BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP019H07 563 bp,

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795340.1|  PREDICTED: pumilio homolog 1-like isoform X2       220   7e-64   Nicotiana sylvestris
ref|XP_009795329.1|  PREDICTED: pumilio homolog 1-like isoform X1       220   7e-64   Nicotiana sylvestris
ref|XP_009631474.1|  PREDICTED: pumilio homolog 1-like isoform X3       218   1e-63   Nicotiana tomentosiformis
ref|XP_009631473.1|  PREDICTED: pumilio homolog 1-like isoform X2       218   9e-63   Nicotiana tomentosiformis
ref|XP_009631472.1|  PREDICTED: pumilio homolog 1-like isoform X1       218   9e-63   Nicotiana tomentosiformis
ref|XP_009597729.1|  PREDICTED: pumilio homolog 2-like isoform X2       213   7e-61   Nicotiana tomentosiformis
ref|XP_009597728.1|  PREDICTED: pumilio homolog 1-like isoform X1       214   1e-60   Nicotiana tomentosiformis
ref|XP_009795986.1|  PREDICTED: pumilio homolog 1-like                  210   1e-59   Nicotiana sylvestris
ref|XP_006346707.1|  PREDICTED: pumilio homolog 1-like                  205   2e-57   Solanum tuberosum [potatoes]
ref|XP_004236737.1|  PREDICTED: pumilio homolog 1-like                  203   8e-57   Solanum lycopersicum
ref|XP_010658540.1|  PREDICTED: pumilio homolog 2-like                  198   5e-55   Vitis vinifera
ref|XP_006343744.1|  PREDICTED: pumilio homolog 1-like                  197   6e-55   Solanum tuberosum [potatoes]
gb|KHG26002.1|  Pumilio -like protein                                   189   1e-51   Gossypium arboreum [tree cotton]
ref|XP_007016356.1|  Pumilio 2 isoform 3                                187   3e-51   Theobroma cacao [chocolate]
ref|XP_007016355.1|  Pumilio 2 isoform 2                                187   5e-51   Theobroma cacao [chocolate]
ref|XP_007016354.1|  Pumilio 2 isoform 1                                187   5e-51   Theobroma cacao [chocolate]
emb|CBI31647.3|  unnamed protein product                                185   8e-51   Vitis vinifera
ref|XP_007218909.1|  hypothetical protein PRUPE_ppa000626mg             184   3e-50   Prunus persica
gb|KDP44926.1|  hypothetical protein JCGZ_01426                         182   2e-49   Jatropha curcas
ref|XP_010067428.1|  PREDICTED: pumilio homolog 1-like                  182   3e-49   Eucalyptus grandis [rose gum]
ref|XP_002524200.1|  pumilio, putative                                  182   3e-49   
ref|XP_008233648.1|  PREDICTED: pumilio homolog 1-like                  182   4e-49   Prunus mume [ume]
gb|KJB21631.1|  hypothetical protein B456_004G005400                    180   2e-48   Gossypium raimondii
ref|XP_002524201.1|  pumilio, putative                                  179   2e-48   Ricinus communis
gb|KJB21632.1|  hypothetical protein B456_004G005400                    179   2e-48   Gossypium raimondii
gb|KJB21630.1|  hypothetical protein B456_004G005400                    180   2e-48   Gossypium raimondii
gb|KJB21633.1|  hypothetical protein B456_004G005400                    179   2e-48   Gossypium raimondii
gb|KJB08904.1|  hypothetical protein B456_001G112000                    179   2e-48   Gossypium raimondii
gb|KJB08902.1|  hypothetical protein B456_001G112000                    179   2e-48   Gossypium raimondii
gb|KJB08905.1|  hypothetical protein B456_001G112000                    179   2e-48   Gossypium raimondii
gb|KJB08901.1|  hypothetical protein B456_001G112000                    179   3e-48   Gossypium raimondii
ref|XP_010650999.1|  PREDICTED: pumilio homolog 2 isoform X1            179   3e-48   Vitis vinifera
emb|CAN61602.1|  hypothetical protein VITISV_024967                     179   3e-48   Vitis vinifera
ref|XP_002283191.1|  PREDICTED: pumilio homolog 2 isoform X2            179   3e-48   Vitis vinifera
ref|XP_008343532.1|  PREDICTED: pumilio homolog 2-like                  177   1e-47   Malus domestica [apple tree]
gb|KHG15533.1|  Pumilio -like protein                                   176   3e-47   Gossypium arboreum [tree cotton]
ref|XP_011032252.1|  PREDICTED: pumilio homolog 2-like isoform X1       175   7e-47   Populus euphratica
ref|XP_011032254.1|  PREDICTED: pumilio homolog 2-like isoform X2       175   7e-47   Populus euphratica
ref|XP_009343723.1|  PREDICTED: pumilio homolog 2-like                  174   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_002314164.2|  hypothetical protein POPTR_0009s03980g             174   1e-46   Populus trichocarpa [western balsam poplar]
gb|KHG11376.1|  Pumilio -like protein                                   174   1e-46   Gossypium arboreum [tree cotton]
gb|KJB20009.1|  hypothetical protein B456_003G129200                    174   2e-46   Gossypium raimondii
gb|KJB20011.1|  hypothetical protein B456_003G129200                    174   2e-46   Gossypium raimondii
ref|XP_008222212.1|  PREDICTED: pumilio homolog 1                       173   3e-46   Prunus mume [ume]
ref|XP_007208120.1|  hypothetical protein PRUPE_ppa000627mg             173   5e-46   Prunus persica
gb|KJB55838.1|  hypothetical protein B456_009G097200                    172   6e-46   Gossypium raimondii
gb|KJB55837.1|  hypothetical protein B456_009G097200                    172   8e-46   Gossypium raimondii
ref|XP_009351433.1|  PREDICTED: pumilio homolog 1-like                  172   8e-46   Pyrus x bretschneideri [bai li]
ref|XP_011035276.1|  PREDICTED: pumilio homolog 2                       172   9e-46   Populus euphratica
gb|KHG12246.1|  Pumilio 2                                               172   1e-45   Gossypium arboreum [tree cotton]
gb|KHG12245.1|  Pumilio 2                                               172   1e-45   Gossypium arboreum [tree cotton]
ref|XP_002299859.2|  pumilio/Puf RNA-binding domain-containing fa...    171   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006592187.1|  PREDICTED: pumilio homolog 2-like isoform X3       170   3e-45   
ref|XP_003539627.1|  PREDICTED: pumilio homolog 2-like isoform X1       170   5e-45   Glycine max [soybeans]
ref|XP_010256854.1|  PREDICTED: pumilio homolog 2-like                  169   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006590976.1|  PREDICTED: pumilio homolog 2-like isoform X3       167   2e-44   
ref|XP_007009255.1|  Pumilio 2 isoform 2                                166   3e-44   Theobroma cacao [chocolate]
ref|XP_006590974.1|  PREDICTED: pumilio homolog 2-like isoform X1       167   5e-44   Glycine max [soybeans]
ref|XP_010262560.1|  PREDICTED: pumilio homolog 2-like                  167   5e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004294652.1|  PREDICTED: pumilio homolog 2                       167   5e-44   Fragaria vesca subsp. vesca
ref|XP_008371890.1|  PREDICTED: pumilio homolog 2-like                  167   5e-44   Malus domestica [apple tree]
ref|XP_007009256.1|  Pumilio 2 isoform 3                                165   6e-44   Theobroma cacao [chocolate]
ref|XP_006592185.1|  PREDICTED: pumilio homolog 2-like isoform X2       166   6e-44   
ref|XP_007009257.1|  Pumilio 2 isoform 4                                164   7e-44   Theobroma cacao [chocolate]
ref|XP_006475541.1|  PREDICTED: pumilio homolog 1-like                  164   7e-44   Citrus sinensis [Valencia orange]
ref|XP_003539618.1|  PREDICTED: pumilio homolog 2-like isoform X1       167   7e-44   Glycine max [soybeans]
gb|KHN21931.1|  Pumilio like 2                                          166   1e-43   Glycine soja [wild soybean]
ref|XP_006485456.1|  PREDICTED: pumilio homolog 1-like                  164   1e-43   Citrus sinensis [Valencia orange]
ref|XP_007009254.1|  Pumilio 2 isoform 1                                166   1e-43   Theobroma cacao [chocolate]
gb|KEH39457.1|  pumilio Mpt5 protein, putative                          165   2e-43   Medicago truncatula
ref|XP_003597396.1|  Pumilio-like protein                               165   2e-43   Medicago truncatula
ref|XP_006590979.1|  PREDICTED: pumilio homolog 2-like isoform X2       165   2e-43   
ref|XP_006469751.1|  PREDICTED: pumilio homolog 2-like                  160   2e-43   Citrus sinensis [Valencia orange]
ref|XP_003537978.1|  PREDICTED: pumilio homolog 2-like isoform X1       165   2e-43   Glycine max [soybeans]
ref|XP_006435647.1|  hypothetical protein CICLE_v10030588mg             164   4e-43   Citrus clementina
ref|XP_006435648.1|  hypothetical protein CICLE_v10030588mg             164   4e-43   Citrus clementina
gb|KDO69138.1|  hypothetical protein CISIN_1g001588mg                   164   4e-43   Citrus sinensis [Valencia orange]
gb|KDO69140.1|  hypothetical protein CISIN_1g001588mg                   164   4e-43   Citrus sinensis [Valencia orange]
ref|XP_008356857.1|  PREDICTED: pumilio homolog 1-like                  164   4e-43   Malus domestica [apple tree]
gb|KDO69136.1|  hypothetical protein CISIN_1g001588mg                   164   5e-43   Citrus sinensis [Valencia orange]
ref|XP_006486391.1|  PREDICTED: pumilio homolog 1-like                  164   5e-43   Citrus sinensis [Valencia orange]
ref|XP_006435646.1|  hypothetical protein CICLE_v10030588mg             164   5e-43   Citrus clementina
gb|KDO69137.1|  hypothetical protein CISIN_1g001588mg                   164   6e-43   Citrus sinensis [Valencia orange]
emb|CDP00123.1|  unnamed protein product                                164   7e-43   Coffea canephora [robusta coffee]
gb|KHN32144.1|  Pumilio like 2                                          162   2e-42   Glycine soja [wild soybean]
ref|XP_010106527.1|  Pumilio-2-like protein                             162   2e-42   Morus notabilis
ref|XP_010096599.1|  Pumilio-2-like protein                             162   3e-42   Morus notabilis
gb|KDO72813.1|  hypothetical protein CISIN_1g039493mg                   160   5e-42   Citrus sinensis [Valencia orange]
ref|XP_008372362.1|  PREDICTED: pumilio homolog 1-like                  158   7e-42   
gb|KHN32146.1|  Pumilio like 2                                          161   7e-42   Glycine soja [wild soybean]
ref|XP_008384935.1|  PREDICTED: pumilio homolog 1-like                  161   8e-42   Malus domestica [apple tree]
ref|XP_006424877.1|  hypothetical protein CICLE_v10027726mg             160   1e-41   Citrus clementina
ref|XP_003537979.1|  PREDICTED: pumilio homolog 2-like isoform X1       160   2e-41   
ref|XP_006424876.1|  hypothetical protein CICLE_v10027726mg             160   2e-41   Citrus clementina
gb|KHN21930.1|  Pumilio like 2                                          159   3e-41   Glycine soja [wild soybean]
ref|XP_009364362.1|  PREDICTED: pumilio homolog 1-like                  159   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_006846288.1|  hypothetical protein AMTR_s00012p00251030          158   6e-41   Amborella trichopoda
gb|KHN21928.1|  Pumilio like 2                                          157   2e-40   Glycine soja [wild soybean]
ref|XP_009375924.1|  PREDICTED: pumilio homolog 1-like isoform X1       157   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_010690975.1|  PREDICTED: pumilio homolog 1-like                  156   4e-40   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010043502.1|  PREDICTED: pumilio homolog 2-like                  155   7e-40   Eucalyptus grandis [rose gum]
gb|KCW85517.1|  hypothetical protein EUGRSUZ_B02314                     155   7e-40   Eucalyptus grandis [rose gum]
ref|XP_004160189.1|  PREDICTED: LOW QUALITY PROTEIN: pumilio homo...    153   5e-39   
ref|XP_004143128.1|  PREDICTED: pumilio homolog 1-like                  153   5e-39   Cucumis sativus [cucumbers]
ref|XP_007132044.1|  hypothetical protein PHAVU_011G062200g             151   2e-38   Phaseolus vulgaris [French bean]
ref|XP_007132045.1|  hypothetical protein PHAVU_011G062300g             150   3e-38   Phaseolus vulgaris [French bean]
gb|KHN33363.1|  Pumilio like 2                                          149   7e-38   Glycine soja [wild soybean]
ref|XP_003547219.1|  PREDICTED: pumilio homolog 2-like                  149   1e-37   
gb|KEH30178.1|  pumilio Mpt5 protein, putative                          148   2e-37   Medicago truncatula
ref|XP_008464104.1|  PREDICTED: pumilio homolog 1-like                  148   2e-37   Cucumis melo [Oriental melon]
ref|XP_011032451.1|  PREDICTED: pumilio homolog 1-like isoform X2       147   3e-37   Populus euphratica
ref|XP_003606712.1|  Pumilio-like protein                               147   3e-37   Medicago truncatula
gb|KDP44922.1|  hypothetical protein JCGZ_01422                         144   4e-37   Jatropha curcas
emb|CDP09091.1|  unnamed protein product                                147   5e-37   Coffea canephora [robusta coffee]
ref|XP_011032372.1|  PREDICTED: pumilio homolog 1-like isoform X1       147   6e-37   Populus euphratica
ref|XP_004241216.1|  PREDICTED: pumilio homolog 2-like                  146   1e-36   Solanum lycopersicum
ref|XP_002316273.2|  hypothetical protein POPTR_0010s20870g             144   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_004490876.1|  PREDICTED: pumilio homolog 1-like isoform X2       144   9e-36   Cicer arietinum [garbanzo]
ref|XP_004490875.1|  PREDICTED: pumilio homolog 1-like isoform X1       143   1e-35   Cicer arietinum [garbanzo]
ref|XP_011016453.1|  PREDICTED: pumilio homolog 1-like isoform X1       142   3e-35   Populus euphratica
ref|XP_011016454.1|  PREDICTED: pumilio homolog 1-like isoform X2       141   4e-35   Populus euphratica
ref|XP_004486985.1|  PREDICTED: pumilio homolog 2-like                  142   4e-35   Cicer arietinum [garbanzo]
ref|XP_008777342.1|  PREDICTED: pumilio homolog 2-like isoform X2       140   1e-34   Phoenix dactylifera
ref|XP_008777335.1|  PREDICTED: pumilio homolog 2-like isoform X1       140   1e-34   Phoenix dactylifera
ref|XP_011089489.1|  PREDICTED: pumilio homolog 2-like                  139   3e-34   Sesamum indicum [beniseed]
ref|XP_010906596.1|  PREDICTED: pumilio homolog 2-like isoform X2       139   4e-34   Elaeis guineensis
ref|XP_010906595.1|  PREDICTED: pumilio homolog 2-like isoform X1       139   4e-34   Elaeis guineensis
ref|XP_008785558.1|  PREDICTED: pumilio homolog 2-like                  137   2e-33   Phoenix dactylifera
gb|EYU45944.1|  hypothetical protein MIMGU_mgv1a000618mg                137   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_004507166.1|  PREDICTED: pumilio homolog 2-like isoform X1       134   2e-32   Cicer arietinum [garbanzo]
ref|XP_010922284.1|  PREDICTED: pumilio homolog 2-like                  134   2e-32   Elaeis guineensis
ref|XP_006350783.1|  PREDICTED: pumilio homolog 2-like isoform X1       132   6e-32   Solanum tuberosum [potatoes]
ref|XP_006350784.1|  PREDICTED: pumilio homolog 2-like isoform X2       132   6e-32   
ref|XP_007141399.1|  hypothetical protein PHAVU_008G192100g             131   2e-31   Phaseolus vulgaris [French bean]
ref|XP_011076804.1|  PREDICTED: pumilio homolog 2-like isoform X2       130   2e-31   Sesamum indicum [beniseed]
ref|XP_011002642.1|  PREDICTED: pumilio homolog 1-like                  130   3e-31   Populus euphratica
ref|XP_011076803.1|  PREDICTED: pumilio homolog 2-like isoform X1       130   3e-31   Sesamum indicum [beniseed]
gb|AES99404.2|  pumilio-family RNA-binding repeatprotein                130   6e-31   Medicago truncatula
ref|XP_003616446.1|  Pumilio-like protein                               130   6e-31   
ref|XP_010920533.1|  PREDICTED: pumilio homolog 1-like                  129   1e-30   Elaeis guineensis
ref|XP_002311179.2|  hypothetical protein POPTR_0008s05850g             128   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004147681.1|  PREDICTED: pumilio homolog 1-like                  127   5e-30   
gb|KGN50567.1|  hypothetical protein Csa_5G182720                       127   5e-30   Cucumis sativus [cucumbers]
ref|XP_010557243.1|  PREDICTED: pumilio homolog 2-like                  126   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010321733.1|  PREDICTED: LOW QUALITY PROTEIN: pumilio homo...    125   1e-29   Solanum lycopersicum
ref|XP_008461691.1|  PREDICTED: pumilio homolog 1-like                  125   1e-29   Cucumis melo [Oriental melon]
ref|XP_010685712.1|  PREDICTED: pumilio homolog 2-like isoform X1       125   2e-29   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010685713.1|  PREDICTED: pumilio homolog 2-like isoform X2       125   2e-29   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006827416.1|  hypothetical protein AMTR_s00009p00067490          124   4e-29   
ref|XP_006358700.1|  PREDICTED: pumilio homolog 2-like                  122   3e-28   
