BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP020A05 300 bp,

Length=300
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357654.1|  PREDICTED: uncharacterized protein LOC102599...  75.5    2e-13   Solanum tuberosum [potatoes]
ref|XP_009801445.1|  PREDICTED: ribosomal biogenesis protein LAS1...  73.2    2e-13   Nicotiana sylvestris
ref|XP_006357653.1|  PREDICTED: uncharacterized protein LOC102599...  75.5    2e-13   Solanum tuberosum [potatoes]
ref|XP_004243580.1|  PREDICTED: uncharacterized protein LOC101262...  75.1    3e-13   Solanum lycopersicum
ref|XP_010323905.1|  PREDICTED: uncharacterized protein LOC101262...  75.1    3e-13   Solanum lycopersicum
gb|KDO54752.1|  hypothetical protein CISIN_1g008111mg                 73.6    8e-13   Citrus sinensis [Valencia orange]
gb|KDO54753.1|  hypothetical protein CISIN_1g008111mg                 73.6    8e-13   Citrus sinensis [Valencia orange]
ref|XP_006470524.1|  PREDICTED: uncharacterized protein LOC102625...  73.6    9e-13   Citrus sinensis [Valencia orange]
ref|XP_006470523.1|  PREDICTED: uncharacterized protein LOC102625...  73.6    9e-13   Citrus sinensis [Valencia orange]
ref|XP_006446316.1|  hypothetical protein CICLE_v10014592mg           73.6    1e-12   Citrus clementina
ref|XP_006446315.1|  hypothetical protein CICLE_v10014592mg           73.6    1e-12   Citrus clementina
ref|XP_009626552.1|  PREDICTED: pre-rRNA-processing protein las1      73.2    2e-12   Nicotiana tomentosiformis
ref|XP_011082168.1|  PREDICTED: uncharacterized protein LOC105164994  70.9    9e-12   Sesamum indicum [beniseed]
emb|CDP13853.1|  unnamed protein product                              68.9    2e-11   Coffea canephora [robusta coffee]
ref|XP_010271772.1|  PREDICTED: uncharacterized protein LOC104607...  67.4    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010271771.1|  PREDICTED: uncharacterized protein LOC104607...  67.4    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010271773.1|  PREDICTED: uncharacterized protein LOC104607...  67.4    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010656891.1|  PREDICTED: pre-rRNA-processing protein las1      65.1    8e-10   Vitis vinifera
ref|XP_004491237.1|  PREDICTED: uncharacterized protein LOC101503...  65.1    8e-10   Cicer arietinum [garbanzo]
emb|CBI17903.3|  unnamed protein product                              62.4    9e-10   Vitis vinifera
ref|XP_004491236.1|  PREDICTED: uncharacterized protein LOC101503...  64.7    1e-09   Cicer arietinum [garbanzo]
ref|XP_002298459.2|  las1-like family protein                         64.3    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008229033.1|  PREDICTED: uncharacterized protein LOC103328422  63.5    2e-09   
ref|XP_009355292.1|  PREDICTED: uncharacterized protein LOC103946...  63.2    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_010673777.1|  PREDICTED: uncharacterized protein LOC104890...  63.2    4e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009355290.1|  PREDICTED: uncharacterized protein LOC103946...  62.8    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_002314010.1|  las1-like family protein                         62.8    4e-09   Populus trichocarpa [western balsam poplar]
gb|KDP43177.1|  hypothetical protein JCGZ_22729                       62.8    5e-09   Jatropha curcas
ref|XP_010673778.1|  PREDICTED: uncharacterized protein LOC104890...  62.8    5e-09   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008357641.1|  PREDICTED: uncharacterized protein LOC103421...  62.8    6e-09   Malus domestica [apple tree]
ref|XP_008357642.1|  PREDICTED: uncharacterized protein LOC103421...  62.8    6e-09   Malus domestica [apple tree]
ref|XP_011036402.1|  PREDICTED: uncharacterized protein LOC105133938  61.6    1e-08   Populus euphratica
gb|KHG08373.1|  Ribosomal biogenesis LAS1L                            61.6    1e-08   Gossypium arboreum [tree cotton]
gb|KJB21153.1|  hypothetical protein B456_003G185300                  61.2    2e-08   Gossypium raimondii
gb|KJB21154.1|  hypothetical protein B456_003G185300                  61.2    2e-08   Gossypium raimondii
gb|EYU37440.1|  hypothetical protein MIMGU_mgv11b003028mg             61.2    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_008227626.1|  PREDICTED: uncharacterized protein LOC103327116  60.8    2e-08   Prunus mume [ume]
ref|XP_007214532.1|  hypothetical protein PRUPE_ppa003033mg           60.8    2e-08   Prunus persica
ref|XP_007040710.1|  Las1-like family protein, putative isoform 1     60.8    2e-08   Theobroma cacao [chocolate]
ref|XP_007198899.1|  hypothetical protein PRUPE_ppa003025mg           60.5    3e-08   Prunus persica
ref|XP_003545166.1|  PREDICTED: uncharacterized protein LOC100775513  60.5    3e-08   Glycine max [soybeans]
gb|KHN12038.1|  Ribosomal biogenesis protein LAS1L                    60.5    3e-08   Glycine soja [wild soybean]
ref|XP_010031719.1|  PREDICTED: uncharacterized protein LOC104421464  60.5    3e-08   Eucalyptus grandis [rose gum]
ref|XP_009131263.1|  PREDICTED: uncharacterized protein LOC103855960  60.1    4e-08   Brassica rapa
ref|XP_008339380.1|  PREDICTED: uncharacterized protein LOC103402...  60.1    4e-08   Malus domestica [apple tree]
ref|XP_008339381.1|  PREDICTED: uncharacterized protein LOC103402...  60.1    4e-08   
ref|XP_008339382.1|  PREDICTED: uncharacterized protein LOC103402...  60.1    4e-08   
ref|XP_008339379.1|  PREDICTED: uncharacterized protein LOC103402...  60.1    4e-08   Malus domestica [apple tree]
ref|XP_009353740.1|  PREDICTED: uncharacterized protein LOC103944...  59.7    6e-08   Pyrus x bretschneideri [bai li]
ref|XP_007141512.1|  hypothetical protein PHAVU_008G202300g           59.7    6e-08   Phaseolus vulgaris [French bean]
ref|XP_009353741.1|  PREDICTED: uncharacterized protein LOC103944...  59.7    6e-08   Pyrus x bretschneideri [bai li]
ref|XP_010922079.1|  PREDICTED: uncharacterized protein LOC105045481  58.9    1e-07   Elaeis guineensis
ref|XP_008449642.1|  PREDICTED: pre-rRNA-processing protein las1      58.9    1e-07   Cucumis melo [Oriental melon]
ref|XP_010519821.1|  PREDICTED: pre-rRNA-processing protein las1      58.2    2e-07   Tarenaya hassleriana [spider flower]
gb|KFK25498.1|  hypothetical protein AALP_AA8G122400                  58.2    2e-07   Arabis alpina [alpine rockcress]
ref|XP_010232471.1|  PREDICTED: uncharacterized protein LOC100831838  58.2    2e-07   Brachypodium distachyon [annual false brome]
ref|XP_004140277.1|  PREDICTED: uncharacterized protein LOC101206515  57.4    3e-07   Cucumis sativus [cucumbers]
ref|XP_008788499.1|  PREDICTED: uncharacterized protein LOC103706229  57.4    3e-07   Phoenix dactylifera
gb|KGN48087.1|  hypothetical protein Csa_6G430640                     57.4    4e-07   Cucumis sativus [cucumbers]
emb|CDX78473.1|  BnaA03g03850D                                        57.0    5e-07   Brassica napus [oilseed rape]
emb|CDX70455.1|  BnaC03g05390D                                        57.0    5e-07   Brassica napus [oilseed rape]
ref|XP_011024993.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.6    6e-07   Populus euphratica
ref|XP_009384357.1|  PREDICTED: uncharacterized protein LOC103971923  56.6    7e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011464875.1|  PREDICTED: protein LAS1 isoform X2               56.6    7e-07   Fragaria vesca subsp. vesca
ref|XP_004299975.1|  PREDICTED: uncharacterized protein LOC101296...  56.6    7e-07   Fragaria vesca subsp. vesca
ref|XP_002871519.1|  hypothetical protein ARALYDRAFT_488065           56.2    1e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_003617221.1|  LAS1-like protein                                55.8    1e-06   Medicago truncatula
ref|XP_010453287.1|  PREDICTED: uncharacterized protein LOC104735237  55.8    1e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001190293.1|  las1-like family protein                         55.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491978.1|  PREDICTED: uncharacterized protein LOC104769459  55.8    1e-06   Camelina sativa [gold-of-pleasure]
gb|AAL91200.1|  unknown protein                                       55.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287306.1|  hypothetical protein CARUB_v10000499mg           55.5    1e-06   Capsella rubella
ref|NP_196783.2|  las1-like family protein                            55.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10040.1|  unnamed protein product                              55.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006575619.1|  PREDICTED: uncharacterized protein LOC100818...  55.5    2e-06   Glycine max [soybeans]
ref|XP_010543390.1|  PREDICTED: uncharacterized protein LOC104816...  55.1    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010543391.1|  PREDICTED: uncharacterized protein LOC104816...  55.1    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_006575620.1|  PREDICTED: uncharacterized protein LOC100818...  55.1    2e-06   Glycine max [soybeans]
emb|CDM84627.1|  unnamed protein product                              55.1    2e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010419810.1|  PREDICTED: uncharacterized protein LOC104705493  54.7    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006399738.1|  hypothetical protein EUTSA_v10012989mg           54.3    4e-06   Eutrema salsugineum
dbj|BAJ98227.1|  predicted protein                                    53.5    8e-06   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006832836.1|  hypothetical protein AMTR_s00095p00033450        52.8    1e-05   Amborella trichopoda
tpg|DAA57195.1|  TPA: hypothetical protein ZEAMMB73_455150            52.4    2e-05   Zea mays [maize]
ref|NP_001145840.1|  uncharacterized protein LOC100279349             52.4    2e-05   Zea mays [maize]
ref|XP_002458656.1|  hypothetical protein SORBIDRAFT_03g037530        52.0    2e-05   Sorghum bicolor [broomcorn]
ref|NP_001066337.1|  Os12g0189900                                     51.6    3e-05   
gb|EEC68976.1|  hypothetical protein OsI_37725                        51.6    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_004970301.1|  PREDICTED: uncharacterized protein LOC101771511  51.2    4e-05   



