

Query  279  ERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLF  100
            E K  ++R WMD  L  +SCS+ESV NV  VA AC++KDPSKRP++ D+VY LSK+++L 
Sbjct  548  ENKEERLRGWMDGRLFDDSCSVESVMNVAVVARACVSKDPSKRPSLADVVYILSKADELC  607

Query  99   FDVSD---DGLS-SGPVTAR  52
            FD+S    D +S +  VTAR
Sbjct  608  FDLSSASHDSISVNSGVTAR  627



>gb|EPS63752.1| hypothetical protein M569_11034, partial [Genlisea aurea]
Length=616

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -3

Query  264  QVREWMDPCLAR-ESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVS  88
            +VREW+D  + + E+ S ESV  V+ VAVACL KDP+ RP+M++IVYALSKS+   FD+S
Sbjct  545  RVREWVDQSVLKDETVSFESVMRVVGVAVACLGKDPAMRPSMIEIVYALSKSDSQSFDMS  604

Query  87   DDGLSSGPVTAR  52
            + GLS   V AR
Sbjct  605  ETGLSPRGVVAR  616



>gb|KDO53930.1| hypothetical protein CISIN_1g047377mg [Citrus sinensis]
Length=160

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  285  SEERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYAL  121
            +E RK  +V+EWMD  L ++S SME V   M +A+ACL+KDPSKRP+MVDIV+A+
Sbjct  77   NEGRKVKRVKEWMDEILLQDSISMEGVMRAMGIAIACLHKDPSKRPSMVDIVHAV  131


 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  216  MESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVSDDGLSS  70
            MESV + M +A+ACL+KDPSKRP+MVDIVYALSKS+DL  D+SDD LSS
Sbjct  1    MESVMSAMGIAIACLHKDPSKRPSMVDIVYALSKSDDLLSDISDDALSS  49



>ref|XP_010026876.1| PREDICTED: receptor-like serine/threonine-protein kinase At1g78530 
[Eucalyptus grandis]
Length=106

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  273  KAAQVREWMDPCLARES-CSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLF  100
            +  ++REWM   L  +S CSME+V++ M+V ++CLN+DP  RP+MVDIVYAL KS+D+F
Sbjct  45   RLERLREWMGKALVADSTCSMETVASGMSVVISCLNRDPLNRPSMVDIVYALCKSDDVF  103



>ref|XP_003572823.2| PREDICTED: lysM domain receptor-like kinase 4 [Brachypodium distachyon]
Length=682

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EE+  A+   WMDP LA +SC   SV+ V++VA ACL +DP+KRP+MVD+ Y LS++ + 
Sbjct  603  EEKLEARAAAWMDPVLAEQSCPPGSVAAVVSVARACLQRDPAKRPSMVDVAYTLSRAEEY  662

Query  102  FFDVSDDGLS---SGPVTAR  52
            F D S + +S   SG + AR
Sbjct  663  FADYSGESVSVNGSGELAAR  682



>gb|EYU33013.1| hypothetical protein MIMGU_mgv1a009449mg [Erythranthe guttata]
Length=342

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = -3

Query  273  KAAQVREWMDPCLARESCSM---ESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            K  ++R WM   L  +   M   ESV +V+AVAVAC+N+DP+KRP+MV+IVYALSKS+DL
Sbjct  266  KGGKLRGWMAEGLVGDETIMSSWESVVSVVAVAVACVNRDPTKRPSMVEIVYALSKSDDL  325

Query  102  FFDVSDDGLSSGPVTAR  52
            FFD S+D  S   V AR
Sbjct  326  FFDFSEDEFSPRQVIAR  342



>ref|XP_009400476.1| PREDICTED: lysM domain receptor-like kinase 4 [Musa acuminata 
subsp. malaccensis]
Length=646

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  255  EWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVSDDGL  76
            +W+D  LA +SCS+ESV +VM VA ACL+KDPSKRP+M+D  Y LSK+++   D S DGL
Sbjct  577  QWVDAALAGQSCSVESVVSVMNVARACLHKDPSKRPSMMDAAYMLSKADEHLSDFSIDGL  636

Query  75   SSG  67
            S G
Sbjct  637  SVG  639



>ref|XP_003572131.2| PREDICTED: receptor-like protein kinase isoform X1 [Brachypodium 
distachyon]
Length=1115

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -3

Query  246   DPCLARESC---SMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVSDDGL  76
             DP L RE C    +E V  V+++A+ C+ KDP +RP+MVD+V  L+ S      +S   +
Sbjct  1025  DPALMREVCGTAELEEVRGVLSIALKCIAKDPRQRPSMVDVVKELTHSRRDDLSLSKQEI  1084