ref|XP_009381078.1|  PREDICTED: pumilio homolog 2-like isoform X2       121   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381077.1|  PREDICTED: pumilio homolog 2-like isoform X1       121   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABW81063.1|  Mpt5-1                                                  120   1e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_002881034.1|  mpt5-1                                             119   2e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_009402270.1|  PREDICTED: pumilio homolog 3-like                  119   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABW81111.1|  putative pumilio Mpt5                                   119   3e-27   Boechera divaricarpa
ref|XP_006409965.1|  hypothetical protein EUTSA_v10016189mg             119   4e-27   Eutrema salsugineum
ref|XP_010937586.1|  PREDICTED: pumilio homolog 1-like                  119   4e-27   Elaeis guineensis
gb|ABW81068.1|  Mpt5-3                                                  119   4e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_002879203.1|  mpt5-3                                             118   8e-27   Arabidopsis lyrata subsp. lyrata
gb|ABW81112.1|  putative pumilio Mpt5-2                                 117   1e-26   Boechera divaricarpa
gb|ABW81162.1|  PMpt5-1                                                 117   2e-26   Capsella rubella
ref|XP_010253957.1|  PREDICTED: pumilio homolog 4-like                  117   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009802143.1|  PREDICTED: pumilio homolog 2-like isoform X1       116   2e-26   Nicotiana sylvestris
ref|XP_009802144.1|  PREDICTED: pumilio homolog 2-like isoform X2       116   2e-26   Nicotiana sylvestris
ref|XP_004970555.1|  PREDICTED: pumilio homolog 2-like                  116   3e-26   Setaria italica
gb|ABW74568.1|  Mpt5                                                    116   3e-26   Boechera divaricarpa
ref|XP_006409963.1|  hypothetical protein EUTSA_v10016185mg             116   3e-26   Eutrema salsugineum
ref|XP_006409962.1|  hypothetical protein EUTSA_v10016184mg             115   4e-26   Eutrema salsugineum
ref|XP_010418800.1|  PREDICTED: pumilio homolog 2-like                  116   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006293694.1|  hypothetical protein CARUB_v10022652mg             115   5e-26   Capsella rubella
ref|XP_010469982.1|  PREDICTED: pumilio homolog 2-like                  115   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010510528.1|  PREDICTED: pumilio homolog 2-like                  115   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006644998.1|  PREDICTED: pumilio homolog 2-like                  115   7e-26   Oryza brachyantha
dbj|BAB89558.1|  putative pumilio domain-containing protein PPD1        115   7e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044782.1|  Os01g0844800                                       115   7e-26   
gb|EAY76473.1|  hypothetical protein OsI_04410                          115   8e-26   Oryza sativa Indica Group [Indian rice]
gb|ABW81161.1|  unknown                                                 115   9e-26   Capsella rubella
ref|XP_006293626.1|  hypothetical protein CARUB_v10022579mg             114   1e-25   Capsella rubella
ref|XP_010414430.1|  PREDICTED: pumilio homolog 2-like                  114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010473984.1|  PREDICTED: pumilio homolog 2-like                  114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010414415.1|  PREDICTED: pumilio homolog 2-like                  114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002456623.1|  hypothetical protein SORBIDRAFT_03g039600          113   4e-25   Sorghum bicolor [broomcorn]
ref|XP_002863049.1|  hypothetical protein ARALYDRAFT_920647             110   5e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_010241847.1|  PREDICTED: pumilio homolog 4-like                  112   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009597138.1|  PREDICTED: pumilio homolog 2-like isoform X2       109   6e-24   Nicotiana tomentosiformis
ref|XP_009597137.1|  PREDICTED: pumilio homolog 2-like isoform X1       109   6e-24   Nicotiana tomentosiformis
ref|NP_180483.1|  pumilio 1                                             108   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535459.1|  PREDICTED: pumilio homolog 2-like                  108   1e-23   Tarenaya hassleriana [spider flower]
gb|EMT17283.1|  Pumilio-like protein                                    108   2e-23   Aegilops tauschii
ref|XP_010469980.1|  PREDICTED: pumilio homolog 2                       108   2e-23   Camelina sativa [gold-of-pleasure]
emb|CDM84977.1|  unnamed protein product                                108   2e-23   Triticum aestivum [Canadian hard winter wheat]
ref|NP_180482.1|  pumilio 2                                             107   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EMS59607.1|  Pumilio-like protein 2                                  107   4e-23   Triticum urartu
dbj|BAE98746.1|  putative pumilio/Mpt5 family RNA-binding protein       107   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295787.1|  hypothetical protein CARUB_v10024911mg             107   5e-23   Capsella rubella
gb|AAM20149.1|  putative pumilio/Mpt5 family RNA-binding protein        107   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABW81064.1|  AlMpt5-2                                                106   8e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_008658750.1|  PREDICTED: pumilio homolog 1-like                  105   1e-22   Zea mays [maize]
tpg|DAA46484.1|  TPA: hypothetical protein ZEAMMB73_346749              105   1e-22   Zea mays [maize]
gb|AFW82890.1|  hypothetical protein ZEAMMB73_959107                    105   1e-22   Zea mays [maize]
ref|NP_001146200.1|  uncharacterized protein LOC100279770               105   1e-22   Zea mays [maize]
gb|ACN27840.1|  unknown                                                 105   1e-22   Zea mays [maize]
ref|XP_006279123.1|  hypothetical protein CARUB_v10008047mg             104   3e-22   Capsella rubella
ref|XP_010535467.1|  PREDICTED: pumilio homolog 2-like                  104   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_002440447.1|  hypothetical protein SORBIDRAFT_09g001090          103   5e-22   Sorghum bicolor [broomcorn]
ref|NP_180478.1|  pumilio 3                                             103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535464.1|  PREDICTED: pumilio homolog 2-like                  102   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_009616462.1|  PREDICTED: pumilio homolog 2-like isoform X3       102   2e-21   Nicotiana tomentosiformis
ref|XP_009779662.1|  PREDICTED: pumilio homolog 2-like isoform X1       102   2e-21   Nicotiana sylvestris
ref|XP_009779664.1|  PREDICTED: pumilio homolog 2-like isoform X2       102   3e-21   Nicotiana sylvestris
ref|XP_009616459.1|  PREDICTED: pumilio homolog 2-like isoform X1       102   3e-21   Nicotiana tomentosiformis
ref|XP_009616461.1|  PREDICTED: pumilio homolog 2-like isoform X2       101   3e-21   Nicotiana tomentosiformis
ref|XP_004960534.1|  PREDICTED: pumilio homolog 1-like                  101   4e-21   Setaria italica
ref|XP_009384840.1|  PREDICTED: pumilio homolog 2-like                  100   6e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010535463.1|  PREDICTED: pumilio homolog 2-like                97.8    8e-20   Tarenaya hassleriana [spider flower]
gb|EYU19929.1|  hypothetical protein MIMGU_mgv1a001211mg              95.9    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_006653961.1|  PREDICTED: pumilio homolog 1-like                95.9    4e-19   
gb|EMS50302.1|  Pumilio-like protein 3                                93.6    2e-18   Triticum urartu
ref|NP_001170502.1|  uncharacterized protein LOC100384506             91.3    3e-18   Zea mays [maize]
gb|AAM22812.1|AF427791_3  BPM                                         92.4    5e-18   Hordeum vulgare subsp. vulgare [barley]
gb|AFW74987.1|  hypothetical protein ZEAMMB73_090092                  92.4    5e-18   Zea mays [maize]
ref|XP_008648194.1|  PREDICTED: uncharacterized protein LOC100384...  92.0    6e-18   Zea mays [maize]
gb|EEE62062.1|  hypothetical protein OsJ_16846                        92.0    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78380.1|  hypothetical protein OsI_18154                        92.0    6e-18   Oryza sativa Indica Group [Indian rice]
dbj|BAH00903.1|  unnamed protein product                              92.0    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAU44141.1|  putative pumilio/Mpt5 family RNA-binding protein      92.0    7e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAK73144.1|AC079022_17  putative pumilio/Mpt5 family RNA-bindi...  92.0    7e-18   Oryza sativa [red rice]
ref|XP_003569112.1|  PREDICTED: pumilio homolog 1-like                90.1    2e-17   
ref|XP_010231850.1|  PREDICTED: pumilio homolog 1-like                90.1    3e-17   Brachypodium distachyon [annual false brome]
ref|XP_008233289.1|  PREDICTED: pumilio homolog 4                     89.4    6e-17   Prunus mume [ume]
ref|XP_009396181.1|  PREDICTED: pumilio homolog 1-like                89.0    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008365664.1|  PREDICTED: pumilio homolog 4                     88.6    1e-16   Malus domestica [apple tree]
gb|EMT27786.1|  Pumilio-like protein                                  87.8    2e-16   Aegilops tauschii
ref|XP_002273503.1|  PREDICTED: pumilio homolog 4 isoform X1          86.7    5e-16   Vitis vinifera
ref|XP_010658381.1|  PREDICTED: pumilio homolog 4 isoform X2          86.3    5e-16   Vitis vinifera
ref|XP_009368908.1|  PREDICTED: pumilio homolog 4 isoform X2          85.9    8e-16   Pyrus x bretschneideri [bai li]
ref|XP_009368909.1|  PREDICTED: pumilio homolog 4 isoform X3          85.9    8e-16   Pyrus x bretschneideri [bai li]
ref|XP_009368907.1|  PREDICTED: pumilio homolog 4 isoform X1          85.9    8e-16   Pyrus x bretschneideri [bai li]
ref|XP_010935723.1|  PREDICTED: pumilio homolog 1-like                84.7    2e-15   Elaeis guineensis
ref|XP_007220282.1|  hypothetical protein PRUPE_ppa000731mg           83.6    5e-15   Prunus persica
emb|CDM82624.1|  unnamed protein product                              82.4    9e-15   Triticum aestivum [Canadian hard winter wheat]
gb|EMT10419.1|  Pumilio-like protein                                  82.4    1e-14   Aegilops tauschii
gb|EMS46736.1|  Pumilio-like protein 1                                82.8    1e-14   Triticum urartu
dbj|BAK03395.1|  predicted protein                                    82.4    1e-14   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008362674.1|  PREDICTED: pumilio homolog 4-like isoform X2     82.4    1e-14   Malus domestica [apple tree]
ref|XP_008362673.1|  PREDICTED: pumilio homolog 4-like isoform X1     82.4    1e-14   Malus domestica [apple tree]
ref|XP_007009913.1|  Pumilio 4 isoform 2                              81.3    3e-14   Theobroma cacao [chocolate]
ref|XP_007009912.1|  Pumilio 4 isoform 1                              81.3    3e-14   Theobroma cacao [chocolate]
ref|XP_007009914.1|  Pumilio 4 isoform 3                              80.9    3e-14   Theobroma cacao [chocolate]
ref|XP_009395430.1|  PREDICTED: pumilio homolog 1-like                80.9    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789554.1|  PREDICTED: pumilio homolog 4-like                80.5    5e-14   Phoenix dactylifera
emb|CDM87073.1|  unnamed protein product                              79.7    9e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008800533.1|  PREDICTED: pumilio homolog 1-like                76.3    1e-12   Phoenix dactylifera
gb|AGW24466.1|  pumilio-like protein 3                                70.9    2e-12   Avicennia marina subsp. marina
ref|XP_009140975.1|  PREDICTED: pumilio homolog 1-like                75.5    2e-12   Brassica rapa
emb|CDY31766.1|  BnaA04g17020D                                        75.5    2e-12   Brassica napus [oilseed rape]
gb|EPS67369.1|  hypothetical protein M569_07403                       74.3    3e-12   Genlisea aurea
gb|KJB74738.1|  hypothetical protein B456_012G005400                  73.9    7e-12   Gossypium raimondii
gb|KJB74739.1|  hypothetical protein B456_012G005400                  73.9    7e-12   Gossypium raimondii
emb|CDY50144.1|  BnaC04g40330D                                        73.9    8e-12   Brassica napus [oilseed rape]
ref|XP_011041036.1|  PREDICTED: pumilio homolog 4-like                72.4    3e-11   Populus euphratica
gb|KHG29032.1|  Pumilio -like protein                                 71.6    4e-11   Gossypium arboreum [tree cotton]
ref|NP_001045538.1|  Os01g0971900                                     70.5    1e-10   
gb|AAX58753.1|  PUF-domain RNA-binding protein                        69.7    2e-10   Physcomitrella patens
ref|XP_002316382.2|  pumilio/Puf RNA-binding domain-containing fa...  69.3    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_001767683.1|  predicted protein                                68.9    3e-10   Physcomitrella patens
ref|XP_001767745.1|  predicted protein                                68.6    4e-10   Physcomitrella patens
ref|XP_002530940.1|  pumilio, putative                                67.0    1e-09   
gb|KDO48815.1|  hypothetical protein CISIN_1g001685mg                 65.9    3e-09   Citrus sinensis [Valencia orange]
ref|XP_006436466.1|  hypothetical protein CICLE_v10030594mg           65.9    3e-09   Citrus clementina
gb|KDO48818.1|  hypothetical protein CISIN_1g001685mg                 65.9    3e-09   Citrus sinensis [Valencia orange]
gb|KDO48817.1|  hypothetical protein CISIN_1g001685mg                 65.9    3e-09   Citrus sinensis [Valencia orange]
ref|XP_002311080.2|  hypothetical protein POPTR_0008s03630g           65.1    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010940626.1|  PREDICTED: pumilio homolog 1-like                63.9    1e-08   Elaeis guineensis
ref|XP_001767679.1|  predicted protein                                62.8    3e-08   Physcomitrella patens
ref|XP_007143735.1|  hypothetical protein PHAVU_007G097100g           62.8    3e-08   Phaseolus vulgaris [French bean]
ref|XP_010112210.1|  Pumilio-4-like protein                           62.8    3e-08   Morus notabilis
gb|KDP30469.1|  hypothetical protein JCGZ_16148                       62.0    5e-08   Jatropha curcas
ref|XP_004496247.1|  PREDICTED: pumilio homolog 4-like isoform X5     61.6    7e-08   
ref|XP_004496246.1|  PREDICTED: pumilio homolog 4-like isoform X4     61.6    7e-08   
ref|XP_004496245.1|  PREDICTED: pumilio homolog 4-like isoform X3     61.6    8e-08   
ref|XP_004496243.1|  PREDICTED: pumilio homolog 4-like isoform X1     61.6    8e-08   
ref|XP_001759120.1|  predicted protein                                59.7    3e-07   
gb|AES62113.2|  pumilio-family RNA-binding repeatprotein              59.7    3e-07   
gb|KEH43508.1|  pumilio-family RNA-binding repeatprotein              59.7    3e-07   
ref|XP_003591862.1|  60S ribosomal protein L4                         59.7    3e-07   
gb|KHN17156.1|  Pumilio like 4                                        59.3    3e-07   
ref|XP_006279124.1|  hypothetical protein CARUB_v10008048mg           58.9    3e-07   
ref|XP_006589408.1|  PREDICTED: pumilio homolog 4-like isoform X1     59.3    4e-07   
ref|XP_006589409.1|  PREDICTED: pumilio homolog 4-like isoform X2     59.3    4e-07   
gb|KEH43507.1|  pumilio-family RNA-binding repeatprotein              59.3    4e-07   
ref|XP_011469641.1|  PREDICTED: pumilio homolog 4                     56.6    3e-06   
ref|XP_006606261.1|  PREDICTED: pumilio homolog 4-like isoform X1     56.6    3e-06   
ref|XP_006606263.1|  PREDICTED: pumilio homolog 4-like isoform X3     56.6    3e-06   
gb|KHN00858.1|  Pumilio like 4                                        56.2    3e-06   
ref|XP_011031696.1|  PREDICTED: pumilio homolog 4-like                55.8    4e-06   
ref|XP_010263225.1|  PREDICTED: pumilio homolog 5 isoform X3          53.1    4e-05   
ref|XP_010263223.1|  PREDICTED: pumilio homolog 5 isoform X1          52.8    5e-05   
ref|XP_010263224.1|  PREDICTED: pumilio homolog 5 isoform X2          52.8    5e-05   
ref|XP_002453050.1|  hypothetical protein SORBIDRAFT_04g037410        51.6    1e-04   
gb|AFW63978.1|  hypothetical protein ZEAMMB73_492361                  50.1    3e-04   
ref|XP_008679159.1|  PREDICTED: pumilio homolog 3-like                50.1    4e-04   