>ref|XP_006357654.1| PREDICTED: uncharacterized protein LOC102599960 isoform X2 [Solanum 
tuberosum]
Length=638

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF E   ++  +  S  LKLVPW++W+EW+ I DSLFSSSP SV  AL+RISTWR+RG
Sbjct  4    LLGFIEPSADETVEGNSLALKLVPWISWDEWNSIRDSLFSSSPQSVAFALQRISTWRSRG  63

Query  265  CIPVAVDVTASI  300
            CIPVAVDVTASI
Sbjct  64   CIPVAVDVTASI  75



>ref|XP_009801445.1| PREDICTED: ribosomal biogenesis protein LAS1L-like [Nicotiana 
sylvestris]
Length=278

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  85   MFGFKESYLND-VEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNR  261
            + GF E   +D + +  SQG KLVPW++W+EW+ + DSLFSSSP SV  AL+RISTWR+R
Sbjct  4    LLGFIEPPADDEIAETNSQGFKLVPWISWDEWNSVRDSLFSSSPPSVAFALQRISTWRSR  63

Query  262  GCIPVAVDVTASI  300
            GCIPVAV+VTASI
Sbjct  64   GCIPVAVEVTASI  76



>ref|XP_006357653.1| PREDICTED: uncharacterized protein LOC102599960 isoform X1 [Solanum 
tuberosum]
Length=643

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF E   ++  +  S  LKLVPW++W+EW+ I DSLFSSSP SV  AL+RISTWR+RG
Sbjct  4    LLGFIEPSADETVEGNSLALKLVPWISWDEWNSIRDSLFSSSPQSVAFALQRISTWRSRG  63

Query  265  CIPVAVDVTASI  300
            CIPVAVDVTASI
Sbjct  64   CIPVAVDVTASI  75



>ref|XP_004243580.1| PREDICTED: uncharacterized protein LOC101262228 isoform X2 [Solanum 
lycopersicum]
Length=642

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF E   ++  +  S  LKLVPW++W+EW+ I DSLFSSSP SV  AL+RISTWR+RG
Sbjct  18   LLGFIEPSADETVEGNSLALKLVPWISWDEWNSIRDSLFSSSPQSVAFALQRISTWRSRG  77

Query  265  CIPVAVDVTASI  300
            CIPVAVDVTASI
Sbjct  78   CIPVAVDVTASI  89



>ref|XP_010323905.1| PREDICTED: uncharacterized protein LOC101262228 isoform X1 [Solanum 
lycopersicum]
Length=647

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF E   ++  +  S  LKLVPW++W+EW+ I DSLFSSSP SV  AL+RISTWR+RG
Sbjct  18   LLGFIEPSADETVEGNSLALKLVPWISWDEWNSIRDSLFSSSPQSVAFALQRISTWRSRG  77

Query  265  CIPVAVDVTASI  300
            CIPVAVDVTASI
Sbjct  78   CIPVAVDVTASI  89



>gb|KDO54752.1| hypothetical protein CISIN_1g008111mg [Citrus sinensis]
Length=549

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQK-------SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRI  243
            + GF++  +N  ED++       S G KLVPWL+W+EW F+ +SLFSSS   V SALRRI
Sbjct  4    LLGFEDEVMNVGEDKEMSSSSSSSNGYKLVPWLSWDEWDFVRESLFSSSSDKVASALRRI  63