Query  75    SSGPVTAR  52
             S    + R
Sbjct  1085  SGSSSSLR  1092



>ref|XP_010235055.1| PREDICTED: receptor-like protein kinase isoform X2 [Brachypodium 
distachyon]
Length=1109

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -3

Query  246   DPCLARESC---SMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVSDDGL  76
             DP L RE C    +E V  V+++A+ C+ KDP +RP+MVD+V  L+ S      +S   +
Sbjct  1019  DPALMREVCGTAELEEVRGVLSIALKCIAKDPRQRPSMVDVVKELTHSRRDDLSLSKQEI  1078

Query  75    SSGPVTAR  52
             S    + R
Sbjct  1079  SGSSSSLR  1086



>ref|XP_004509233.1| PREDICTED: protein LYK5-like [Cicer arietinum]
Length=603

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 49/88 (56%), Gaps = 13/88 (15%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALS-----  118
            EE++  ++R W+DP L R    +E +S + ++AV C  + P  RPTM ++V +LS     
Sbjct  518  EEKRDERLRRWIDPLLGRFFNVVEVLS-LASIAVNCTKEQPLSRPTMGEVVLSLSLLTQH  576

Query  117  ------KSNDLFFDVSDDGLSSGPVTAR  52
                  +S +   D+ D G+ + P+TAR
Sbjct  577  STTTLERSWNFGLDLEDTGMVT-PITAR  603



>gb|KJB40216.1| hypothetical protein B456_007G051800 [Gossypium raimondii]
Length=615

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 11/87 (13%)
 Frame = -3

Query  282  EERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDL  103
            EE++  ++R+WMDP L      ++S  ++  +A+AC  ++P  RP+M +IV++LS     
Sbjct  530  EEKREKRLRKWMDPNL-ESFYPLDSALSLAVLAMACTQENPLARPSMAEIVFSLSVLIQS  588

Query  102  FFDVSDDGLSSG----------PVTAR  52
             F++S+    SG          PV AR
Sbjct  589  SFEISEGSWGSGIETELDQMIVPVVAR  615



>gb|KJB69337.1| hypothetical protein B456_011G017600 [Gossypium raimondii]
Length=648

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -3

Query  273  KAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALS  118
            K  +  E MDPCL  ESCS+  +   M V + C+ +DP+ RPTM D+V  L 
Sbjct  555  KEGKELELMDPCLL-ESCSIPEIRRCMHVGLLCVQEDPTDRPTMSDVVVVLG  605



>ref|XP_006351555.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like, 
partial [Solanum tuberosum]
Length=955

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = -3

Query  255  EWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVSDDGL  76
            E MDPCL+ +SC    ++  + + + C+ +DP+ RPTM  +V+ L      F   S    
Sbjct  163  ELMDPCLS-QSCVTTEITKCIHIGLLCVQQDPADRPTMSSVVFMLENDTKTFPQPSQPAF  221

Query  75   SSGPVTAR  52
            S G +  R
Sbjct  222  SIGRLAVR  229



>ref|XP_010063641.1| PREDICTED: receptor-like protein kinase [Eucalyptus grandis]
 gb|KCW70876.1| hypothetical protein EUGRSUZ_F04007 [Eucalyptus grandis]
Length=1102

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = -3

Query  261   VREWMDPCLARE---SCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSN  109
             ++  +DP LA E   +  ME V++V+ VA+ C  K+PS+RP M+D+V  L K+N
Sbjct  1042  IKRIVDPSLAEEFLDTNIMEQVADVVLVALRCTEKEPSRRPNMIDVVNQLLKAN  1095



>ref|XP_010228936.1| PREDICTED: protein LYK5-like [Brachypodium distachyon]
Length=529

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -3

Query  279  ERKAAQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALS  118
            +++ A++R+WMDP L  E   M++  ++  +A AC  +D ++RP M D+V++LS
Sbjct  444  DKRDARLRKWMDPALGSE-FHMDAALSLAGMARACTEEDAARRPKMADVVFSLS  496



>ref|XP_009615784.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g14390 [Nicotiana tomentosiformis]
Length=744

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -3

Query  267  AQVREWMDPCLARESCSMESVSNVMAVAVACLNKDPSKRPTMVDIVYALSKSNDLFFDVS  88
            +++R+  DPC+ R + + ES+  ++ +AV CL+K+PS+RP++ D+++ +  S  +    +
Sbjct  664  SKLRDLTDPCI-RGTFAYESLKTMVQIAVNCLDKEPSRRPSIEDVLWHMQYSIQVQEGAT  722

Query  87   DDGLSSGPVTAR  52
            + G  SG ++ +
Sbjct  723  NSGNLSGNLSGK  734



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551001054360