>ref|XP_009795340.1| PREDICTED: pumilio homolog 1-like isoform X2 [Nicotiana sylvestris]
Length=693

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P L +N+ AG  +GA GID R+M GGL   PNLLAAAAE+QN++RL   +LG+S+Q 
Sbjct  427  GNFPSLFENISAGATMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQTLGSSLQI  486

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P +DP+YLQYLRST+  +A L+A+N+P +NRESLGNSYMD LELQKA+ G L ASQKSQY
Sbjct  487  PQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGNSYMDLLELQKAYFGALFASQKSQY  546

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G     K+GGIN+GYYGN  LG  +SYPGSPLAG+ L NSPF PGSP+RYGERNMHF SG
Sbjct  547  GLSCLGKSGGINNGYYGNIALGINMSYPGSPLAGAALHNSPFWPGSPIRYGERNMHFPSG  606

Query  545  MRNL  556
            MRNL
Sbjct  607  MRNL  610



>ref|XP_009795329.1| PREDICTED: pumilio homolog 1-like isoform X1 [Nicotiana sylvestris]
Length=703

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P L +N+ AG  +GA GID R+M GGL   PNLLAAAAE+QN++RL   +LG+S+Q 
Sbjct  437  GNFPSLFENISAGATMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQTLGSSLQI  496

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P +DP+YLQYLRST+  +A L+A+N+P +NRESLGNSYMD LELQKA+ G L ASQKSQY
Sbjct  497  PQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGNSYMDLLELQKAYFGALFASQKSQY  556

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G     K+GGIN+GYYGN  LG  +SYPGSPLAG+ L NSPF PGSP+RYGERNMHF SG
Sbjct  557  GLSCLGKSGGINNGYYGNIALGINMSYPGSPLAGAALHNSPFWPGSPIRYGERNMHFPSG  616

Query  545  MRNL  556
            MRNL
Sbjct  617  MRNL  620



>ref|XP_009631474.1| PREDICTED: pumilio homolog 1-like isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009631475.1| PREDICTED: pumilio homolog 1-like isoform X3 [Nicotiana tomentosiformis]
Length=610

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P L +N+ AG  +GA GID R+M GGL   PNLLAAAAE+QN++RL   +LG S+Q 
Sbjct  257  GNFPSLFENISAGVTMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQTLGRSLQI  316

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P +DP+YLQYLRST+  +A L+A+N+P +NRESLG+SYMD LELQKA+ G LLASQKS+Y
Sbjct  317  PQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGSSYMDLLELQKAYFGVLLASQKSEY  376

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G     K+GG+N+GYYGN  LG  +SYPGSPLAG+ L NSPF PGSPVRYGERNMHF SG
Sbjct  377  GLLCLGKSGGLNNGYYGNIALGVNMSYPGSPLAGAALHNSPFWPGSPVRYGERNMHFPSG  436

Query  545  MRNL  556
            MRNL
Sbjct  437  MRNL  440



>ref|XP_009631473.1| PREDICTED: pumilio homolog 1-like isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P L +N+ AG  +GA GID R+M GGL   PNLLAAAAE+QN++RL   +LG S+Q 
Sbjct  427  GNFPSLFENISAGVTMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQTLGRSLQI  486

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P +DP+YLQYLRST+  +A L+A+N+P +NRESLG+SYMD LELQKA+ G LLASQKS+Y
Sbjct  487  PQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGSSYMDLLELQKAYFGVLLASQKSEY  546

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G     K+GG+N+GYYGN  LG  +SYPGSPLAG+ L NSPF PGSPVRYGERNMHF SG
Sbjct  547  GLLCLGKSGGLNNGYYGNIALGVNMSYPGSPLAGAALHNSPFWPGSPVRYGERNMHFPSG  606

Query  545  MRNL  556
            MRNL
Sbjct  607  MRNL  610



>ref|XP_009631472.1| PREDICTED: pumilio homolog 1-like isoform X1 [Nicotiana tomentosiformis]
Length=780

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P L +N+ AG  +GA GID R+M GGL   PNLLAAAAE+QN++RL   +LG S+Q 
Sbjct  427  GNFPSLFENISAGVTMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQTLGRSLQI  486

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P +DP+YLQYLRST+  +A L+A+N+P +NRESLG+SYMD LELQKA+ G LLASQKS+Y
Sbjct  487  PQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGSSYMDLLELQKAYFGVLLASQKSEY  546

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G     K+GG+N+GYYGN  LG  +SYPGSPLAG+ L NSPF PGSPVRYGERNMHF SG
Sbjct  547  GLLCLGKSGGLNNGYYGNIALGVNMSYPGSPLAGAALHNSPFWPGSPVRYGERNMHFPSG  606

Query  545  MRNL  556
            MRNL
Sbjct  607  MRNL  610



>ref|XP_009597729.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana tomentosiformis]
Length=933

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 146/185 (79%), Gaps = 4/185 (2%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P +  N+   + +GA GID+R+ GG L+L PNLLAAAAE+QNL RL N +LG S+Q 
Sbjct  377  GNFPSVLGNIA--SPVGACGIDARATGGSLSLGPNLLAAAAELQNL-RLGNQTLGGSLQM  433

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQY  364
              MDPLYLQYLRST+  AA L ALN+P +NRESLG SYMD +ELQKA+L  LLASQ SQY
Sbjct  434  SQMDPLYLQYLRSTEYHAAQLAALNDPTVNRESLGTSYMDLIELQKAYLETLLASQNSQY  493

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+GG+NHGYYGN+  G  +SYPGSPLAG++LPNSPFGPGSPVRYGERNMHF SG
Sbjct  494  GLPYLGKSGGLNHGYYGNTANGLNMSYPGSPLAGAVLPNSPFGPGSPVRYGERNMHFPSG  553

Query  545  MRNLG  559
            MRNL 
Sbjct  554  MRNLA  558



>ref|XP_009597728.1| PREDICTED: pumilio homolog 1-like isoform X1 [Nicotiana tomentosiformis]
Length=1010

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 146/185 (79%), Gaps = 4/185 (2%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P +  N+   + +GA GID+R+ GG L+L PNLLAAAAE+QNL RL N +LG S+Q 
Sbjct  454  GNFPSVLGNIA--SPVGACGIDARATGGSLSLGPNLLAAAAELQNL-RLGNQTLGGSLQM  510

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQY  364
              MDPLYLQYLRST+  AA L ALN+P +NRESLG SYMD +ELQKA+L  LLASQ SQY
Sbjct  511  SQMDPLYLQYLRSTEYHAAQLAALNDPTVNRESLGTSYMDLIELQKAYLETLLASQNSQY  570

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+GG+NHGYYGN+  G  +SYPGSPLAG++LPNSPFGPGSPVRYGERNMHF SG
Sbjct  571  GLPYLGKSGGLNHGYYGNTANGLNMSYPGSPLAGAVLPNSPFGPGSPVRYGERNMHFPSG  630

Query  545  MRNLG  559
            MRNL 
Sbjct  631  MRNLA  635



>ref|XP_009795986.1| PREDICTED: pumilio homolog 1-like [Nicotiana sylvestris]
Length=1012

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P +  N+   + +GA GID+R+ GG L+L PNLLAAAAE+QNL RL N +LG S+Q 
Sbjct  456  GNFPSVLGNIA--SPVGACGIDARATGGSLSLGPNLLAAAAELQNL-RLGNQTLGGSLQM  512

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQY  364
              MDPLYLQYLRST+  AA L ALN+P +NRESLG SYMD +ELQKA+L  LLASQ SQY
Sbjct  513  SQMDPLYLQYLRSTEYHAAQLAALNDPTVNRESLGTSYMDLIELQKAYLETLLASQNSQY  572

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+GG+NHGYYGN+  G  +SYPGSPLAG++LPNSPFGPGSPVRYGERNM F SG
Sbjct  573  GLPYLGKSGGLNHGYYGNAANGLNMSYPGSPLAGAVLPNSPFGPGSPVRYGERNMRFPSG  632

Query  545  MRNLG  559
            MRNL 
Sbjct  633  MRNLA  637



>ref|XP_006346707.1| PREDICTED: pumilio homolog 1-like [Solanum tuberosum]
Length=1025

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 145/186 (78%), Gaps = 3/186 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP +  N+   + +GA GID+R  GGGL+L PNL+AAAAE+QNL+RL N +LG S+ 
Sbjct  466  AGNLPSVLGNIA--SPVGACGIDARVTGGGLSLGPNLMAAAAELQNLNRLGNQTLGGSLP  523

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQ  361
               MDPLYLQYLRS +  AA L ALN+P +NRESLG SYM+ +ELQKA+L  L+ASQ SQ
Sbjct  524  MSQMDPLYLQYLRSPEYLAAQLAALNDPTVNRESLGTSYMELIELQKAYLETLVASQNSQ  583

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P   K+GG+NHGYYGN  LG  +SYPGSPLAG+ LPNSPFGPGSPVRYGERNM F S
Sbjct  584  YGIPYLGKSGGLNHGYYGNPALGLSMSYPGSPLAGAGLPNSPFGPGSPVRYGERNMRFHS  643

Query  542  GMRNLG  559
            GMRNL 
Sbjct  644  GMRNLA  649



>ref|XP_004236737.1| PREDICTED: pumilio homolog 1-like [Solanum lycopersicum]
Length=1024

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 144/186 (77%), Gaps = 3/186 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP +  N+   + +GA GID+   GGGL L PNL+AAAAE+QNL+RL N +LG S+ 
Sbjct  465  AGNLPSVLGNIA--SPVGACGIDAHVPGGGLNLGPNLMAAAAELQNLNRLGNQTLGGSLP  522

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQ  361
               MDPLYLQYLRS +  AA L ALN+P +NRESLG SYM+ +ELQKA+L  L+ASQKSQ
Sbjct  523  MSQMDPLYLQYLRSPEYLAAQLAALNDPTVNRESLGTSYMELIELQKAYLETLVASQKSQ  582

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P   K+GG+NHGYYGN  LG  +SYPGSPLAG+ LPNSPFGPGSPVRYGERNM F S
Sbjct  583  YGIPYLGKSGGLNHGYYGNPALGLNMSYPGSPLAGAGLPNSPFGPGSPVRYGERNMRFHS  642

Query  542  GMRNLG  559
            GMRNL 
Sbjct  643  GMRNLA  648



>ref|XP_010658540.1| PREDICTED: pumilio homolog 2-like [Vitis vinifera]
Length=1063

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG++P L +NV A +A+G +G+DSR++GGGL L PNL+AAA+E+QNL R+ N + GN++Q
Sbjct  505  SGNMPPLFENVAAASAMGVTGMDSRALGGGLNLGPNLMAAASELQNL-RVGNHTTGNALQ  563

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P++DPLYLQYLRS + +A    ALN+P ++RE +G+SYMD L LQKA+LG LL SQKSQ
Sbjct  564  VPVVDPLYLQYLRSAEYAATQGVALNDPTMDREYMGSSYMDLLGLQKAYLGALLTSQKSQ  623

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P   K+  +NHGYYGN   G G+SYPGSPLAG +LPNSP G GSPVR+ ERNM F S
Sbjct  624  YGVPYLGKSSSMNHGYYGNPQFGLGMSYPGSPLAGPLLPNSPVGSGSPVRHNERNMRFPS  683

Query  542  GMRNLG  559
            GMRNL 
Sbjct  684  GMRNLA  689



>ref|XP_006343744.1| PREDICTED: pumilio homolog 1-like [Solanum tuberosum]
Length=982

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+ P L +N+ AG A+GA  ID R++GGGL L PNLLA AAE+QN++RL N +LG SVQ 
Sbjct  425  GNFPSLFENIAAGAAMGACRIDPRAIGGGLNLGPNLLAVAAELQNINRLGNQTLGGSVQL  484

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQY  364
              MDP++LQYLRS +  AA L+A+N+P +NRESLGNSYMD LE+QKA++  LLASQKSQY
Sbjct  485  CQMDPMHLQYLRSAEYLAAQLSAVNDPTVNRESLGNSYMDLLEIQKAYIEALLASQKSQY  544

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
             F    K+ G N+GYYGN  LG  +SYPGSPLA + L NSPFGP S VRYGER +HF  G
Sbjct  545  DFSRIGKSCGFNNGYYGNLGLGVNMSYPGSPLASASLENSPFGPDSYVRYGERYVHFPLG  604

Query  545  MRNL  556
            MRNL
Sbjct  605  MRNL  608



>gb|KHG26002.1| Pumilio -like protein [Gossypium arboreum]
Length=1067

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +NV A +A+   G+DSR +GG      N+  AA+E  NL R+ +   GN++ 
Sbjct  506  SGNLPPLFENVAAASAMAVPGMDSRVLGGAFGSGQNISNAASESHNLGRVGSQIAGNALN  565

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DPLYLQYLR++D +AA   ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  566  APFIDPLYLQYLRTSDYAAAQQAALNDPTVDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  625

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+   N HG+YGN+T GAG+SYPGSPLA ++LPNSP GPGSP+R+ + NM F 
Sbjct  626  YGVPMGAKSTSSNLHGFYGNTTFGAGMSYPGSPLANAVLPNSPVGPGSPIRHTDLNMRFP  685

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  686  SGMRNLA  692



>ref|XP_007016356.1| Pumilio 2 isoform 3 [Theobroma cacao]
 gb|EOY33975.1| Pumilio 2 isoform 3 [Theobroma cacao]
Length=945

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 138/187 (74%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A + +   G+DSR +GGGL    N+  AA+E  NL R+ +   GN++Q
Sbjct  507  TGNLPPLFENVAAASPMAVPGMDSRVLGGGLGSGQNISNAASESHNLGRVGSQIAGNALQ  566

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR++D +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  567  APFVDPMYLQYLRTSDYAAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  626

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YGN T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  627  YGVPLGAKSGSSNLHGFYGNPTFGAGMSYPGSPLASPVIPNSPVGPGSPIRHTDLNMRFP  686

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  687  SGMRNLA  693



>ref|XP_007016355.1| Pumilio 2 isoform 2 [Theobroma cacao]
 gb|EOY33974.1| Pumilio 2 isoform 2 [Theobroma cacao]
Length=1067

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 138/187 (74%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A + +   G+DSR +GGGL    N+  AA+E  NL R+ +   GN++Q
Sbjct  507  TGNLPPLFENVAAASPMAVPGMDSRVLGGGLGSGQNISNAASESHNLGRVGSQIAGNALQ  566

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR++D +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  567  APFVDPMYLQYLRTSDYAAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  626

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YGN T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  627  YGVPLGAKSGSSNLHGFYGNPTFGAGMSYPGSPLASPVIPNSPVGPGSPIRHTDLNMRFP  686

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  687  SGMRNLA  693



>ref|XP_007016354.1| Pumilio 2 isoform 1 [Theobroma cacao]
 gb|EOY33973.1| Pumilio 2 isoform 1 [Theobroma cacao]
Length=1067