Query  244  STWRNRGCIPVAVDVTASI  300
            STWR+RGC+PV +DVTASI
Sbjct  64   STWRSRGCLPVVIDVTASI  82



>gb|KDO54753.1| hypothetical protein CISIN_1g008111mg [Citrus sinensis]
 gb|KDO54754.1| hypothetical protein CISIN_1g008111mg [Citrus sinensis]
Length=577

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQK-------SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRI  243
            + GF++  +N  ED++       S G KLVPWL+W+EW F+ +SLFSSS   V SALRRI
Sbjct  4    LLGFEDEVMNVGEDKEMSSSSSSSNGYKLVPWLSWDEWDFVRESLFSSSSDKVASALRRI  63

Query  244  STWRNRGCIPVAVDVTASI  300
            STWR+RGC+PV +DVTASI
Sbjct  64   STWRSRGCLPVVIDVTASI  82



>ref|XP_006470524.1| PREDICTED: uncharacterized protein LOC102625692 isoform X2 [Citrus 
sinensis]
Length=605

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQK-------SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRI  243
            + GF++  +N  ED++       S G KLVPWL+W+EW F+ +SLFSSS   V SALRRI
Sbjct  4    LLGFEDEVMNVGEDKEMSSSSSSSNGYKLVPWLSWDEWDFVRESLFSSSSDKVASALRRI  63

Query  244  STWRNRGCIPVAVDVTASI  300
            STWR+RGC+PV +DVTASI
Sbjct  64   STWRSRGCLPVVIDVTASI  82



>ref|XP_006470523.1| PREDICTED: uncharacterized protein LOC102625692 isoform X1 [Citrus 
sinensis]
Length=633

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQK-------SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRI  243
            + GF++  +N  ED++       S G KLVPWL+W+EW F+ +SLFSSS   V SALRRI
Sbjct  4    LLGFEDEVMNVGEDKEMSSSSSSSNGYKLVPWLSWDEWDFVRESLFSSSSDKVASALRRI  63

Query  244  STWRNRGCIPVAVDVTASI  300
            STWR+RGC+PV +DVTASI
Sbjct  64   STWRSRGCLPVVIDVTASI  82



>ref|XP_006446316.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 ref|XP_006446317.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59556.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59557.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
Length=604

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 6/78 (8%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQK------SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            + GF++  +N  ED++      S G KLVPWL W+EW F+ +SLFSSS   V SALRRIS
Sbjct  4    LLGFEDEVMNVGEDKEMSSSSSSNGYKLVPWLIWDEWDFVRESLFSSSSDKVASALRRIS  63

Query  247  TWRNRGCIPVAVDVTASI  300
            TWR+RGC+PV +DVTASI
Sbjct  64   TWRSRGCLPVVIDVTASI  81



>ref|XP_006446315.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 ref|XP_006446318.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59555.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
 gb|ESR59558.1| hypothetical protein CICLE_v10014592mg [Citrus clementina]
Length=632

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 6/78 (8%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQK------SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            + GF++  +N  ED++      S G KLVPWL W+EW F+ +SLFSSS   V SALRRIS
Sbjct  4    LLGFEDEVMNVGEDKEMSSSSSSNGYKLVPWLIWDEWDFVRESLFSSSSDKVASALRRIS  63

Query  247  TWRNRGCIPVAVDVTASI  300
            TWR+RGC+PV +DVTASI
Sbjct  64   TWRSRGCLPVVIDVTASI  81



>ref|XP_009626552.1| PREDICTED: pre-rRNA-processing protein las1 [Nicotiana tomentosiformis]
Length=631

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  85   MFGFKESYLND-VEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNR  261
            + GF E   +D + +  SQG KLVPW++W+EW+ + DSLFSSSP SV  AL+RISTWR+R
Sbjct  4    LLGFIEPPADDEIAETNSQGFKLVPWISWDEWNSVRDSLFSSSPPSVAFALQRISTWRSR  63

Query  262  GCIPVAVDVTASI  300
            GCIPVAV+VTASI
Sbjct  64   GCIPVAVEVTASI  76



>ref|XP_011082168.1| PREDICTED: uncharacterized protein LOC105164994 [Sesamum indicum]
Length=626

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  88   FGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGC  267
             GF E   +DV + KS   KLVPW++W+EW F+ +SLFSSSP SV SAL+RISTWR+RGC
Sbjct  4    LGFMEPVPDDVVEDKSHSFKLVPWMSWDEWKFVRESLFSSSPDSVASALQRISTWRSRGC  63

Query  268  IPVAVDVTASI  300
              +A++VTASI
Sbjct  64   TAMAIEVTASI  74



>emb|CDP13853.1| unnamed protein product [Coffea canephora]
Length=352

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF E   NDV   +S   KLVPW++W+EW F+  SLFSSSP SV SAL+RI+ WR+RG
Sbjct  4    LLGFTEPPANDVVLDQSHSFKLVPWISWDEWDFVRISLFSSSPPSVASALQRITAWRSRG  63

Query  265  CIPVAVDVTASI  300
            C+PV V+VTASI
Sbjct  64   CLPVVVEVTASI  75



>ref|XP_010271772.1| PREDICTED: uncharacterized protein LOC104607775 isoform X2 [Nelumbo 
nucifera]
Length=639

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  115  DVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTA  294
            D + +K  G KLVPWL W+EW+F+ +SLFSSSP SV +ALRRIS WR+RGC+P+ V+VTA
Sbjct  12   DGQKEKPSGYKLVPWLNWDEWNFVRESLFSSSPDSVAAALRRISAWRSRGCLPIVVEVTA  71

Query  295  SI  300
            SI
Sbjct  72   SI  73



>ref|XP_010271771.1| PREDICTED: uncharacterized protein LOC104607775 isoform X1 [Nelumbo 
nucifera]
Length=640

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  115  DVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTA  294
            D + +K  G KLVPWL W+EW+F+ +SLFSSSP SV +ALRRIS WR+RGC+P+ V+VTA
Sbjct  12   DGQKEKPSGYKLVPWLNWDEWNFVRESLFSSSPDSVAAALRRISAWRSRGCLPIVVEVTA  71

Query  295  SI  300
            SI
Sbjct  72   SI  73



>ref|XP_010271773.1| PREDICTED: uncharacterized protein LOC104607775 isoform X3 [Nelumbo 
nucifera]
Length=612

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  115  DVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTA  294
            D + +K  G KLVPWL W+EW+F+ +SLFSSSP SV +ALRRIS WR+RGC+P+ V+VTA
Sbjct  12   DGQKEKPSGYKLVPWLNWDEWNFVRESLFSSSPDSVAAALRRISAWRSRGCLPIVVEVTA  71

Query  295  SI  300
            SI
Sbjct  72   SI  73



>ref|XP_010656891.1| PREDICTED: pre-rRNA-processing protein las1 [Vitis vinifera]
Length=624

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF+++  +D  ++ S G KLVPWL WEEW+ +  SLFSSS  SV  AL R+S WR+RG
Sbjct  4    LLGFEQASRHD--NEGSHGQKLVPWLNWEEWNSVRQSLFSSSQDSVGFALGRVSAWRSRG  61