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 138/187 (74%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A + +   G+DSR +GGGL    N+  AA+E  NL R+ +   GN++Q
Sbjct  507  TGNLPPLFENVAAASPMAVPGMDSRVLGGGLGSGQNISNAASESHNLGRVGSQIAGNALQ  566

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR++D +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  567  APFVDPMYLQYLRTSDYAAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  626

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YGN T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  627  YGVPLGAKSGSSNLHGFYGNPTFGAGMSYPGSPLASPVIPNSPVGPGSPIRHTDLNMRFP  686

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  687  SGMRNLA  693



>emb|CBI31647.3| unnamed protein product [Vitis vinifera]
Length=874

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 138/181 (76%), Gaps = 5/181 (3%)
 Frame = +2

Query  29   DNVGAGT---AIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMD  199
            DNV +     A+G +G+DSR++GGGL L PNL+AAA+E+QNL R+ N + GN++Q P++D
Sbjct  321  DNVNSSFSNYAMGVTGMDSRALGGGLNLGPNLMAAASELQNL-RVGNHTTGNALQVPVVD  379

Query  200  PLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGFPS  376
            PLYLQYLRS + +A    ALN+P ++RE +G+SYMD L LQKA+LG LL SQKSQYG P 
Sbjct  380  PLYLQYLRSAEYAATQGVALNDPTMDREYMGSSYMDLLGLQKAYLGALLTSQKSQYGVPY  439

Query  377  FSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
              K+  +NHGYYGN   G G+SYPGSPLAG +LPNSP G GSPVR+ ERNM F SGMRNL
Sbjct  440  LGKSSSMNHGYYGNPQFGLGMSYPGSPLAGPLLPNSPVGSGSPVRHNERNMRFPSGMRNL  499

Query  557  G  559
             
Sbjct  500  A  500



>ref|XP_007218909.1| hypothetical protein PRUPE_ppa000626mg [Prunus persica]
 gb|EMJ20108.1| hypothetical protein PRUPE_ppa000626mg [Prunus persica]
Length=1062

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 141/185 (76%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A +A+G  G+DS + GGG++L PNLLAAAAE+QN++RL N + G++VQ 
Sbjct  504  GSLPPLFENAAAASAMG--GLDSGAFGGGMSLGPNLLAAAAELQNMNRLGNHTAGSAVQV  561

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P+MDPLYLQYLRS + +AA + ALN+P  +RE +GN YMD L LQKA+LG LL+ QKSQ+
Sbjct  562  PMMDPLYLQYLRSNEYAAAQVAALNDPTKDREGMGNMYMDLLGLQKAYLGQLLSPQKSQF  621

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G +NHGYYGN   G G+SY G+ L G +LPNSP GPGSP R+ +RN+ F+SG
Sbjct  622  GVPYIGKSGSLNHGYYGNPAYGLGMSYSGTALGGPLLPNSPVGPGSPARHSDRNLRFSSG  681

Query  545  MRNLG  559
            MRN+G
Sbjct  682  MRNMG  686



>gb|KDP44926.1| hypothetical protein JCGZ_01426 [Jatropha curcas]
Length=982

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 126/185 (68%), Gaps = 6/185 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG LP L +NV A +A+G +G+DSRS+               E+  L R+ N + GN++Q
Sbjct  426  SGGLPPLFENVAAASAVGGTGLDSRSLNALGPNLMAAAP---ELHTLSRVGNQTAGNALQ  482

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P+MDPLYLQYLRS + +AA L  LN+P + RE LGNSYMD L  QKA+LG LL+ QKSQ
Sbjct  483  VPVMDPLYLQYLRSNEYAAAQLATLNDPSMEREYLGNSYMDLL--QKAYLGSLLSPQKSQ  540

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P   K+G +NH YYG+ T G G+SY GSP+ G +L +SP G GSPVR+ ERNM FT+
Sbjct  541  YGVPYLGKSGSLNHNYYGSPTFGLGMSYSGSPIGGPLLASSPIGWGSPVRHNERNMRFTA  600

Query  542  GMRNL  556
            GM NL
Sbjct  601  GMSNL  605



>ref|XP_010067428.1| PREDICTED: pumilio homolog 1-like [Eucalyptus grandis]
 gb|KCW65554.1| hypothetical protein EUGRSUZ_G02951 [Eucalyptus grandis]
Length=990

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 139/187 (74%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L  NV A +A+G +G+D R++GGG  L PN +AAAAE+QNL R    + GN +Q
Sbjct  430  SGNLPPLFKNVAAASALGMNGLDPRALGGGSPLGPNSMAAAAELQNLSRAGAHATGNGLQ  489

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNP-IINRESLGNSYMDYLELQKAHLGLL-ASQKS  358
             PLM P YLQY RS + +AA LTAL +P +++RE +G+SYMD++ LQKA+L LL +SQKS
Sbjct  490  FPLMGPSYLQYSRSNEYAAAQLTALGDPTLLDREGMGDSYMDFMGLQKAYLDLLLSSQKS  549

Query  359  QYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            QYG P   K+G  NHGYYGN   G G+SYPG+ L   +LP+SP G GSPVR+GERN+ F+
Sbjct  550  QYGIPYLGKSGSFNHGYYGNLACGMGMSYPGNQLGSPLLPSSPLGCGSPVRHGERNVRFS  609

Query  539  SGMRNLG  559
            SG+RNLG
Sbjct  610  SGLRNLG  616



>ref|XP_002524200.1| pumilio, putative [Ricinus communis]
 gb|EEF38124.1| pumilio, putative [Ricinus communis]
Length=1011

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 6/185 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG LP L ++  A +A+G +G+DSR++G          A   E+QNL R+ N +  N+ Q
Sbjct  444  SGSLPPLFESAAAASAMGGTGLDSRALGALGPNLVAAAA---ELQNLSRVGNQNTSNAFQ  500

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQY+RS + +AA L ALN+P ++RE +GNSYMD L  QKA++G LL+ QKSQ
Sbjct  501  MPLMDPLYLQYMRSNEYAAAQLAALNDPTMDREYIGNSYMDLL--QKAYIGALLSPQKSQ  558

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P   K+G +NH YYGN   G G+SY GSP+ G +LPNSP G GSPVR+ ERNM FT+
Sbjct  559  YGVPYLGKSGSMNHNYYGNPAFGLGMSYSGSPIGGPLLPNSPIGSGSPVRHNERNMRFTA  618

Query  542  GMRNL  556
            GMRN 
Sbjct  619  GMRNF  623



>ref|XP_008233648.1| PREDICTED: pumilio homolog 1-like [Prunus mume]
Length=1060

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 141/185 (76%), Gaps = 3/185 (2%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A +A+G  G+DS + GGG++L PNLLAAAAE+QN++RL N + G++VQ 
Sbjct  502  GSLPPLFENAAAASAMG--GLDSGAFGGGMSLGPNLLAAAAELQNMNRLGNHTAGSAVQV  559

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P+MDPLYLQY+RS + +AA + ALN+P  +RE +GN YMD L LQKA+LG LL+ QKSQ+
Sbjct  560  PMMDPLYLQYVRSNEYAAAQVAALNDPTKDREGMGNMYMDLLGLQKAYLGQLLSPQKSQF  619

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G +NHGYYG+   G G+SY G+ L G +LPNSP GPGSP R+ +RN+ F+SG
Sbjct  620  GVPYIGKSGSLNHGYYGSPAYGLGMSYSGTALGGPLLPNSPVGPGSPARHSDRNLRFSSG  679

Query  545  MRNLG  559
            MRN+G
Sbjct  680  MRNMG  684



>gb|KJB21631.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=1061

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +NV A +A+   G+DSR +GG      N+  AA+E  NL R+ +   GN++ 
Sbjct  502  SGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAGNALN  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DPLYLQYLR++D +AA   ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  562  APFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  621

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P  +K+   N HG+YGN+T GAG++YPGSPLA ++LPNSP GPGSP+R+ + NM F 
Sbjct  622  Y-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLNMRFP  680

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  681  SGMRNLA  687



>ref|XP_002524201.1| pumilio, putative [Ricinus communis]
 gb|EEF38125.1| pumilio, putative [Ricinus communis]
Length=999

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 129/185 (70%), Gaps = 6/185 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG LP L ++  A +A+G +G+DSR++G          A   E+QNL R+ N +  N +Q
Sbjct  444  SGSLPPLFESAAAASAMGGTGLDSRALGALGPNLVAAAA---ELQNLSRVGNQNTNNGLQ  500

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQY+RS + +AA L ALN+P ++RE LGNSYMD L  QKA+LG LL+ QKSQ
Sbjct  501  MPLMDPLYLQYMRSNEYAAAQLAALNDPTMDREYLGNSYMDLL--QKAYLGALLSPQKSQ  558

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P    +G +NH YYGN   G G+SY GSP+ G +LP+SP G GSPVR+ ERNM FT+
Sbjct  559  YGVPYLGNSGSMNHNYYGNPAFGLGMSYSGSPIGGPLLPSSPIGSGSPVRHSERNMRFTA  618

Query  542  GMRNL  556
            GMRNL
Sbjct  619  GMRNL  623



>gb|KJB21632.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=997

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +NV A +A+   G+DSR +GG      N+  AA+E  NL R+ +   GN++ 
Sbjct  502  SGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAGNALN  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DPLYLQYLR++D +AA   ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  562  APFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  621

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P  +K+   N HG+YGN+T GAG++YPGSPLA ++LPNSP GPGSP+R+ + NM F 
Sbjct  622  Y-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLNMRFP  680

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  681  SGMRNLA  687



>gb|KJB21630.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
 gb|KJB21634.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=1062

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +NV A +A+   G+DSR +GG      N+  AA+E  NL R+ +   GN++ 
Sbjct  502  SGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAGNALN  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DPLYLQYLR++D +AA   ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  562  APFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  621

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P  +K+   N HG+YGN+T GAG++YPGSPLA ++LPNSP GPGSP+R+ + NM F 
Sbjct  622  Y-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLNMRFP  680

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  681  SGMRNLA  687



>gb|KJB21633.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=1075

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +NV A +A+   G+DSR +GG      N+  AA+E  NL R+ +   GN++ 
Sbjct  502  SGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAGNALN  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DPLYLQYLR++D +AA   ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  562  APFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  621

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P  +K+   N HG+YGN+T GAG++YPGSPLA ++LPNSP GPGSP+R+ + NM F 
Sbjct  622  Y-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLNMRFP  680

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  681  SGMRNLA  687



>gb|KJB08904.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=1035

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L ++V A +AI   G+DSR +G GL    +   AA+E+    R+ +   GN++Q
Sbjct  482  TGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQIAGNALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
              L+DP+YLQYLR++D +AA L+ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKS 
Sbjct  542  ASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLLSPQKSP  601

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YG+ T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  602  YGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSDLNMCFP  661

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  662  SGMRNLA  668



>gb|KJB08902.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
 gb|KJB08903.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=1042

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L ++V A +AI   G+DSR +G GL    +   AA+E+    R+ +   GN++Q
Sbjct  482  TGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQIAGNALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
              L+DP+YLQYLR++D +AA L+ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKS 
Sbjct  542  ASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLLSPQKSP  601

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YG+ T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  602  YGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSDLNMCFP  661

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  662  SGMRNLA  668



>gb|KJB08905.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=986

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L ++V A +AI   G+DSR +G GL    +   AA+E+    R+ +   GN++Q
Sbjct  482  TGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQIAGNALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
              L+DP+YLQYLR++D +AA L+ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKS 
Sbjct  542  ASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLLSPQKSP  601

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YG+ T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  602  YGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSDLNMCFP  661

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  662  SGMRNLA  668



>gb|KJB08901.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=1033

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L ++V A +AI   G+DSR +G GL    +   AA+E+    R+ +   GN++Q
Sbjct  473  TGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQIAGNALQ  532

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
              L+DP+YLQYLR++D +AA L+ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKS 
Sbjct  533  ASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLLSPQKSP  592

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YG+ T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  593  YGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSDLNMCFP  652

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  653  SGMRNLA  659



>ref|XP_010650999.1| PREDICTED: pumilio homolog 2 isoform X1 [Vitis vinifera]
Length=1066

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP L +NV A +A+G  GIDSR +G GL   PN+ AA +E QNL+R+ N   GN++Q
Sbjct  506  AANLPPLFENVAAASAMGVPGIDSRVLGAGLASGPNIGAATSESQNLNRIGNHMAGNALQ  565

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+ + +AA + ALN+P ++R  LGNSY+D L LQKA+LG LL+ QKSQ
Sbjct  566  APFVDPMYLQYLRTAEYAAAQVAALNDPSVDRNYLGNSYVDLLGLQKAYLGALLSPQKSQ  625

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  SK+ G N HGYYGN   G G+SYPGSPLA  ++PNSP GPGSP+R+ + NM + 
Sbjct  626  YGVPLGSKSSGSNHHGYYGNPAFGVGMSYPGSPLASPVIPNSPIGPGSPIRHNDLNMRYP  685

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  686  SGMRNLA  692



>emb|CAN61602.1| hypothetical protein VITISV_024967 [Vitis vinifera]
Length=1039

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP L +NV A +A+G  GIDSR +G GL   PN+ AA +E QNL+R+ N   GN++Q
Sbjct  479  AANLPPLFENVAAASAMGVPGIDSRVLGAGLASGPNIGAATSESQNLNRIGNHMAGNALQ  538

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+ + +AA + ALN+P ++R  LGNSY+D L LQKA+LG LL+ QKSQ
Sbjct  539  APFVDPMYLQYLRTAEYAAAQVAALNDPSVDRNYLGNSYVDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  SK+ G N HGYYGN   G G+SYPGSPLA  ++PNSP GPGSP+R+ + NM + 
Sbjct  599  YGVPLGSKSSGSNHHGYYGNPAFGVGMSYPGSPLASPVIPNSPIGPGSPIRHNDLNMRYP  658

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  659  SGMRNLA  665



>ref|XP_002283191.1| PREDICTED: pumilio homolog 2 isoform X2 [Vitis vinifera]
Length=1065

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP L +NV A +A+G  GIDSR +G GL   PN+ AA +E QNL+R+ N   GN++Q
Sbjct  505  AANLPPLFENVAAASAMGVPGIDSRVLGAGLASGPNIGAATSESQNLNRIGNHMAGNALQ  564

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+ + +AA + ALN+P ++R  LGNSY+D L LQKA+LG LL+ QKSQ
Sbjct  565  APFVDPMYLQYLRTAEYAAAQVAALNDPSVDRNYLGNSYVDLLGLQKAYLGALLSPQKSQ  624

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  SK+ G N HGYYGN   G G+SYPGSPLA  ++PNSP GPGSP+R+ + NM + 
Sbjct  625  YGVPLGSKSSGSNHHGYYGNPAFGVGMSYPGSPLASPVIPNSPIGPGSPIRHNDLNMRYP  684

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  685  SGMRNLA  691



>ref|XP_008343532.1| PREDICTED: pumilio homolog 2-like [Malus domestica]
Length=960

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A +A+G  G+DS + GG    P  L AAA E+QN+ R+ N   G+++Q 
Sbjct  471  GSLPPLFENAAAASAMG--GLDSGAFGGMSLGPNLLAAAA-ELQNI-RVGNHGGGSALQV  526

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P+MDPLY+QYLRS + +AA L ALN+P  +RE +GN+YMD L LQKA+LG LL+ QKSQ+
Sbjct  527  PMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGNTYMDLLGLQKAYLGQLLSPQKSQF  586

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G +NHGYYGN   G G+SY G+PL G +LPNSP GPGSP R+GERN+ F+SG
Sbjct  587  GAPYIGKSGSLNHGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFSSG  646

Query  545  MRNLG  559
            +RN+G
Sbjct  647  LRNMG  651



>gb|KHG15533.1| Pumilio -like protein [Gossypium arboreum]
Length=1042

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L ++V A +AI   G+DSR +G GL    +   AA+E+    R  +   GN++Q
Sbjct  482  TGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRGGSQIAGNALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
              L+DP+YLQYLR++D +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKS 
Sbjct  542  ASLIDPMYLQYLRTSDYTAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGTLLSPQKSP  601

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  +K+G  N HG+YG+ T GAG+SYPGSPLA  ++PNSP GPGSP+R+ + NM F 
Sbjct  602  YGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLASPVIPNSPVGPGSPMRHSDLNMCFP  661

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  662  SGMRNLA  668



>ref|XP_011032252.1| PREDICTED: pumilio homolog 2-like isoform X1 [Populus euphratica]
 ref|XP_011032253.1| PREDICTED: pumilio homolog 2-like isoform X1 [Populus euphratica]
Length=1067

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 134/186 (72%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +GGGL    NL AA+ E  NL R+ +S  G+++Q
Sbjct  508  TGNLPPLFENVAAASAMAIPGMDSRVLGGGLGSGANLTAASLESHNLGRVGSSIAGSALQ  567

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
             P +DP+YLQYLR+ + +   L A+N+P ++R  LGNSY++YLE+QKA+ G L+SQKSQY
Sbjct  568  APFVDPVYLQYLRTPEYATTQLAAINDPSVDRSYLGNSYLNYLEIQKAY-GFLSSQKSQY  626

Query  365  GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G P   K+G  N HGY+GN   G G+SYPGSPLA  ++PNSP GPG+P+R+ E NM F+S
Sbjct  627  GVPLGGKSGSSNHHGYFGNPGFGVGMSYPGSPLASPVIPNSPVGPGTPIRHNELNMRFSS  686

Query  542  GMRNLG  559
            GM NL 
Sbjct  687  GMSNLA  692



>ref|XP_011032254.1| PREDICTED: pumilio homolog 2-like isoform X2 [Populus euphratica]
Length=1058

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 134/186 (72%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +GGGL    NL AA+ E  NL R+ +S  G+++Q
Sbjct  499  TGNLPPLFENVAAASAMAIPGMDSRVLGGGLGSGANLTAASLESHNLGRVGSSIAGSALQ  558

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
             P +DP+YLQYLR+ + +   L A+N+P ++R  LGNSY++YLE+QKA+ G L+SQKSQY
Sbjct  559  APFVDPVYLQYLRTPEYATTQLAAINDPSVDRSYLGNSYLNYLEIQKAY-GFLSSQKSQY  617

Query  365  GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G P   K+G  N HGY+GN   G G+SYPGSPLA  ++PNSP GPG+P+R+ E NM F+S
Sbjct  618  GVPLGGKSGSSNHHGYFGNPGFGVGMSYPGSPLASPVIPNSPVGPGTPIRHNELNMRFSS  677

Query  542  GMRNLG  559
            GM NL 
Sbjct  678  GMSNLA  683



>ref|XP_009343723.1| PREDICTED: pumilio homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009343732.1| PREDICTED: pumilio homolog 2-like [Pyrus x bretschneideri]
Length=1035

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 134/185 (72%), Gaps = 5/185 (3%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A +A+G  G+DS + GG    P  L AA  E+QN+ RL N   G+++Q 
Sbjct  479  GSLPPLFENAAAASAMG--GLDSGAFGGMSLGPNLLAAAT-ELQNI-RLGNHGGGSALQV  534

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P+MDPLY+QYLRS + +AA L ALN+P  +RE +GN+YMD L LQKA+LG LL+ QKSQ+
Sbjct  535  PMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGNTYMDLLGLQKAYLGQLLSPQKSQF  594

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   ++G +NHGYYGN +   G+SY G+PL G +LPNSP GPGSP R+GERN+ F+SG
Sbjct  595  GAPYIGRSGSLNHGYYGNPSYVHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFSSG  654

Query  545  MRNLG  559
            +RN+G
Sbjct  655  LRNMG  659



>ref|XP_002314164.2| hypothetical protein POPTR_0009s03980g [Populus trichocarpa]
 gb|EEE88119.2| hypothetical protein POPTR_0009s03980g [Populus trichocarpa]
Length=1009

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 133/186 (72%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +GGGL    NL AA+ E  NL R+ +   G+++Q
Sbjct  450  TGNLPPLFENVAAASAMAMPGMDSRVLGGGLGSGANLTAASLESHNLGRVGSPMAGSALQ  509

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
             P +DP+YLQYLR+ + +   L A+N+P ++R  LGNSY++YLE+QKA+ G L+SQKSQY
Sbjct  510  APFVDPVYLQYLRTPEYATTQLAAINDPSVDRSYLGNSYLNYLEIQKAY-GFLSSQKSQY  568

Query  365  GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G P   K+G  N HGY+GN   G G+SYPGSPLA  ++PNSP GPGSP+R+ E NM F+S
Sbjct  569  GVPLGGKSGSSNHHGYFGNPGFGVGMSYPGSPLASPVIPNSPVGPGSPIRHNELNMRFSS  628

Query  542  GMRNLG  559
            GM NL 
Sbjct  629  GMSNLA  634



>gb|KHG11376.1| Pumilio -like protein [Gossypium arboreum]
Length=1060

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 138/188 (73%), Gaps = 3/188 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + ++P L  NV A +A+   G+DSR +GGGL    N+  AA+E+ NL R+ +   GN++Q
Sbjct  499  TSNMPPLFGNVTASSAVPILGMDSRVLGGGLGSGQNISNAASELHNLGRVGSQIAGNALQ  558

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR++D +AA L AL++P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  559  APFVDPMYLQYLRTSDYTAAQLAALSDPSMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  618

Query  362  Y-GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHF  535
            Y G P  +K+G  N HG+YG+ T G G+SYPGSPLA  ++PNSP GPGSP+R+ + N+HF
Sbjct  619  YGGVPLGAKSGSSNLHGFYGSPTFGTGMSYPGSPLASPLIPNSPVGPGSPIRHTDLNLHF  678

Query  536  TSGMRNLG  559
             SGMRNL 
Sbjct  679  PSGMRNLA  686



>gb|KJB20009.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
 gb|KJB20010.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
 gb|KJB20012.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
Length=1003

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 137/188 (73%), Gaps = 3/188 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + ++P L  NV A +A+   G+DSR +GGGL    N+  AA+E  NL R+ +   GN++Q
Sbjct  499  TSNMPPLFGNVTASSAVPVLGMDSRVLGGGLGSGQNISNAASESYNLGRVGSQIAGNALQ  558

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR++D +AA L AL++P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  559  APFVDPMYLQYLRTSDYTAAQLAALSDPSMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  618

Query  362  Y-GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHF  535
            Y G P  +K+G  N HG+YG+ T G G+SYPGSPLA  ++PNSP GPGSP+R+ + NMHF
Sbjct  619  YGGVPLGAKSGSSNLHGFYGSPTFGTGMSYPGSPLASPLIPNSPVGPGSPIRHTDLNMHF  678

Query  536  TSGMRNLG  559
             SGMRNL 
Sbjct  679  PSGMRNLA  686



>gb|KJB20011.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
Length=1060

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 137/188 (73%), Gaps = 3/188 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + ++P L  NV A +A+   G+DSR +GGGL    N+  AA+E  NL R+ +   GN++Q
Sbjct  499  TSNMPPLFGNVTASSAVPVLGMDSRVLGGGLGSGQNISNAASESYNLGRVGSQIAGNALQ  558

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR++D +AA L AL++P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  559  APFVDPMYLQYLRTSDYTAAQLAALSDPSMDRNFLGNSYMNLLELQKAYLGALLSPQKSQ  618

Query  362  Y-GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHF  535
            Y G P  +K+G  N HG+YG+ T G G+SYPGSPLA  ++PNSP GPGSP+R+ + NMHF
Sbjct  619  YGGVPLGAKSGSSNLHGFYGSPTFGTGMSYPGSPLASPLIPNSPVGPGSPIRHTDLNMHF  678

Query  536  TSGMRNLG  559
             SGMRNL 
Sbjct  679  PSGMRNLA  686



>ref|XP_008222212.1| PREDICTED: pumilio homolog 1 [Prunus mume]
Length=1060

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 136/187 (73%), Gaps = 7/187 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +     +A+G+ G+DSR +GGG+   PNL AAA+E  NL RL +   G+ +Q
Sbjct  505  TGNLPPLFE-----SAMGSPGMDSRVLGGGMASGPNLAAAASESHNLGRLGSPITGSGLQ  559

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  560  APFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKSQ  619

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P   K+ G N HGYYGN   G G+SYPGSP+A  ++PNSP GPGSP+R+ E NM F 
Sbjct  620  YGVPLGGKSAGSNHHGYYGNPAFGVGMSYPGSPMASPVIPNSPVGPGSPMRHNELNMCFP  679

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  680  SGMRNLA  686



>ref|XP_007208120.1| hypothetical protein PRUPE_ppa000627mg [Prunus persica]
 gb|EMJ09319.1| hypothetical protein PRUPE_ppa000627mg [Prunus persica]
Length=1062

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 136/187 (73%), Gaps = 7/187 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +     +A+G+ G+DSR +GGG+   PNL AAA+E  NL RL +   G+ +Q
Sbjct  507  TGNLPPLFE-----SAMGSPGMDSRVLGGGMASGPNLAAAASESHNLGRLGSPIAGSGLQ  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  562  APFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKSQ  621

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P   K+ G N HGYYGN   G G+SYPGSP+A  ++PNSP GPGSP+R+ E NM F 
Sbjct  622  YGVPLGGKSAGSNHHGYYGNPAFGVGMSYPGSPMASPVIPNSPVGPGSPMRHNELNMCFP  681

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  682  SGMRNLA  688



>gb|KJB55838.1| hypothetical protein B456_009G097200 [Gossypium raimondii]
Length=984

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  32   NVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLYL  211
            N+ A +AI   G+DSR  GGGL    N+ +A +E  NL R+ +   GN++Q P +DP+YL
Sbjct  494  NLPAASAIPVPGMDSRVFGGGLGSGQNISSAVSESPNLGRVGSQIAGNALQAPFVDPMYL  553

Query  212  QYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGFPSFSKT  388
            QYLR++D  AA L A N+P +NR  LG+SYM+ LELQKA+ G +L+ QKSQYG P  +K+
Sbjct  554  QYLRTSDYPAAQLPAFNDPCMNRNFLGDSYMNLLELQKAYFGSMLSPQKSQYGVPLGTKS  613

Query  389  GGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
            GG N HG+YGNST GAG+SYPGSPLA + +PNSP G GSP+R+ + NM F SG RNL
Sbjct  614  GGSNIHGFYGNSTFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNL  670



>gb|KJB55837.1| hypothetical protein B456_009G097200 [Gossypium raimondii]
Length=1045

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  32   NVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLYL  211
            N+ A +AI   G+DSR  GGGL    N+ +A +E  NL R+ +   GN++Q P +DP+YL
Sbjct  494  NLPAASAIPVPGMDSRVFGGGLGSGQNISSAVSESPNLGRVGSQIAGNALQAPFVDPMYL  553

Query  212  QYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGFPSFSKT  388
            QYLR++D  AA L A N+P +NR  LG+SYM+ LELQKA+ G +L+ QKSQYG P  +K+
Sbjct  554  QYLRTSDYPAAQLPAFNDPCMNRNFLGDSYMNLLELQKAYFGSMLSPQKSQYGVPLGTKS  613

Query  389  GGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
            GG N HG+YGNST GAG+SYPGSPLA + +PNSP G GSP+R+ + NM F SG RNL
Sbjct  614  GGSNIHGFYGNSTFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNL  670



>ref|XP_009351433.1| PREDICTED: pumilio homolog 1-like [Pyrus x bretschneideri]
Length=1022

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 5/185 (3%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A +A+G  G+DS + GG    P  L AAA E+QN+ R+ N   G+++Q 
Sbjct  466  GSLPPLFENAAAASAMG--GLDSGAFGGMSLGPNLLAAAA-ELQNI-RVGNHGTGSALQV  521

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P+MDPLY+QYLRS + +AA L ALN+P  +RE +G+ YMD L LQKA+LG  L+ QKSQ+
Sbjct  522  PMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGSMYMDLLGLQKAYLGQFLSPQKSQF  581

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+  +NHGYYGN   G G+SY G+PL G +LPNSP GPGSP R+GERN+ F+SG
Sbjct  582  GAPYVGKSASLNHGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFSSG  641

Query  545  MRNLG  559
            +RN+G
Sbjct  642  LRNMG  646



>ref|XP_011035276.1| PREDICTED: pumilio homolog 2 [Populus euphratica]
Length=1065

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 131/186 (70%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +G GL    NL AA+ E  NL R  +   G ++Q
Sbjct  507  TGNLPPLFENVAAASAMAIPGMDSRVLGSGLGSGANLTAASLESYNLGRGGSPIAGGALQ  566

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
             P +DP+YLQYLR+ D +A  L+A+N+P I+R  LGNSY+++LE+QKA+ GLL+SQKSQY
Sbjct  567  APFVDPMYLQYLRTPDYAATQLSAINDPSIDRNYLGNSYLNFLEIQKAY-GLLSSQKSQY  625

Query  365  GFPSFSKTG-GINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G P   K+G   +HGY+GN   G G+ YPGSPLA  ++PNSP GP SP+R+ E NM F S
Sbjct  626  GVPLGGKSGSSTHHGYFGNPAFGVGMPYPGSPLASPVIPNSPVGPASPLRHNELNMRFPS  685

Query  542  GMRNLG  559
            GMRNL 
Sbjct  686  GMRNLA  691



>gb|KHG12246.1| Pumilio 2 [Gossypium arboreum]
Length=1477

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  32   NVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLYL  211
            N+ AG+ I   G+DSR  GG L    N+ +AA+E  NL R+ +   GN++Q P +DP+YL
Sbjct  494  NLPAGSTIPVPGMDSRVFGGDLGSGQNISSAASESLNLGRIGSQIAGNALQAPFVDPMYL  553

Query  212  QYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGFPSFSKT  388
            QYLR++D  AA L A N+P ++R  LG+SYM+ LELQKA+ G LL+ QKSQYG P  +K+
Sbjct  554  QYLRTSDYPAAQLPAFNDPCMDRNFLGDSYMNLLELQKAYFGSLLSPQKSQYGVPLGTKS  613

Query  389  GGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
            GG N HG+YGNST GAG+SYPGSPLA + +PNSP G GSP+R+ + NM F SG RNL
Sbjct  614  GGSNIHGFYGNSTFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNL  670



>gb|KHG12245.1| Pumilio 2 [Gossypium arboreum]
Length=1478

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  32   NVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLYL  211
            N+ AG+ I   G+DSR  GG L    N+ +AA+E  NL R+ +   GN++Q P +DP+YL
Sbjct  494  NLPAGSTIPVPGMDSRVFGGDLGSGQNISSAASESLNLGRIGSQIAGNALQAPFVDPMYL  553

Query  212  QYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGFPSFSKT  388
            QYLR++D  AA L A N+P ++R  LG+SYM+ LELQKA+ G LL+ QKSQYG P  +K+
Sbjct  554  QYLRTSDYPAAQLPAFNDPCMDRNFLGDSYMNLLELQKAYFGSLLSPQKSQYGVPLGTKS  613

Query  389  GGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
            GG N HG+YGNST GAG+SYPGSPLA + +PNSP G GSP+R+ + NM F SG RNL
Sbjct  614  GGSNIHGFYGNSTFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNL  670



>ref|XP_002299859.2| pumilio/Puf RNA-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEE84664.2| pumilio/Puf RNA-binding domain-containing family protein [Populus 
trichocarpa]
Length=1065

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 132/186 (71%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +G GL    NL AA+ E  NL R  +   G+++Q
Sbjct  507  TGNLPPLFENVAAASAMAIPGMDSRVLGSGLGSGTNLTAASLESYNLGRGGSPIAGSALQ  566

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
             P +DP+YLQYLR+ D +A  L+A+N+P ++R  LGNSY+++LE+QKA+ GLL+SQKSQY
Sbjct  567  APFVDPMYLQYLRTPDYAATQLSAINDPSLDRNYLGNSYLNFLEIQKAY-GLLSSQKSQY  625

Query  365  GFPSFSKTG-GINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G P   K+G   +HGY+GN   G G+ YPGSPLA  ++PNSP GP SP+R+ E NM F S
Sbjct  626  GVPLGGKSGSSTHHGYFGNPAFGVGMPYPGSPLASPVIPNSPVGPASPLRHNELNMRFPS  685

Query  542  GMRNLG  559
            GMRNL 
Sbjct  686  GMRNLA  691



>ref|XP_006592187.1| PREDICTED: pumilio homolog 2-like isoform X3 [Glycine max]
Length=926

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (70%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L  NV A +A+ A G+DSR +G GL       +   ++ NL R+ N   G+++Q
Sbjct  497  TGNLPPLFQNVAAASAMAAPGMDSRILGCGLASGTAAPS---DVHNLGRMGNQIQGSALQ  553