Query  265  CIPVAVDVTASI  300
            C+PV V+VTASI
Sbjct  62   CLPVVVEVTASI  73



>ref|XP_004491237.1| PREDICTED: uncharacterized protein LOC101503689 isoform X2 [Cicer 
arietinum]
Length=600

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +1

Query  76   EYEMFGFKESYLNDVEDQKSQG---LKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            E  + GFKE  + D+ED         KLVPWL W EW F+ D+LFS SP S+ SAL+RIS
Sbjct  2    EAPLLGFKE--VPDLEDDTKSSPSSRKLVPWLNWNEWLFVRDALFSDSPQSLSSALKRIS  59

Query  247  TWRNRGCIPVAVDVTASI  300
            +WR+RG +PV +DVTASI
Sbjct  60   SWRSRGSLPVLIDVTASI  77



>emb|CBI17903.3| unnamed protein product [Vitis vinifera]
Length=193

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF+++  +D  ++ S G KLVPWL WEEW+ +  SLFSSS  SV  AL R+S WR+RG
Sbjct  4    LLGFEQASRHD--NEGSHGQKLVPWLNWEEWNSVRQSLFSSSQDSVGFALGRVSAWRSRG  61

Query  265  CIPVAVDVTASI  300
            C+PV V+VTASI
Sbjct  62   CLPVVVEVTASI  73



>ref|XP_004491236.1| PREDICTED: uncharacterized protein LOC101503689 isoform X1 [Cicer 
arietinum]
Length=628

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +1

Query  76   EYEMFGFKESYLNDVED---QKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            E  + GFKE  + D+ED         KLVPWL W EW F+ D+LFS SP S+ SAL+RIS
Sbjct  2    EAPLLGFKE--VPDLEDDTKSSPSSRKLVPWLNWNEWLFVRDALFSDSPQSLSSALKRIS  59

Query  247  TWRNRGCIPVAVDVTASI  300
            +WR+RG +PV +DVTASI
Sbjct  60   SWRSRGSLPVLIDVTASI  77



>ref|XP_002298459.2| las1-like family protein [Populus trichocarpa]
 gb|EEE83264.2| las1-like family protein [Populus trichocarpa]
Length=626

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 8/80 (10%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQ--------GLKLVPWLTWEEWSFIGDslfsssplsvdsalRR  240
            + GF++  +  V+D + +        G KLVPWL W EW  + DSLFS SP ++ SA+ R
Sbjct  4    LLGFQDETVAVVDDDEEKSTSSSSSYGYKLVPWLNWNEWECVRDSLFSESPENILSAINR  63

Query  241  ISTWRNRGCIPVAVDVTASI  300
            ISTWR+RGC+PV +DVTASI
Sbjct  64   ISTWRSRGCLPVVIDVTASI  83



>ref|XP_008229033.1| PREDICTED: uncharacterized protein LOC103328422 [Prunus mume]
Length=435

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 9/102 (9%)
 Frame = +1

Query  13   QQNTTSEPTEHCKWIWENGPCEYEMFGFKESYLNDVE------DQKSQGLKLVPWLTWEE  174
            +++TTS   +    IW +GP    +    +   N+V+         S   KLVPWL+W+E
Sbjct  92   KRHTTSNVDQTGDGIWNHGPF---LVHLPKLDTNNVQLGISTSSSSSYSYKLVPWLSWDE  148

Query  175  WSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            W F+ +SLFS SP SV SALRRIS WR+RGC+PV V+VT+SI
Sbjct  149  WLFVDESLFSKSPNSVASALRRISAWRSRGCLPVVVEVTSSI  190



>ref|XP_009355292.1| PREDICTED: uncharacterized protein LOC103946347 isoform X2 [Pyrus 
x bretschneideri]
Length=610

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 6/79 (8%)
 Frame = +1

Query  82   EMFGFKESYLNDVE------DQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRI  243
            E+ GF E   ++ E         S   KLVPWL+W+EW F+ +SLFS+SP  V SALRRI
Sbjct  3    ELLGFTEESRDNEELGISSLSSSSYSYKLVPWLSWDEWLFVEESLFSNSPDIVASALRRI  62

Query  244  STWRNRGCIPVAVDVTASI  300
            STWR+RGC+P+ ++VTASI
Sbjct  63   STWRSRGCLPIVIEVTASI  81



>ref|XP_010673777.1| PREDICTED: uncharacterized protein LOC104890105 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  109  LNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDV  288
            L +  +      KLVPWL WEEW F+  S FSSS  SV  +LRRI  WR+RGC+PV +++
Sbjct  7    LKETNNNADDNYKLVPWLNWEEWDFVRTSFFSSSSDSVTKSLRRIVAWRSRGCLPVEIEI  66

Query  289  TASI  300
            TASI
Sbjct  67   TASI  70



>ref|XP_009355290.1| PREDICTED: uncharacterized protein LOC103946347 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009355291.1| PREDICTED: uncharacterized protein LOC103946347 isoform X1 [Pyrus 
x bretschneideri]
Length=622

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 6/79 (8%)
 Frame = +1

Query  82   EMFGFKESYLNDVE------DQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRI  243
            E+ GF E   ++ E         S   KLVPWL+W+EW F+ +SLFS+SP  V SALRRI
Sbjct  3    ELLGFTEESRDNEELGISSLSSSSYSYKLVPWLSWDEWLFVEESLFSNSPDIVASALRRI  62

Query  244  STWRNRGCIPVAVDVTASI  300
            STWR+RGC+P+ ++VTASI
Sbjct  63   STWRSRGCLPIVIEVTASI  81



>ref|XP_002314010.1| las1-like family protein [Populus trichocarpa]
 gb|EEE87965.1| las1-like family protein [Populus trichocarpa]
Length=617

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 6/78 (8%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQK------SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            + GF++  +  V D +      S G KLVPWL W EW  + DSLFS SP  + SA+ RIS
Sbjct  4    LLGFQDETIAVVGDDQEKSTSSSYGYKLVPWLNWNEWECVRDSLFSDSPEKIHSAITRIS  63

Query  247  TWRNRGCIPVAVDVTASI  300
            TWR+RGC+P  +DVTASI
Sbjct  64   TWRSRGCLPAVIDVTASI  81



>gb|KDP43177.1| hypothetical protein JCGZ_22729 [Jatropha curcas]
Length=662

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLVPWL WEEW ++ D LFS SP ++ SAL+RISTWR+RGC+PV +D+TASI
Sbjct  35   KLVPWLNWEEWVWVRDFLFSDSPKNISSALKRISTWRSRGCVPVVIDITASI  86



>ref|XP_010673778.1| PREDICTED: uncharacterized protein LOC104890105 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=606

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  109  LNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDV  288
            L +  +      KLVPWL WEEW F+  S FSSS  SV  +LRRI  WR+RGC+PV +++
Sbjct  7    LKETNNNADDNYKLVPWLNWEEWDFVRTSFFSSSSDSVTKSLRRIVAWRSRGCLPVEIEI  66