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  554  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQKSQ  613

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   GAG+SYPGSP+A S++  SP G GSPVR+ E NMHF 
Sbjct  614  YNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHFA  673

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  674  SGMRNLA  680



>ref|XP_003539627.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
 ref|XP_006592186.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1053

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (70%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L  NV A +A+ A G+DSR +G GL       +   ++ NL R+ N   G+++Q
Sbjct  497  TGNLPPLFQNVAAASAMAAPGMDSRILGCGLASGTAAPS---DVHNLGRMGNQIQGSALQ  553

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  554  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQKSQ  613

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   GAG+SYPGSP+A S++  SP G GSPVR+ E NMHF 
Sbjct  614  YNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHFA  673

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  674  SGMRNLA  680



>ref|XP_010256854.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
 ref|XP_010256855.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
 ref|XP_010256857.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
 ref|XP_010256858.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
Length=1058

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 138/186 (74%), Gaps = 6/186 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ ASG+D+R++GGGL    NL  AA E+QNL+R+ N + G+++Q
Sbjct  504  TGNLPPLFENVAAASAMAASGLDARALGGGLPSGTNLTGAA-ELQNLNRMGNHTAGSTLQ  562

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PL+DPLYLQYLR+   +AA    LN+P ++R  +GNSY+D L LQKA+LG LL+ QKSQ
Sbjct  563  MPLVDPLYLQYLRTAGYAAA----LNDPSVDRNYMGNSYVDLLGLQKAYLGALLSPQKSQ  618

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P   K+GG+N GYYGN   G G+SYPGSPL   ++PNSP GPGSP+R+ ERN+ F  
Sbjct  619  YGVPFLGKSGGLNPGYYGNPGFGLGMSYPGSPLGSPLIPNSPVGPGSPIRHNERNLRFPP  678

Query  542  GMRNLG  559
            G+RNL 
Sbjct  679  GLRNLA  684



>ref|XP_006590976.1| PREDICTED: pumilio homolog 2-like isoform X3 [Glycine max]
Length=833

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ + G+D R          +  AA +++ NL R+ N   G+++Q
Sbjct  277  TGNLPPLFENVAAASAMASPGMDLR---ILGGGLASGAAAPSDVHNLGRMGNQIPGSALQ  333

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  334  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQKSQ  393

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPGSP+A S++  SP G  SPVR+ E NM F 
Sbjct  394  YNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGSPMANSVVSTSPVGSASPVRHNELNMRFA  453

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  454  SGMRNLA  460



>ref|XP_007009255.1| Pumilio 2 isoform 2 [Theobroma cacao]
 gb|EOY18065.1| Pumilio 2 isoform 2 [Theobroma cacao]
Length=703

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 17/185 (9%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G LP L +NV A +A+G +G++SR++ GGL + PNL+AAA E+QNL RL N + GN++Q
Sbjct  241  TGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGNALQ  300

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PL+DPLYLQYLRS +L+AA + ALN+ +++RE  GNSYMD L +QKA+LG LL+ QKS 
Sbjct  301  APLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQKS-  359

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
                           YYGN  L  G+SYPGSPLAG + P+S  G GSPVR+ ERNM F S
Sbjct  360  ---------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNMRFAS  404

Query  542  GMRNL  556
            G+RN+
Sbjct  405  GLRNV  409



>ref|XP_006590974.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
 ref|XP_006590975.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1047

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ + G+D R          +  AA +++ NL R+ N   G+++Q
Sbjct  491  TGNLPPLFENVAAASAMASPGMDLR---ILGGGLASGAAAPSDVHNLGRMGNQIPGSALQ  547

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  548  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQKSQ  607

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPGSP+A S++  SP G  SPVR+ E NM F 
Sbjct  608  YNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGSPMANSVVSTSPVGSASPVRHNELNMRFA  667

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  668  SGMRNLA  674



>ref|XP_010262560.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
Length=1050

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 139/185 (75%), Gaps = 3/185 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ ASG+D+R++GG  +      AA  E+QNL+R+ N + G+++Q
Sbjct  493  TGNLPPLFENVAAASAMAASGLDARALGGLPSGGNLTGAA--ELQNLNRIGNHTAGSALQ  550

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P++DPLYLQYL++ + +AA + ALN+P ++R  +GNSY+D L LQKA+LG LL+ QKSQ
Sbjct  551  MPVLDPLYLQYLKTAEYAAAQVAALNDPSLDRNYMGNSYVDLLGLQKAYLGALLSPQKSQ  610

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P   K+GG++ GYYGN   G G+SYPGSPLA  +LPNSP GPGSP+R+ ER++ F  
Sbjct  611  YGVPFLGKSGGLSPGYYGNPAFGLGMSYPGSPLASPLLPNSPVGPGSPIRHNERSLRFPP  670

Query  542  GMRNL  556
            GMRNL
Sbjct  671  GMRNL  675



>ref|XP_004294652.1| PREDICTED: pumilio homolog 2 [Fragaria vesca subsp. vesca]
Length=1077

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 137/188 (73%), Gaps = 6/188 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +GGGL   PNL AAA++  NL RL +   GN +Q
Sbjct  512  TGNLPPLFENVAAASAMIPPGMDSRVLGGGLASGPNLAAAASDSHNLGRLGSPIAGNGLQ  571

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  572  APYVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNILELQKAYLGALLSPQKSQ  631

Query  362  YGF--PSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMH  532
            YG   P   K+GG N HGYYGN     G+SYPGSP+A  ++PNSP GPGSP+R+ + NM 
Sbjct  632  YGVGAPLGGKSGGSNHHGYYGNHAF--GMSYPGSPMASPVIPNSPVGPGSPMRHNDLNMC  689

Query  533  FTSGMRNL  556
            + SGMRNL
Sbjct  690  YPSGMRNL  697



>ref|XP_008371890.1| PREDICTED: pumilio homolog 2-like [Malus domestica]
Length=1024

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 131/185 (71%), Gaps = 5/185 (3%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A +A+G  G+DS + GG    P  L AAA E+QN+ R+ N   G+++Q 
Sbjct  468  GSLPPLFENAAAASAMG--GLDSGAFGGMSLGPNLLAAAA-ELQNI-RVGNHGTGSALQV  523

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P+MDPLY+QYLRS + +AA L ALN+P  +RE +G+ +MD L LQKA+LG  L  QKSQ+
Sbjct  524  PMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGSMHMDLLGLQKAYLGQFLTPQKSQF  583

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+  +N+GYYGN   G G+SY G+PL G +LPNSP GPGSP R+GERN+ F+SG
Sbjct  584  GAPYVGKSASLNNGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFSSG  643

Query  545  MRNLG  559
            +RN+G
Sbjct  644  LRNMG  648



>ref|XP_007009256.1| Pumilio 2 isoform 3, partial [Theobroma cacao]
 gb|EOY18066.1| Pumilio 2 isoform 3, partial [Theobroma cacao]
Length=710

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 17/185 (9%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G LP L +NV A +A+G +G++SR++ GGL + PNL+AAA E+QNL RL N + GN++Q
Sbjct  472  TGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGNALQ  531

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PL+DPLYLQYLRS +L+AA + ALN+ +++RE  GNSYMD L +QKA+LG LL+ QKS 
Sbjct  532  APLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQKS-  590

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
                           YYGN  L  G+SYPGSPLAG + P+S  G GSPVR+ ERNM F S
Sbjct  591  ---------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNMRFAS  635

Query  542  GMRNL  556
            G+RN+
Sbjct  636  GLRNV  640



>ref|XP_006592185.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=902

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 128/187 (68%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ A  +DSR          +  AA +++ NL R+ N   G+++Q
Sbjct  477  TGNLPPLFENVAAASAMAAPRMDSR---ILGGGLASGAAAPSDVHNLGRMGNQIQGSALQ  533

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+ + +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  534  APFVDPMYLQYLRTPEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQKSQ  593

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   GAG+SYPGSP+A S++  SP G GSPVR+ E NMHF 
Sbjct  594  YNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHFA  653

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  654  SGMRNLA  660



>ref|XP_007009257.1| Pumilio 2 isoform 4, partial [Theobroma cacao]
 gb|EOY18067.1| Pumilio 2 isoform 4, partial [Theobroma cacao]
Length=698

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 17/185 (9%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G LP L +NV A +A+G +G++SR++ GGL + PNL+AAA E+QNL RL N + GN++Q
Sbjct  472  TGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGNALQ  531

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PL+DPLYLQYLRS +L+AA + ALN+ +++RE  GNSYMD L +QKA+LG LL+ QKS 
Sbjct  532  APLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQKS-  590

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
                           YYGN  L  G+SYPGSPLAG + P+S  G GSPVR+ ERNM F S
Sbjct  591  ---------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNMRFAS  635

Query  542  GMRNL  556
            G+RN+
Sbjct  636  GLRNV  640



>ref|XP_006475541.1| PREDICTED: pumilio homolog 1-like [Citrus sinensis]
Length=582

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  290  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  348

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  349  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  405

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  406  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  461

Query  542  GMRNL  556
            GMRNL
Sbjct  462  GMRNL  466



>ref|XP_003539618.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
Length=1033

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 128/187 (68%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ A  +DSR          +  AA +++ NL R+ N   G+++Q
Sbjct  477  TGNLPPLFENVAAASAMAAPRMDSR---ILGGGLASGAAAPSDVHNLGRMGNQIQGSALQ  533

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+ + +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  534  APFVDPMYLQYLRTPEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQKSQ  593

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   GAG+SYPGSP+A S++  SP G GSPVR+ E NMHF 
Sbjct  594  YNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHFA  653

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  654  SGMRNLA  660



>gb|KHN21931.1| Pumilio like 2 [Glycine soja]
Length=1174

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 126/187 (67%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ + G+ SR          +  AA +++ NL R+ N   G+++Q
Sbjct  616  TGNLPPLFENVAAASAMASPGMRSR---ILGGGLASGAAAPSDVHNLGRMGNQIPGSALQ  672

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  673  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQKSQ  732

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPGSP+A S++  SP G  SPVR+ E NM F 
Sbjct  733  YNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGSPMANSVVSTSPVGSASPVRHNELNMRFA  792

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  793  SGMRNLA  799



>ref|XP_006485456.1| PREDICTED: pumilio homolog 1-like [Citrus sinensis]
Length=671

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  290  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  348

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  349  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  405

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  406  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  461

Query  542  GMRNL  556
            GMRNL
Sbjct  462  GMRNL  466



>ref|XP_007009254.1| Pumilio 2 isoform 1 [Theobroma cacao]
 gb|EOY18064.1| Pumilio 2 isoform 1 [Theobroma cacao]
Length=1016

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 17/185 (9%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G LP L +NV A +A+G +G++SR++ GGL + PNL+AAA E+QNL RL N + GN++Q
Sbjct  472  TGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGNALQ  531

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PL+DPLYLQYLRS +L+AA + ALN+ +++RE  GNSYMD L +QKA+LG LL+ QKS 
Sbjct  532  APLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQKS-  590

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
                           YYGN  L  G+SYPGSPLAG + P+S  G GSPVR+ ERNM F S
Sbjct  591  ---------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNMRFAS  635

Query  542  GMRNL  556
            G+RN+
Sbjct  636  GLRNV  640



>gb|KEH39457.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=917

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 6/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G++P L +NV A +A+ + G+DSR +GGGL       +   ++  L R+ N   G ++Q
Sbjct  493  TGNMPPLFENVAAASAMVSPGMDSRILGGGLPSGVASPS---DVHVLSRMGNQIAGGALQ  549

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
            +P +DP+YLQY+R+ + +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  550  SPYVDPMYLQYMRTPEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSLLSPQKSQ  609

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+GG N HGYYGN T G G+SYPGSP+A S L  SP G GSP+R+ + NMHF 
Sbjct  610  YNVPLGGKSGGSNHHGYYGNPTYGVGLSYPGSPMANS-LSTSPVGSGSPIRHNDLNMHFA  668

Query  539  SGMRNLG  559
            SGMRN+ 
Sbjct  669  SGMRNVA  675



>ref|XP_003597396.1| Pumilio-like protein [Medicago truncatula]
 gb|ABD33134.1| Nucleic acid binding NABP [Medicago truncatula]
 gb|AES67647.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=1047

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 6/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G++P L +NV A +A+ + G+DSR +GGGL       +   ++  L R+ N   G ++Q
Sbjct  493  TGNMPPLFENVAAASAMVSPGMDSRILGGGLPSGVASPS---DVHVLSRMGNQIAGGALQ  549

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
            +P +DP+YLQY+R+ + +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  550  SPYVDPMYLQYMRTPEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSLLSPQKSQ  609

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+GG N HGYYGN T G G+SYPGSP+A S L  SP G GSP+R+ + NMHF 
Sbjct  610  YNVPLGGKSGGSNHHGYYGNPTYGVGLSYPGSPMANS-LSTSPVGSGSPIRHNDLNMHFA  668

Query  539  SGMRNLG  559
            SGMRN+ 
Sbjct  669  SGMRNVA  675



>ref|XP_006590979.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1031

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ + G+ SR          +  AA +++ N+ R+ N   G+++Q
Sbjct  475  TGNLPPLFENVAAASAMASPGMRSR---ILGGGLASGAAAPSDVHNIGRMGNQIPGSALQ  531

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  532  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQKSQ  591

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPG+P+A S++  SP G GSPVR+ E NM F 
Sbjct  592  YNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGTPIANSVVSTSPVGSGSPVRHNELNMRFA  651

Query  539  SGMRNLG  559
            SG+RNL 
Sbjct  652  SGLRNLA  658



>ref|XP_006469751.1| PREDICTED: pumilio homolog 2-like [Citrus sinensis]
Length=441

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 108/143 (76%), Gaps = 8/143 (6%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            E+Q+++RL N + G+++Q PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD 
Sbjct  46   ELQSMNRLGNHTAGSALQAPLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDL  102

Query  311  LELQKAHLG-LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP  487
            L LQKA+LG LL+ QKSQYG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP
Sbjct  103  LGLQKAYLGALLSPQKSQYGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSP  158

Query  488  FGPGSPVRYGERNMHFTSGMRNL  556
             G GSPVR+G+RNM F SGMRNL
Sbjct  159  VGSGSPVRHGDRNMRFPSGMRNL  181



>ref|XP_003537978.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
Length=1047

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ + G+ SR          +  AA +++ N+ R+ N   G+++Q
Sbjct  491  TGNLPPLFENVAAASAMASPGMRSR---ILGGGLASGAAAPSDVHNIGRMGNQIPGSALQ  547

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  548  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQKSQ  607

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPG+P+A S++  SP G GSPVR+ E NM F 
Sbjct  608  YNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGTPIANSVVSTSPVGSGSPVRHNELNMRFA  667

Query  539  SGMRNLG  559
            SG+RNL 
Sbjct  668  SGLRNLA  674



>ref|XP_006435647.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
 gb|ESR48887.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
Length=967

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>ref|XP_006435648.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
 gb|ESR48888.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
Length=904

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>gb|KDO69138.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
 gb|KDO69139.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=967

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>gb|KDO69140.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=904

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>ref|XP_008356857.1| PREDICTED: pumilio homolog 1-like [Malus domestica]
Length=1056

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 134/187 (72%), Gaps = 10/187 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +     +A+G+ G+DSR++GG ++  PNL AAA E  NL  L +   G+ +Q
Sbjct  509  TGNLPPLFE-----SAMGSPGMDSRALGGRMSSGPNLAAAANESHNLGGLGSPIAGSGLQ  563

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  564  APFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKSQ  623

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P   K+GG NH GYYGN   G G+SYPGSP    ++PNSP GPG+P+R+ E NM + 
Sbjct  624  YGVPMVGKSGGSNHQGYYGNPAFGLGMSYPGSP---PVIPNSPVGPGTPIRHNELNMCYP  680

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  681  SGMRNLA  687



>gb|KDO69136.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=1034

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>ref|XP_006486391.1| PREDICTED: pumilio homolog 1-like [Citrus sinensis]
Length=1034

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>ref|XP_006435646.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
 gb|ESR48886.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
Length=1034

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>gb|KDO69137.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=1049

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 9/185 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +N  A +A+  +G+D+R++      P  + AAA E+Q+++RL N + G+++Q
Sbjct  483  SGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAA-ELQSMNRLGNHTAGSALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA + +LN+P ++   +GNSYMD L LQKA+LG LL+ QKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            YG P  +K+G +N+  YGN   G G+SYPG PL    LPNSP G GSPVR+G+RNM F S
Sbjct  599  YGVPYLNKSGSLNNNLYGNPAFGLGMSYPGGPL----LPNSPVGSGSPVRHGDRNMRFPS  654

Query  542  GMRNL  556
            GMRNL
Sbjct  655  GMRNL  659



>emb|CDP00123.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 122/179 (68%), Gaps = 8/179 (4%)
 Frame = +2

Query  23   LSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDP  202
            L +N+ A  A+G   +DSR +  G  L         E+QNL R+ N +  +++Q PLMDP
Sbjct  445  LIENIAAARAMG---VDSRGVTLGPNLLAAAA----ELQNLGRVGNQNSASALQMPLMDP  497

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQYGFPSF  379
            LYLQYL+ST+ +AA+  ALN+P+++RES+GNS+M+ LE+QK++L  LL  QKS Y  P  
Sbjct  498  LYLQYLKSTEYAAAHAAALNDPMLDRESVGNSFMELLEMQKSYLETLLLHQKSHYSLPYL  557

Query  380  SKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
             K G  NHGYYGN   G G+SY G+ L G +LPNSP G GSPVR+GERNM F SGMRN 
Sbjct  558  GKAGNPNHGYYGNPGFGLGMSYAGNQLGGQLLPNSPIGSGSPVRHGERNMRFPSGMRNF  616



>gb|KHN32144.1| Pumilio like 2 [Glycine soja]
Length=1050

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 128/187 (68%), Gaps = 8/187 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L  NV A +A+ A G+DSR +G GL       +   E+ NL R+ N   G+++Q
Sbjct  497  TGNLPPLFQNVAAASAMAAPGMDSRILGCGLASGTAAPS---EVHNLGRMGNQIQGSALQ  553

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM++   QKA+LG +L+ QKSQ
Sbjct  554  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNF---QKAYLGSVLSPQKSQ  610

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   GAG+SYPGSP+A S++  SP G GSPVR+ E NMHF 
Sbjct  611  YNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHFA  670

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  671  SGMRNLA  677



>ref|XP_010106527.1| Pumilio-2-like protein [Morus notabilis]
 gb|EXC10703.1| Pumilio-2-like protein [Morus notabilis]
Length=1062

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 123/186 (66%), Gaps = 10/186 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G++    D V A + + +  +DSR +GGGL    +      E  NL R+ +   G  +Q
Sbjct  512  TGNVSPFFDGVAAASGVPSPAMDSRVLGGGLASGQS------ESHNLGRIGSQMAGGGLQ  565

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
             P MDP+YLQYLRS++ +AA L ALN+P  +R  LGNSYM+ LELQKA+L LL+ QKSQY
Sbjct  566  TPFMDPMYLQYLRSSEYAAAQLAALNDPSADRSYLGNSYMNLLELQKAYLALLSPQKSQY  625

Query  365  GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
                  K+GG N HGYYGN   G GISYPGSP+A  ++PNSP GPGSP+R+ E N+ F S
Sbjct  626  ---VGGKSGGSNHHGYYGNPAFGVGISYPGSPMASPVIPNSPVGPGSPLRHSELNLRFPS  682

Query  542  GMRNLG  559
            GMR+L 
Sbjct  683  GMRSLA  688



>ref|XP_010096599.1| Pumilio-2-like protein [Morus notabilis]
 gb|EXB65267.1| Pumilio-2-like protein [Morus notabilis]
Length=966

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 132/186 (71%), Gaps = 7/186 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L ++  A + +G  G+DS + GGGL L P++LA AAE+QN  R+ N S G    
Sbjct  451  SGNLPPLFESAAAASGMG--GLDSGAFGGGLALGPSMLAVAAELQNAGRVGNHSGGM---  505

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             PLMDPLYLQYLRS + +AA   ALN+  ++RE +GN+YMD   LQKA+LG LL+ QKSQ
Sbjct  506  -PLMDPLYLQYLRSNEYAAAQAAALNDATMDREGMGNTYMDIFGLQKAYLGALLSPQKSQ  564

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            +  P   K+  +NHGYYGN   G G+SYPGSPL G +LPNSP G GSPVR+ ERN+ ++S
Sbjct  565  FAVPYMGKSSSLNHGYYGNPAFGLGMSYPGSPLGGPLLPNSPVGSGSPVRHSERNLRYSS  624

Query  542  GMRNLG  559
            GMRN+ 
Sbjct  625  GMRNMA  630



>gb|KDO72813.1| hypothetical protein CISIN_1g039493mg [Citrus sinensis]
Length=749

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 131/186 (70%), Gaps = 5/186 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +GGG     NL A + E  NL+R  +   G ++Q
Sbjct  503  AGNLPPLYENVAAASAMAVPGMDSRVLGGGFASGQNLSATS-ESHNLNRAGSQMGGGALQ  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLRS++  AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  562  FPFVDPVYLQYLRSSEY-AAQLAALNDPSVDRNFLGNSYMNLLELQKAYLGVLLSPQKSQ  620

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  SK+ G NH GY G    G G+SYPGSPLA  ++PNSP GPGSP+R+ + N+ F 
Sbjct  621  YGGPLGSKSSGSNHHGYCGTPGFGLGMSYPGSPLANPVIPNSPVGPGSPIRHNDPNLRF-  679

Query  539  SGMRNL  556
            +GMRNL
Sbjct  680  AGMRNL  685



>ref|XP_008372362.1| PREDICTED: pumilio homolog 1-like [Malus domestica]
Length=550

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = +2

Query  200  PLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGFPS  376
            PLY+QYLRS + +AA L ALN+P  +RE +GN+YMD L LQKA+LG LL+ QKSQ+G P 
Sbjct  54   PLYVQYLRSNEYAAAQLAALNDPTKDREGMGNTYMDLLGLQKAYLGQLLSPQKSQFGAPY  113

Query  377  FSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
              K+G +NHGYYGN   G G+SY G+PL G +LPNSP GPGSP R+GERN+ F+SG+RN+
Sbjct  114  IGKSGSLNHGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFSSGLRNM  173

Query  557  G  559
            G
Sbjct  174  G  174



>gb|KHN32146.1| Pumilio like 2 [Glycine soja]
Length=1030

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 126/187 (67%), Gaps = 9/187 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ + G+ SR          +  AA +++ NL R+ N   G+++Q
Sbjct  477  TGNLPPLFENVAAASAMASPGMRSR---ILGGGLASGAAAPSDVHNLGRMGNQIQGSALQ  533

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+    QKA+LG +L+ QKSQ
Sbjct  534  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMN----QKAYLGSVLSPQKSQ  589

Query  362  YGFPSFSKTGGI-NHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN+  G G+SYPGSP+A S++  SP G GSPVR+ E NMHF 
Sbjct  590  YNVPLGGKSGSSPAHGYYGNAAYGGGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHFA  649

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  650  SGMRNLA  656



>ref|XP_008384935.1| PREDICTED: pumilio homolog 1-like [Malus domestica]
Length=1052

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 132/187 (71%), Gaps = 10/187 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +     +A+G+ G+DSR +GG +   PNL AAA E  NL  L +   G+ +Q
Sbjct  505  TGNLPPLFE-----SAMGSPGMDSRVLGGRMASGPNLAAAANESHNLAGLGSPIAGSGLQ  559

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ +ELQKA+LG LL+ QKSQ
Sbjct  560  APFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLIELQKAYLGALLSPQKSQ  619

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P   K+GG N HGYYGN   G G+SYPGSP    ++PNSP GPGSP+R+ E N+ + 
Sbjct  620  YGVPMGGKSGGSNHHGYYGNPAFGVGMSYPGSP---PVIPNSPVGPGSPMRHNELNICYP  676

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  677  SGMRNLA  683



>ref|XP_006424877.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
 gb|ESR38117.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
Length=1003

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 132/187 (71%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +GGG     NL AA+ E  NL+R  +   G ++Q
Sbjct  503  AGNLPPLYENVAAASAMAVPGMDSRVLGGGFASGQNLSAAS-ESHNLNRAGSQMGGGALQ  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLAS-QKSQ  361
             P +DP+YLQYLRS++  AA L ALN+P ++R  LGNSYM+ LELQKA+LG+L S QKSQ
Sbjct  562  FPFVDPVYLQYLRSSEY-AAQLAALNDPSVDRNFLGNSYMNLLELQKAYLGVLLSPQKSQ  620

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  SK+ G NH GY G    G G+SYPGSPLA  ++PNSP GPGSP+R+ + N+ F 
Sbjct  621  YGGPLGSKSSGSNHHGYCGTPGFGLGMSYPGSPLANPVIPNSPVGPGSPIRHNDPNLRF-  679

Query  539  SGMRNLG  559
            +GMRNL 
Sbjct  680  AGMRNLA  686



>ref|XP_003537979.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
 ref|XP_006590977.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1049

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ A G+DSR          +  AA +++ NL R+ N   G+++Q
Sbjct  493  TGNLPPLFENVAAASAMAAPGMDSR---ILGGGLASGAAAPSDVHNLGRMGNQIPGSALQ  549

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  550  APFVDPMYLQYLRTSEFAAAQLAALNDPAVDRNYLGNSYMNLLELQKAYLGSILSPQKSQ  609

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPG+ +A S++  SP G GSP+R+ E NM F 
Sbjct  610  YNVPLGGKSGSSTPHGYYGNPAYGVGLSYPGTAMANSVVSTSPVGSGSPIRHNELNMQFA  669

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  670  SGMRNLA  676



>ref|XP_006424876.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
 ref|XP_006488369.1| PREDICTED: pumilio homolog 2-like [Citrus sinensis]
 gb|ESR38116.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
Length=1058

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 132/187 (71%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+   G+DSR +GGG     NL AA+ E  NL+R  +   G ++Q
Sbjct  503  AGNLPPLYENVAAASAMAVPGMDSRVLGGGFASGQNLSAAS-ESHNLNRAGSQMGGGALQ  561

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLAS-QKSQ  361
             P +DP+YLQYLRS++  AA L ALN+P ++R  LGNSYM+ LELQKA+LG+L S QKSQ
Sbjct  562  FPFVDPVYLQYLRSSEY-AAQLAALNDPSVDRNFLGNSYMNLLELQKAYLGVLLSPQKSQ  620

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P  SK+ G NH GY G    G G+SYPGSPLA  ++PNSP GPGSP+R+ + N+ F 
Sbjct  621  YGGPLGSKSSGSNHHGYCGTPGFGLGMSYPGSPLANPVIPNSPVGPGSPIRHNDPNLRF-  679

Query  539  SGMRNLG  559
            +GMRNL 
Sbjct  680  AGMRNLA  686



>gb|KHN21930.1| Pumilio like 2 [Glycine soja]
Length=1040

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ A G+DSR          +  AA +++ NL R+ N   G+++Q
Sbjct  484  TGNLPPLFENVAAASAMAAPGMDSR---ILGGGLASGAAAPSDVHNLGRMGNQIPGSALQ  540

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  541  APFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQKSQ  600

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPG+ +A S++  SP G GSP+R+ E NM F 
Sbjct  601  YNVPLGGKSGSSTPHGYYGNPAYGVGLSYPGTAMANSVVSTSPVGSGSPIRHNELNMQFA  660

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  661  SGMRNLA  667



>ref|XP_009364362.1| PREDICTED: pumilio homolog 1-like [Pyrus x bretschneideri]
Length=1060

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 131/186 (70%), Gaps = 10/186 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +     +A+G+ G+DSR +GG ++  PNL A A E  NL  L +   G+ +Q
Sbjct  513  TGNLPPLFE-----SAMGSPGMDSRVLGGRMSSGPNLAAVANESLNLGGLGSPIAGSGLQ  567

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  568  APFVDPMYLQYLRTSEYAAAQLGALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKSQ  627

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P   K+GG NH GYYGN   G G+SYPGSP    ++PNSP GP +P+R+ E NM + 
Sbjct  628  YGVPMVGKSGGPNHQGYYGNPAFGLGMSYPGSP---PVIPNSPVGPATPMRHNELNMCYP  684

Query  539  SGMRNL  556
            SGMRNL
Sbjct  685  SGMRNL  690



>ref|XP_006846288.1| hypothetical protein AMTR_s00012p00251030 [Amborella trichopoda]
 gb|ERN07963.1| hypothetical protein AMTR_s00012p00251030 [Amborella trichopoda]
Length=1019

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 124/183 (68%), Gaps = 5/183 (3%)
 Frame = +2

Query  23   LSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDP  202
            L DN+    ++   G+DSRSMG GL     L     ++QNL+R+RN ++ N +Q P+MDP
Sbjct  469  LFDNISFSASLAGPGLDSRSMGAGLNSGTGLTGNN-DLQNLNRIRNQTV-NGLQVPVMDP  526

Query  203  LYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGFPS  376
            LY+QYL+ T   A+ + A L +P + R  +G+SY+D L LQKA+LG LLA QKSQY  P 
Sbjct  527  LYIQYLQRTAEYASQVAAGLTDPSLERNYMGSSYVDLLGLQKAYLGALLAQQKSQYNIPY  586

Query  377  FSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGS-PVRYGERNMHFTSGMRN  553
            F+K+GG+NHGYYGN   G G+ YPGSPL   +LPNSP GPGS P+R  +R++ F SG+R 
Sbjct  587  FNKSGGLNHGYYGNPAFGLGMPYPGSPLTSPVLPNSPVGPGSPPMRQNDRSLRFASGIRG  646

Query  554  LGA  562
             G 
Sbjct  647  SGV  649



>gb|KHN21928.1| Pumilio like 2 [Glycine soja]
Length=1014

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++ NL R+ N   G+++Q P +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ 
Sbjct  497  DVHNLGRMGNQIPGSALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNL  556

Query  311  LELQKAHLG-LLASQKSQYGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNS  484
            LELQKA+LG +L+ QKSQY  P   K+G    HGYYGN   G G+SYPG+P+A S++  S
Sbjct  557  LELQKAYLGSILSPQKSQYNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGTPIANSVVSTS  616

Query  485  PFGPGSPVRYGERNMHFTSGMRNLG  559
            P G GSPVR+ E NM F SG+RNL 
Sbjct  617  PVGSGSPVRHNELNMRFASGLRNLA  641



>ref|XP_009375924.1| PREDICTED: pumilio homolog 1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375925.1| PREDICTED: pumilio homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=1052

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 129/187 (69%), Gaps = 10/187 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +     +A+G+ G+DSR +GG +   PNL A + E  NL  L +   G+ +Q
Sbjct  505  TGNLPPLFE-----SAMGSPGMDSRVLGGRMASGPNLAATSNESHNLAGLGSPIAGSGLQ  559

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
               +DP+YLQYLR+++ +AA L ALN+P ++R  LGNSYM+ +ELQKA+LG LL+ QKSQ
Sbjct  560  ASFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLIELQKAYLGALLSPQKSQ  619

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            YG P   K+ G N HGYYGN   G G+SYPGSP    ++PNSP GPGSP+R+ E NM + 
Sbjct  620  YGVPMGGKSSGSNHHGYYGNPAFGVGMSYPGSP---PVIPNSPVGPGSPMRHNELNMCYP  676

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  677  SGMRNLA  683



>ref|XP_010690975.1| PREDICTED: pumilio homolog 1-like [Beta vulgaris subsp. vulgaris]
Length=1047

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 126/186 (68%), Gaps = 13/186 (7%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG LP L +N  A +AIG  G+DSR++GG  +   N++AAAAE+QNL R  + S      
Sbjct  496  SGALPPLFEN-AAASAIGVGGMDSRALGGSASSRANMMAAAAELQNLGRGGSQSQ-----  549

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
               +DPLY+ YL S D +AA L AL++P ++    GNSYMD L LQKA+LG LL+ QKS+
Sbjct  550  ---LDPLYMHYLSSNDYTAAQLAALSDPSVDG---GNSYMDLLTLQKAYLGSLLSPQKSE  603

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
             G P   K+ G+NHGYYGN   G G +Y G+ LA S+LPNSP GPGSP+R+GERNM   S
Sbjct  604  CGRPYLGKSTGLNHGYYGNPAFGIGTAYAGNHLASSLLPNSPVGPGSPLRHGERNMRLPS  663