Query  289  TASI  300
            TASI
Sbjct  67   TASI  70



>ref|XP_008357641.1| PREDICTED: uncharacterized protein LOC103421394 isoform X1 [Malus 
domestica]
Length=618

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +1

Query  82   EMFGFKESYLNDVED--------QKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalR  237
            E+ GF E    D ED          S   KLVPWL+W+EW F+ +SLFS+SP  V SALR
Sbjct  3    ELLGFTEES-RDNEDLGISSLSSSSSYSYKLVPWLSWDEWLFVEESLFSNSPDIVTSALR  61

Query  238  RISTWRNRGCIPVAVDVTASI  300
            RISTWR+RGC+P+ ++VTASI
Sbjct  62   RISTWRSRGCLPIVIEVTASI  82



>ref|XP_008357642.1| PREDICTED: uncharacterized protein LOC103421394 isoform X2 [Malus 
domestica]
Length=606

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 9/81 (11%)
 Frame = +1

Query  82   EMFGFKESYLNDVED--------QKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalR  237
            E+ GF E    D ED          S   KLVPWL+W+EW F+ +SLFS+SP  V SALR
Sbjct  3    ELLGFTEES-RDNEDLGISSLSSSSSYSYKLVPWLSWDEWLFVEESLFSNSPDIVTSALR  61

Query  238  RISTWRNRGCIPVAVDVTASI  300
            RISTWR+RGC+P+ ++VTASI
Sbjct  62   RISTWRSRGCLPIVIEVTASI  82



>ref|XP_011036402.1| PREDICTED: uncharacterized protein LOC105133938 [Populus euphratica]
Length=634

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 10/82 (12%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQ----------GLKLVPWLTWEEWSFIGDslfsssplsvdsal  234
            + GF++  +  V D + +          G KLVPWL W EW  + DSLFS SP  + SA+
Sbjct  4    LLGFQDETIAVVGDDQEKSTSSSSSSSYGYKLVPWLNWNEWEHVRDSLFSDSPEKIHSAI  63

Query  235  RRISTWRNRGCIPVAVDVTASI  300
             RISTWR+RGC+P  +DVTASI
Sbjct  64   TRISTWRSRGCLPAVIDVTASI  85



>gb|KHG08373.1| Ribosomal biogenesis LAS1L [Gossypium arboreum]
Length=618

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 6/78 (8%)
 Frame = +1

Query  85   MFGFKE----SYLNDVEDQK--SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            + GFKE    +Y  D       S   KLVPWL W EW  +  SLFSSSP  + SAL RIS
Sbjct  4    LLGFKEETVEAYNQDFSSSTIPSNAYKLVPWLNWAEWDSVRKSLFSSSPRKISSALSRIS  63

Query  247  TWRNRGCIPVAVDVTASI  300
            TWR+RGC+PV +DVTASI
Sbjct  64   TWRSRGCLPVVIDVTASI  81



>gb|KJB21153.1| hypothetical protein B456_003G185300 [Gossypium raimondii]
Length=619

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 6/78 (8%)
 Frame = +1

Query  85   MFGFKE----SYLNDVEDQK--SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            + GFKE    +Y  D       S   KLVPWL W EW  +  SLFSSSP  + SAL RIS
Sbjct  4    LLGFKEETVEAYNQDFSSSTIPSNAYKLVPWLNWAEWDSVRKSLFSSSPRKISSALSRIS  63

Query  247  TWRNRGCIPVAVDVTASI  300
            TWR+RGC+PV +DVTASI
Sbjct  64   TWRSRGCLPVVIDVTASI  81



>gb|KJB21154.1| hypothetical protein B456_003G185300 [Gossypium raimondii]
Length=618

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 6/78 (8%)
 Frame = +1

Query  85   MFGFKE----SYLNDVEDQK--SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIS  246
            + GFKE    +Y  D       S   KLVPWL W EW  +  SLFSSSP  + SAL RIS
Sbjct  4    LLGFKEETVEAYNQDFSSSTIPSNAYKLVPWLNWAEWDSVRKSLFSSSPRKISSALSRIS  63

Query  247  TWRNRGCIPVAVDVTASI  300
            TWR+RGC+PV +DVTASI
Sbjct  64   TWRSRGCLPVVIDVTASI  81



>gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Erythranthe guttata]
Length=571

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + G K++   DV ++KS  L+ VPW+ W+EW F+ DSLFS+S  SV SALR ISTW+ RG
Sbjct  4    LSGLKDNVQYDVVEEKSHSLRYVPWMNWDEWKFVKDSLFSASSSSVASALRIISTWQIRG  63

Query  265  CIPVAVDVTASI  300
             I VA++VTAS+
Sbjct  64   GIHVAIEVTASL  75



>ref|XP_008227626.1| PREDICTED: uncharacterized protein LOC103327116 [Prunus mume]
 ref|XP_008227627.1| PREDICTED: uncharacterized protein LOC103327116 [Prunus mume]
Length=640

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+ +SLFS+SP SV SALRRIS WR+RGC+PV ++VTASI
Sbjct  32   LVPWLSWDEWLFVDESLFSNSPESVASALRRISAWRSRGCLPVVIEVTASI  82



>ref|XP_007214532.1| hypothetical protein PRUPE_ppa003033mg [Prunus persica]
 gb|EMJ15731.1| hypothetical protein PRUPE_ppa003033mg [Prunus persica]
Length=610

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+ +SLFS SP SV SALRRIS WR+RGC+PV ++VTASI
Sbjct  32   LVPWLSWDEWLFVDESLFSISPESVASALRRISAWRSRGCLPVVIEVTASI  82



>ref|XP_007040710.1| Las1-like family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY25211.1| Las1-like family protein, putative isoform 1 [Theobroma cacao]
Length=624

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQ-----KSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRIST  249
            + GF+E  +    ++      S G KLVPWL W EW  +  SLFSSSP  + SAL RIS 
Sbjct  4    LLGFEEETIAAYNEELSSSSSSNGYKLVPWLNWTEWESVRKSLFSSSPAKISSALSRISA  63

Query  250  WRNRGCIPVAVDVTASI  300
            WR+RGC+PV +DVTASI
Sbjct  64   WRSRGCLPVVIDVTASI  80



>ref|XP_007198899.1| hypothetical protein PRUPE_ppa003025mg [Prunus persica]
 gb|EMJ00098.1| hypothetical protein PRUPE_ppa003025mg [Prunus persica]
Length=611

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLVPWL+W+EW F+ +SLFS+SP SV SALRRIS WR+RGC+PV V++T+SI
Sbjct  30   KLVPWLSWDEWLFVDESLFSNSPNSVASALRRISAWRSRGCLPVVVELTSSI  81



>ref|XP_003545166.1| PREDICTED: uncharacterized protein LOC100775513 [Glycine max]
Length=631

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF+E      E   S   +LVPWL W+EW F+ ++LFS SP SV SAL+RIS WR+RG
Sbjct  6    LLGFEEDAKMVTESSSSSAHRLVPWLNWDEWLFVKNALFSDSPHSVYSALKRISAWRSRG  65

Query  265  CIPVAVDVTASI  300
             +PV ++VT SI
Sbjct  66   SLPVLIEVTTSI  77



>gb|KHN12038.1| Ribosomal biogenesis protein LAS1L [Glycine soja]
Length=632

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRG  264
            + GF+E      E   S   +LVPWL W+EW F+ ++LFS SP SV SAL+RIS WR+RG
Sbjct  6    LLGFEEDAKMVTESSSSSAHRLVPWLNWDEWLFVKNALFSDSPHSVYSALKRISAWRSRG  65

Query  265  CIPVAVDVTASI  300
             +PV ++VT SI
Sbjct  66   SLPVLIEVTTSI  77



>ref|XP_010031719.1| PREDICTED: uncharacterized protein LOC104421464 [Eucalyptus grandis]
 gb|KCW51086.1| hypothetical protein EUGRSUZ_J00691 [Eucalyptus grandis]
Length=627

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLVPWL+W+EW  +  SLFS SP SV +ALRRI+ WR+RGC+PVAV+VTASI
Sbjct  27   KLVPWLSWDEWDSVRASLFSPSPDSVAAALRRITAWRSRGCLPVAVEVTASI  78



>ref|XP_009131263.1| PREDICTED: uncharacterized protein LOC103855960 [Brassica rapa]
Length=613

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +1

Query  100  ESYLNDVEDQK---SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCI  270
            ESYLN+  DQ+   S G K VPWL WEEW  + +SLFSSSP     AL+R+ TWR+RGCI
Sbjct  12   ESYLNNEHDQERPSSDGCKQVPWLNWEEWDSVRESLFSSSPDRFAFALQRVRTWRSRGCI  71

Query  271  PVAVDVTASI  300
            P  VDVT ++
Sbjct  72   PGPVDVTCTL  81



>ref|XP_008339380.1| PREDICTED: uncharacterized protein LOC103402411 isoform X2 [Malus 
domestica]
Length=638

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+  SLFS+SP  V SALRRISTWR+RGC+P+ ++VTASI
Sbjct  32   LVPWLSWDEWLFVDKSLFSNSPDFVASALRRISTWRSRGCLPITIEVTASI  82



>ref|XP_008339381.1| PREDICTED: uncharacterized protein LOC103402411 isoform X3 [Malus 
domestica]
Length=635

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+  SLFS+SP  V SALRRISTWR+RGC+P+ ++VTASI
Sbjct  44   LVPWLSWDEWLFVDKSLFSNSPDFVASALRRISTWRSRGCLPITIEVTASI  94



>ref|XP_008339382.1| PREDICTED: uncharacterized protein LOC103402411 isoform X4 [Malus 
domestica]
Length=596

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+  SLFS+SP  V SALRRISTWR+RGC+P+ ++VTASI
Sbjct  44   LVPWLSWDEWLFVDKSLFSNSPDFVASALRRISTWRSRGCLPITIEVTASI  94



>ref|XP_008339379.1| PREDICTED: uncharacterized protein LOC103402411 isoform X1 [Malus 
domestica]
Length=650

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+  SLFS+SP  V SALRRISTWR+RGC+P+ ++VTASI
Sbjct  44   LVPWLSWDEWLFVDKSLFSNSPDFVASALRRISTWRSRGCLPITIEVTASI  94



>ref|XP_009353740.1| PREDICTED: uncharacterized protein LOC103944976 isoform X1 [Pyrus 
x bretschneideri]
Length=659

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+  SLFS+SP  V SALRRISTWR+RGC+P+ ++VTASI
Sbjct  69   LVPWLSWDEWLFVEKSLFSNSPDFVASALRRISTWRSRGCLPITIEVTASI  119



>ref|XP_007141512.1| hypothetical protein PHAVU_008G202300g [Phaseolus vulgaris]
 gb|ESW13506.1| hypothetical protein PHAVU_008G202300g [Phaseolus vulgaris]
Length=633

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQGLK-LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNR  261
            + GF+E      E   S G + LVPWL W+EW F+  +LFS+SP SV SAL+RISTWR+R
Sbjct  6    LLGFEEVANVVAESSSSSGARRLVPWLNWDEWLFVKRALFSNSPHSVSSALKRISTWRSR  65

Query  262  GCIPVAVDVTASI  300
            G +PV ++VTASI
Sbjct  66   GSLPVFIEVTASI  78



>ref|XP_009353741.1| PREDICTED: uncharacterized protein LOC103944976 isoform X2 [Pyrus 
x bretschneideri]
Length=647

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  148  LVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            LVPWL+W+EW F+  SLFS+SP  V SALRRISTWR+RGC+P+ ++VTASI
Sbjct  69   LVPWLSWDEWLFVEKSLFSNSPDFVASALRRISTWRSRGCLPITIEVTASI  119



>ref|XP_010922079.1| PREDICTED: uncharacterized protein LOC105045481 [Elaeis guineensis]
Length=618

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +W++W+F+ +S+FSSSP S+  AL+RIS WR+RGC+PV +++TA+
Sbjct  8    SSGYKLVPWSSWDQWNFVRESIFSSSPDSIAGALQRISAWRSRGCLPVPIEITAA  62



>ref|XP_008449642.1| PREDICTED: pre-rRNA-processing protein las1 [Cucumis melo]
Length=607

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLVPW TW EW F+  SLFS SP  V +AL RISTWR+RGC+PV V+VTASI
Sbjct  25   KLVPWSTWNEWLFVSQSLFSDSPDFVAAALSRISTWRSRGCLPVVVEVTASI  76



>ref|XP_010519821.1| PREDICTED: pre-rRNA-processing protein las1 [Tarenaya hassleriana]
Length=614

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  76   EYEMFGFKESYLNDVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWR  255
            E E+F F E    D +   S G K VPWL+W+EW  + +SLFS+S   V SAL R+ TWR
Sbjct  8    EAELFSFFED--QDPQQTSSDGCKPVPWLSWDEWDSVRESLFSASSDRVASALERVMTWR  65

Query  256  NRGCIPVAVDVTASI  300
            +RG +P  VDVTASI
Sbjct  66   SRGSLPAPVDVTASI  80



>gb|KFK25498.1| hypothetical protein AALP_AA8G122400 [Arabis alpina]
Length=614

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +1

Query  100  ESYLNDVEDQK---SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCI  270
            ES+ N+ + Q+   S G K VPWL+WEEW  + +SLFSSSP    SAL R++TWR+RG +
Sbjct  12   ESFFNEQDQQRPSSSDGCKQVPWLSWEEWDSVRESLFSSSPDRAASALERVATWRSRGSL  71

Query  271  PVAVDVTASI  300
            P  VDVTAS+
Sbjct  72   PAPVDVTASL  81



>ref|XP_010232471.1| PREDICTED: uncharacterized protein LOC100831838 [Brachypodium 
distachyon]
Length=597

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            S G KLVPW +W EW F+ D++FS  P    +  RRI+ WR+RGC+P+ VDVTAS+
Sbjct  16   STGRKLVPWSSWAEWQFVRDAIFSPYPDHAAAL-RRIAAWRSRGCLPIPVDVTASL  70



>ref|XP_004140277.1| PREDICTED: uncharacterized protein LOC101206515 [Cucumis sativus]
 ref|XP_004156103.1| PREDICTED: uncharacterized protein LOC101227409 [Cucumis sativus]
Length=607

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLVPW TW EW F+  SLFS SP SV +AL RISTWR++GC+PV ++VTASI
Sbjct  25   KLVPWSTWNEWLFVSQSLFSDSPDSVAAALSRISTWRSKGCLPVVIEVTASI  76



>ref|XP_008788499.1| PREDICTED: uncharacterized protein LOC103706229 [Phoenix dactylifera]
Length=622

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +W++W+F+ +S+FSSS  SV +ALRRIS WR+RGC+PV +++TA+
Sbjct  11   SSGYKLVPWSSWDQWNFVRESIFSSSSDSVAAALRRISAWRSRGCLPVPIEITAA  65



>gb|KGN48087.1| hypothetical protein Csa_6G430640 [Cucumis sativus]
Length=733

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLVPW TW EW F+  SLFS SP SV +AL RISTWR++GC+PV ++VTASI
Sbjct  151  KLVPWSTWNEWLFVSQSLFSDSPDSVAAALSRISTWRSKGCLPVVIEVTASI  202



>emb|CDX78473.1| BnaA03g03850D [Brassica napus]
Length=613

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  100  ESYLNDVEDQK---SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCI  270
            ESYLN+  DQ+   S G K VPWL WEEW  + +SLFSSSP     AL+R+ TWR+RG I
Sbjct  12   ESYLNNEHDQQRPSSDGCKQVPWLNWEEWDSVRESLFSSSPDRFAFALQRVRTWRSRGSI  71

Query  271  PVAVDVTASI  300
            P  VDVT ++
Sbjct  72   PGPVDVTCTL  81



>emb|CDX70455.1| BnaC03g05390D [Brassica napus]
Length=613

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  100  ESYLNDVEDQK---SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCI  270
            ESYLN+  DQ+   S G K VPWL WEEW  + +SLFSSSP     AL+R+ TWR+RG I
Sbjct  12   ESYLNNEHDQQRPSSDGCKQVPWLNWEEWDSVRESLFSSSPDRFAFALQRVETWRSRGSI  71

Query  271  PVAVDVTASI  300
            P  VDVT ++
Sbjct  72   PGPVDVTCTL  81



>ref|XP_011024993.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105125999 
[Populus euphratica]
Length=625

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +1

Query  85   MFGFKESYLNDVEDQKSQ--------GLKLVPWLTWEEWSFIGDslfsssplsvdsalRR  240
            + GF++  +  V+D++ +        G KLVPWL W EW  + DSLFS SP ++ SA+ R
Sbjct  4    LLGFQDETVAVVDDEEEKSTSSSSSYGYKLVPWLNWNEWECVRDSLFSESPENIISAINR  63

Query  241  ISTWRNRGCIPVAVDVT  291
            ISTWR+RGC+PV +D +
Sbjct  64   ISTWRSRGCLPVVIDXS  80



>ref|XP_009384357.1| PREDICTED: uncharacterized protein LOC103971923 [Musa acuminata 
subsp. malaccensis]
Length=613

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  121  EDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            E + S G KLVPW  W++W F+ +S+FSSSP +V +AL++IS WR+RGC+PV +DVTA+
Sbjct  7    EGELSAGYKLVPWSCWDQWKFVKESIFSSSPDAVGTALQKISAWRSRGCLPVPIDVTAA  65



>ref|XP_011464875.1| PREDICTED: protein LAS1 isoform X2 [Fragaria vesca subsp. vesca]
Length=623

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLV WL+W+EW F+  +LFS SP SV SALRRIS W++RGC+P  ++VTASI
Sbjct  26   KLVAWLSWDEWLFVSQALFSDSPDSVASALRRISAWKSRGCVPAVIEVTASI  77



>ref|XP_004299975.1| PREDICTED: uncharacterized protein LOC101296866 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=651

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            KLV WL+W+EW F+  +LFS SP SV SALRRIS W++RGC+P  ++VTASI
Sbjct  26   KLVAWLSWDEWLFVSQALFSDSPDSVASALRRISAWKSRGCVPAVIEVTASI  77



>ref|XP_002871519.1| hypothetical protein ARALYDRAFT_488065 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47778.1| hypothetical protein ARALYDRAFT_488065 [Arabidopsis lyrata subsp. 
lyrata]
Length=611

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSS   + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSPDGCKQVPWLSWEEWDSVRESLFSSSLDRIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>ref|XP_003617221.1| LAS1-like protein [Medicago truncatula]
 gb|AET00180.1| Las1 family protein, putative [Medicago truncatula]
Length=603

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTA  294
            KLVPWL W EW F+ DSLFS SP S   AL+RIS WR RGC+P  +D+TA
Sbjct  29   KLVPWLNWNEWLFVRDSLFSDSPNSFSDALKRISVWRTRGCLPELIDITA  78



>ref|XP_010453287.1| PREDICTED: uncharacterized protein LOC104735237 [Camelina sativa]
Length=612

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSSDGCKQVPWLSWEEWDSVRESLFSSSPDRIASALERVTTWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>ref|NP_001190293.1| las1-like family protein [Arabidopsis thaliana]
 gb|AED91777.1| las1-like family protein [Arabidopsis thaliana]
Length=600

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSPDGCKQVPWLSWEEWDSVRESLFSSSPDRIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>ref|XP_010491978.1| PREDICTED: uncharacterized protein LOC104769459 [Camelina sativa]
Length=613

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSSDGCKQVPWLSWEEWDSVRESLFSSSPDRIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>gb|AAL91200.1| unknown protein [Arabidopsis thaliana]
 gb|AAO00916.1| unknown protein [Arabidopsis thaliana]
Length=611

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSPDGCKQVPWLSWEEWDSVRESLFSSSPDRIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>ref|XP_006287306.1| hypothetical protein CARUB_v10000499mg [Capsella rubella]
 gb|EOA20204.1| hypothetical protein CARUB_v10000499mg [Capsella rubella]
Length=611

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSSDGCKQVPWLSWEEWDSVRESLFSSSPDKIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>ref|NP_196783.2| las1-like family protein [Arabidopsis thaliana]
 gb|AED91776.1| las1-like family protein [Arabidopsis thaliana]
Length=611

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSPDGCKQVPWLSWEEWDSVRESLFSSSPDRIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>dbj|BAB10040.1| unnamed protein product [Arabidopsis thaliana]
Length=626

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WEEW  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSPDGCKQVPWLSWEEWDSVRESLFSSSPDRIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>ref|XP_006575619.1| PREDICTED: uncharacterized protein LOC100818525 isoform X1 [Glycine 
max]
Length=637

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            +LVPWL W+EW F+  +LFS SP SV SAL+RIS WR+RG +PV ++VTASI
Sbjct  31   RLVPWLNWDEWLFVKHALFSDSPHSVSSALKRISAWRSRGSLPVLIEVTASI  82



>ref|XP_010543390.1| PREDICTED: uncharacterized protein LOC104816332 isoform X1 [Tarenaya 
hassleriana]
Length=603

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  103  SYLNDVEDQK--SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPV  276
            S+ +D + Q+  S G K VPWL+W+EW  + +SLFSSS   V SAL R+ TWR+RG +P 
Sbjct  13   SFFDDQDPQRTSSDGCKPVPWLSWDEWDSVRESLFSSSSDKVASALERVMTWRSRGSLPA  72

Query  277  AVDVTASI  300
             VDVTASI
Sbjct  73   PVDVTASI  80



>ref|XP_010543391.1| PREDICTED: uncharacterized protein LOC104816332 isoform X2 [Tarenaya 
hassleriana]
Length=602

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  103  SYLNDVEDQK--SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPV  276
            S+ +D + Q+  S G K VPWL+W+EW  + +SLFSSS   V SAL R+ TWR+RG +P 
Sbjct  13   SFFDDQDPQRTSSDGCKPVPWLSWDEWDSVRESLFSSSSDKVASALERVMTWRSRGSLPA  72

Query  277  AVDVTASI  300
             VDVTASI
Sbjct  73   PVDVTASI  80



>ref|XP_006575620.1| PREDICTED: uncharacterized protein LOC100818525 isoform X2 [Glycine 
max]
Length=609

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  145  KLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            +LVPWL W+EW F+  +LFS SP SV SAL+RIS WR+RG +PV ++VTASI
Sbjct  31   RLVPWLNWDEWLFVKHALFSDSPHSVSSALKRISAWRSRGSLPVLIEVTASI  82



>emb|CDM84627.1| unnamed protein product [Triticum aestivum]
Length=601

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +1

Query  115  DVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTA  294
            D    +S   KLVPW +W EW F+ D++FS  P    +  RRI+ WR+RGC+P+ V+VTA
Sbjct  9    DAGGGRSTARKLVPWSSWAEWRFVRDAIFSPYPDPGAAL-RRIAAWRSRGCLPIPVEVTA  67

Query  295  SI  300
            ++
Sbjct  68   AL  69



>ref|XP_010419810.1| PREDICTED: uncharacterized protein LOC104705493 [Camelina sativa]
Length=618

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQKS--QGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  + + QKS   G K VPWL+WE+W  + +SLFSSSP  + SAL R++TWR+RG +P
Sbjct  12   ESYFGEQDQQKSSSDGCKQVPWLSWEDWDSVRESLFSSSPDRIASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   APVDVTCSL  80



>ref|XP_006399738.1| hypothetical protein EUTSA_v10012989mg [Eutrema salsugineum]
 gb|ESQ41191.1| hypothetical protein EUTSA_v10012989mg [Eutrema salsugineum]
Length=614

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  100  ESYLNDVEDQK--SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIP  273
            ESY  D +  +  S G K VPWL+WEEW  + +SLFSSSP    SAL R++TWR+RG +P
Sbjct  12   ESYFKDQDQHRPSSDGCKQVPWLSWEEWDSVRESLFSSSPDKTASALERVATWRSRGSLP  71

Query  274  VAVDVTASI  300
              VDVT S+
Sbjct  72   EPVDVTCSL  80



>dbj|BAJ98227.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +1

Query  115  DVEDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTA  294
            D    +S   KLVPW +W EW  + D++FS  P    +  RRI+ WR+RGC+P+ V+VTA
Sbjct  6    DAGGARSTARKLVPWSSWAEWRLVRDAIFSPYPDPGAAL-RRIAAWRSRGCLPIPVEVTA  64

Query  295  SI  300
            ++
Sbjct  65   AL  66



>ref|XP_006832836.1| hypothetical protein AMTR_s00095p00033450 [Amborella trichopoda]
 gb|ERM98114.1| hypothetical protein AMTR_s00095p00033450 [Amborella trichopoda]
Length=636

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  121  EDQKSQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTASI  300
            E   S G KLVPW +W++W+F+ + L SSSP SV SAL +I  WR+RGC+P++V +TA+I
Sbjct  13   EKDLSYGYKLVPWQSWDQWNFVREKLLSSSPASVSSALEKIVGWRSRGCLPISVSITAAI  72



>tpg|DAA57195.1| TPA: hypothetical protein ZEAMMB73_455150 [Zea mays]
Length=592

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +W EW F+ D LFS  P +     RRI+ WR+RG +P+ VDVTA+
Sbjct  22   STGRKLVPWSSWTEWRFVRDGLFSPFPAAAL---RRIAAWRSRGSLPIPVDVTAA  73



>ref|NP_001145840.1| uncharacterized protein LOC100279349 [Zea mays]
 gb|ACL52704.1| unknown [Zea mays]
Length=592

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +W EW F+ D LFS  P +     RRI+ WR+RG +P+ VDVTA+
Sbjct  22   STGRKLVPWSSWTEWRFVRDGLFSPFPAAAL---RRIAAWRSRGSLPIPVDVTAA  73



>ref|XP_002458656.1| hypothetical protein SORBIDRAFT_03g037530 [Sorghum bicolor]
 gb|EES03776.1| hypothetical protein SORBIDRAFT_03g037530 [Sorghum bicolor]
Length=597

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +W EW F+ D LFS  P +     RRI+ WR+RG +P+ VDVTA+
Sbjct  27   STGRKLVPWSSWTEWRFVRDGLFSPFPAAAL---RRIAAWRSRGSLPIPVDVTAA  78



>ref|NP_001066337.1| Os12g0189900 [Oryza sativa Japonica Group]
 gb|ABA96027.1| Las1-like family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF29356.1| Os12g0189900 [Oryza sativa Japonica Group]
 dbj|BAG89794.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52888.1| hypothetical protein OsJ_35471 [Oryza sativa Japonica Group]
Length=595

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +W EW  + D LFS+SP +     RRI+ WR+RG +PV VDVTA+
Sbjct  20   STGRKLVPWSSWAEWRHVRDGLFSASPAAAL---RRIAAWRSRGTLPVPVDVTAA  71



>gb|EEC68976.1| hypothetical protein OsI_37725 [Oryza sativa Indica Group]
Length=598

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +W EW  + D LFS+SP +     RRI+ WR+RG +PV VDVTA+
Sbjct  23   STGRKLVPWSSWAEWRHVRDGLFSASPAAAL---RRIAAWRSRGTLPVPVDVTAA  74



>ref|XP_004970301.1| PREDICTED: uncharacterized protein LOC101771511 [Setaria italica]
Length=601

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  133  SQGLKLVPWLTWEEWSFIGDslfsssplsvdsalRRISTWRNRGCIPVAVDVTAS  297
            S G KLVPW +WEEW F+ D           +ALRRIS WR+RG + + VDVTA+
Sbjct  25   STGRKLVPWSSWEEWRFVRD---GLFSPFPAAALRRISAWRSRGSLLIPVDVTAA  76



Lambda      K        H        a         alpha
   0.317    0.132    0.456    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564737980045