Query  542  GMRNLG  559
            GMRNL 
Sbjct  664  GMRNLA  669



>ref|XP_010043502.1| PREDICTED: pumilio homolog 2-like [Eucalyptus grandis]
 gb|KCW85516.1| hypothetical protein EUGRSUZ_B02314 [Eucalyptus grandis]
Length=1038

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 131/186 (70%), Gaps = 7/186 (4%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+LP L +N  A +AIG  G +SR +GGGL    NL AAA+E  +L+R+ N   G +VQ 
Sbjct  487  GNLPPLYENAAAASAIGMPGTESRVLGGGLATGSNLTAAASEQNSLNRMANQMSGGAVQA  546

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P MDPLYLQY+RS++  A  L ALN+P+ +R  LG+SY++ LE+QKA+LG LL+ QKS Y
Sbjct  547  PFMDPLYLQYMRSSEY-ATQLAALNDPV-DRNYLGSSYLNLLEIQKAYLGALLSPQKSLY  604

Query  365  GFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G     K+GG NH GYYGN   G G+SYPGSPLA +++PNSP GPGSP+R  + +M   S
Sbjct  605  GVGG--KSGGSNHHGYYGNHAFGIGMSYPGSPLANAVIPNSPVGPGSPMRQND-SMRLPS  661

Query  542  GMRNLG  559
            GMRNL 
Sbjct  662  GMRNLA  667



>gb|KCW85517.1| hypothetical protein EUGRSUZ_B02314 [Eucalyptus grandis]
Length=1037

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 131/186 (70%), Gaps = 7/186 (4%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G+LP L +N  A +AIG  G +SR +GGGL    NL AAA+E  +L+R+ N   G +VQ 
Sbjct  487  GNLPPLYENAAAASAIGMPGTESRVLGGGLATGSNLTAAASEQNSLNRMANQMSGGAVQA  546

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQY  364
            P MDPLYLQY+RS++  A  L ALN+P+ +R  LG+SY++ LE+QKA+LG LL+ QKS Y
Sbjct  547  PFMDPLYLQYMRSSEY-ATQLAALNDPV-DRNYLGSSYLNLLEIQKAYLGALLSPQKSLY  604

Query  365  GFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G     K+GG NH GYYGN   G G+SYPGSPLA +++PNSP GPGSP+R  + +M   S
Sbjct  605  GVGG--KSGGSNHHGYYGNHAFGIGMSYPGSPLANAVIPNSPVGPGSPMRQND-SMRLPS  661

Query  542  GMRNLG  559
            GMRNL 
Sbjct  662  GMRNLA  667



>ref|XP_004160189.1| PREDICTED: LOW QUALITY PROTEIN: pumilio homolog 1-like [Cucumis 
sativus]
Length=1043

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +NV + +A+GASG++SR +GG L    NL ++A +   L +L     GN++Q
Sbjct  482  SGNLPTLFENVASASALGASGLESRVLGGSLASATNLTSSAPDSHILGKLGGQMSGNALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
               +DP+YLQYLR+++  AA L ALN+P ++R  LGNSYM+ LELQKA++G LL+  KSQ
Sbjct  542  ASFVDPIYLQYLRTSEY-AAQLGALNDPSLDRNYLGNSYMNQLELQKAYVGALLSPPKSQ  600

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G  NH GY+GN   G  +SYPGSP+A  +L NSP GPGSP+R+ + ++ + 
Sbjct  601  YNVPFSGKSGVSNHHGYFGNPAFGVHMSYPGSPMASPVLSNSPVGPGSPIRHNDLHLRYP  660

Query  539  SGMRNLG  559
            S  RNLG
Sbjct  661  SAARNLG  667



>ref|XP_004143128.1| PREDICTED: pumilio homolog 1-like [Cucumis sativus]
 gb|KGN47133.1| hypothetical protein Csa_6G190240 [Cucumis sativus]
Length=1043

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L +NV + +A+GASG++SR +GG L    NL ++A +   L +L     GN++Q
Sbjct  482  SGNLPTLFENVASASALGASGLESRVLGGSLASATNLTSSAPDSHILGKLGGQMSGNALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
               +DP+YLQYLR+++  AA L ALN+P ++R  LGNSYM+ LELQKA++G LL+  KSQ
Sbjct  542  ASFVDPIYLQYLRTSEY-AAQLGALNDPSLDRNYLGNSYMNQLELQKAYVGALLSPPKSQ  600

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G  NH GY+GN   G  +SYPGSP+A  +L NSP GPGSP+R+ + ++ + 
Sbjct  601  YNVPFSGKSGVSNHHGYFGNPAFGVHMSYPGSPMASPVLSNSPVGPGSPIRHNDLHLRYP  660

Query  539  SGMRNLG  559
            S  RNLG
Sbjct  661  SAARNLG  667



>ref|XP_007132044.1| hypothetical protein PHAVU_011G062200g [Phaseolus vulgaris]
 gb|ESW04038.1| hypothetical protein PHAVU_011G062200g [Phaseolus vulgaris]
Length=1050

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 127/187 (68%), Gaps = 6/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +AI A G+DSR +GGGL       +   ++ NL R+ N   G+++Q
Sbjct  496  TGNLPPLFENVAAASAIAAPGMDSRILGGGLASRAAAPS---DVHNLGRMGNQIPGSALQ  552

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQYLR+++  AA L AL++P ++R  LGNSYM  LELQKA+LG +L+ QKSQ
Sbjct  553  APFVDPMYLQYLRTSEY-AAQLGALSDPSVDRNYLGNSYMSLLELQKAYLGSMLSPQKSQ  611

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    H YYGN   G G+SYPGSP+A S++  +P G GSPVR+ E NM F 
Sbjct  612  YNVPLGGKSGSSTPHNYYGNPAYGVGLSYPGSPMANSVVSTTPVGSGSPVRHNELNMRFA  671

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  672  SGMRNLA  678



>ref|XP_007132045.1| hypothetical protein PHAVU_011G062300g [Phaseolus vulgaris]
 gb|ESW04039.1| hypothetical protein PHAVU_011G062300g [Phaseolus vulgaris]
Length=1047

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 124/187 (66%), Gaps = 6/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L + V A +AI A G+DSR +G GL       +   ++ NL R+ N   G+ +Q
Sbjct  493  TGNLPPLFETVAAASAIAAPGMDSRILGSGLASGAAAPS---DVHNLGRMGNQIPGSPLQ  549

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+Y QYLR+T+  AA L ALN+P ++R  LGNSYM  LELQKA+LG +L+ QKSQ
Sbjct  550  APFVDPMYHQYLRTTEY-AAQLGALNDPSVDRTYLGNSYMSLLELQKAYLGSILSPQKSQ  608

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G    HGYYGN   G G+SYPGSP+A S++  SP G GSPVR+ E NM F 
Sbjct  609  YNGPLGGKSGSSTPHGYYGNPAYGVGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMRFA  668

Query  539  SGMRNLG  559
            SGMRNL 
Sbjct  669  SGMRNLA  675



>gb|KHN33363.1| Pumilio like 2 [Glycine soja]
Length=882

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 128/186 (69%), Gaps = 7/186 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP L +NV A + + A G+DSR +GGGL+      +   ++    R+ N   G ++Q
Sbjct  331  TSNLPPLFENVAAASVMAAPGMDSRILGGGLSSGVAAPS---DVHGHGRMGNQIAGGALQ  387

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQY+RS++L+AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  388  APFVDPMYLQYIRSSELAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGTLLSPQKSQ  447

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            Y  P  +K+GG NHGYYGN     G+SYPGSP+A S L  SP G GSP+R+ + NM F S
Sbjct  448  YNVPLSAKSGGSNHGYYGNPAY--GLSYPGSPMANS-LSTSPVGSGSPIRHNDLNMRFAS  504

Query  542  GMRNLG  559
            GMRNL 
Sbjct  505  GMRNLA  510



>ref|XP_003547219.1| PREDICTED: pumilio homolog 2-like [Glycine max]
Length=1054

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 128/186 (69%), Gaps = 7/186 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP L +NV A + + A G+DSR +GGGL+      +   ++    R+ N   G ++Q
Sbjct  503  TSNLPPLFENVAAASVMAAPGMDSRILGGGLSSGVAAPS---DVHGHGRMGNQIAGGALQ  559

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQY+RS++L+AA L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKSQ
Sbjct  560  APFVDPMYLQYIRSSELAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGTLLSPQKSQ  619

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            Y  P  +K+GG NHGYYGN     G+SYPGSP+A S L  SP G GSP+R+ + NM F S
Sbjct  620  YNVPLSAKSGGSNHGYYGNPAY--GLSYPGSPMANS-LSTSPVGSGSPIRHNDLNMRFAS  676

Query  542  GMRNLG  559
            GMRNL 
Sbjct  677  GMRNLA  682



>gb|KEH30178.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=954

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP + +NV A + + + G+DSR          +   + +++ NL R+ N   G ++Q
Sbjct  401  TSNLPPMFENVAAASMMASPGMDSR---ILGGGLASGAGSPSDLHNLGRMGNQIAGGALQ  457

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQY+R+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  458  APFVDPMYLQYMRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQKSQ  517

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGE-RNMHF  535
            Y      K+G  N HGYYGN   G G+SYPGSP+A S    SP G GSP+R+ +  NM F
Sbjct  518  YNAQLGGKSGNSNHHGYYGNPAYGVGLSYPGSPMANS---GSPVGSGSPIRHNDLNNMRF  574

Query  536  TSGMRNLG  559
             SGMRNL 
Sbjct  575  ASGMRNLA  582



>ref|XP_008464104.1| PREDICTED: pumilio homolog 1-like [Cucumis melo]
Length=1042

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV + +A+GASG++SR +GG L    NL ++A +   L +L     GN++Q
Sbjct  482  TGNLPTLFENVASASALGASGLESRVLGGSLASATNLTSSAPDSHILGKLGGQMSGNALQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
               +DP+YLQYLR+    AA L ALN+P ++R  LGNSYM+ LELQKA++G LL+  KSQ
Sbjct  542  ASFVDPIYLQYLRTE--YAAQLGALNDPSLDRNYLGNSYMNQLELQKAYVGALLSPPKSQ  599

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G  NH GY+GN   G  +SYPGSP+A  +L NSP GPGSP+R+ + ++ + 
Sbjct  600  YNVPFSGKSGVSNHHGYFGNPAFGVHMSYPGSPMASPVLSNSPVGPGSPIRHNDLHLRYP  659

Query  539  SGMRNLG  559
            S  RNL 
Sbjct  660  SATRNLA  666



>ref|XP_011032451.1| PREDICTED: pumilio homolog 1-like isoform X2 [Populus euphratica]
Length=790

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 99/143 (69%), Gaps = 8/143 (6%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            E+QNL R  N + G     PL+DPLYLQYLRS + +AA L ALN+P+++RE  GN+Y D 
Sbjct  278  ELQNLSRFGNQTAGV----PLVDPLYLQYLRSDEYAAAQLAALNDPMLDREYAGNAY-DL  332

Query  311  LELQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP  487
            L  QK  L  LL+SQKSQYG P   K+G +NH YYGN+  G G+SY GSPL G +LPN  
Sbjct  333  L--QKLQLETLLSSQKSQYGVPYLGKSGSLNHNYYGNTGFGLGMSYSGSPLGGPVLPNLL  390

Query  488  FGPGSPVRYGERNMHFTSGMRNL  556
             G G PVR+ ERNM F+ GMRNL
Sbjct  391  TGSGGPVRHSERNMRFSPGMRNL  413



>ref|XP_003606712.1| Pumilio-like protein [Medicago truncatula]
 gb|AES88909.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=1025

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP + +NV A + + + G+DSR          +   + +++ NL R+ N   G ++Q
Sbjct  472  TSNLPPMFENVAAASMMASPGMDSR---ILGGGLASGAGSPSDLHNLGRMGNQIAGGALQ  528

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQY+R+++ +AA L ALN+P ++R  LGNSYM+ LELQKA+LG +L+ QKSQ
Sbjct  529  APFVDPMYLQYMRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQKSQ  588

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGE-RNMHF  535
            Y      K+G  N HGYYGN   G G+SYPGSP+A S    SP G GSP+R+ +  NM F
Sbjct  589  YNAQLGGKSGNSNHHGYYGNPAYGVGLSYPGSPMANS---GSPVGSGSPIRHNDLNNMRF  645

Query  536  TSGMRNLG  559
             SGMRNL 
Sbjct  646  ASGMRNLA  653



>gb|KDP44922.1| hypothetical protein JCGZ_01422 [Jatropha curcas]
Length=497

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLAS-QKSQYGF  370
            MDPLYLQYLRS + +AA L  LN+P ++RE LGNSYMD L  QKA+LG L S QKSQYG 
Sbjct  1    MDPLYLQYLRSNEYAAAQLATLNDPSMDREYLGNSYMDLL--QKAYLGALVSPQKSQYGV  58

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                K+G +NH YYG+ T G G+SYPGSP+   +L +SP G GSPVR+ +RN+ FT+G+ 
Sbjct  59   SYLGKSGSLNHNYYGSPTFGLGMSYPGSPIGAPLLASSPIGSGSPVRHNDRNIRFTAGIS  118

Query  551  NL  556
            NL
Sbjct  119  NL  120



>emb|CDP09091.1| unnamed protein product [Coffea canephora]
Length=1030

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 100/142 (70%), Gaps = 4/142 (3%)
 Frame = +2

Query  140  NLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLEL  319
            NL R+ N   GN +Q+P MDP YLQYLR+ +  A  + ALN+P ++R  +GNSYMD L  
Sbjct  520  NLSRMGNQMAGNGLQSPYMDPAYLQYLRTAEYVANQVAALNDPSLDRNYMGNSYMDLL--  577

Query  320  QKAHLG-LLASQKSQYGFPSFSK-TGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            QKA+LG +L+ QKS YG P+ +K TG  +HGYYGN   G G+SYPG+PLA  ++PNSP  
Sbjct  578  QKAYLGSVLSPQKSPYGVPAGTKNTGSNHHGYYGNPAFGVGLSYPGNPLASPVIPNSPGA  637

Query  494  PGSPVRYGERNMHFTSGMRNLG  559
            PGSP+R+ + NM F  GMRNL 
Sbjct  638  PGSPLRHNDFNMRFPGGMRNLA  659



>ref|XP_011032372.1| PREDICTED: pumilio homolog 1-like isoform X1 [Populus euphratica]
Length=993

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 99/143 (69%), Gaps = 8/143 (6%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            E+QNL R  N + G     PL+DPLYLQYLRS + +AA L ALN+P+++RE  GN+Y D 
Sbjct  481  ELQNLSRFGNQTAGV----PLVDPLYLQYLRSDEYAAAQLAALNDPMLDREYAGNAY-DL  535

Query  311  LELQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP  487
            L  QK  L  LL+SQKSQYG P   K+G +NH YYGN+  G G+SY GSPL G +LPN  
Sbjct  536  L--QKLQLETLLSSQKSQYGVPYLGKSGSLNHNYYGNTGFGLGMSYSGSPLGGPVLPNLL  593

Query  488  FGPGSPVRYGERNMHFTSGMRNL  556
             G G PVR+ ERNM F+ GMRNL
Sbjct  594  TGSGGPVRHSERNMRFSPGMRNL  616



>ref|XP_004241216.1| PREDICTED: pumilio homolog 2-like [Solanum lycopersicum]
Length=993

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 111/182 (61%), Gaps = 11/182 (6%)
 Frame = +2

Query  14   LPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPL  193
            LP L +   A + +   G+DSR +G                QNL R+ N   G+++Q   
Sbjct  450  LPPLFETAAAASGMALPGMDSRMLGASHLNSGVSE------QNLGRMGNHMSGSALQASF  503

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            MDP+YLQYL  T    A ++ALN+P ++R  +GNSYMD    QKA+LG   S KSQYG P
Sbjct  504  MDPMYLQYL--TAEYVAQVSALNDPSMDRNYMGNSYMDLF--QKAYLGNALSPKSQYGVP  559

Query  374  SFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
              SK  G NH GYYGN   G G+SYPGSPLA S++PNSP GPGSP+R+ + NM F+  MR
Sbjct  560  LSSKGSGSNHLGYYGNPAFGVGLSYPGSPLASSVVPNSPVGPGSPMRHSDYNMRFSGAMR  619

Query  551  NL  556
            N+
Sbjct  620  NI  621



>ref|XP_002316273.2| hypothetical protein POPTR_0010s20870g [Populus trichocarpa]
 gb|EEF02444.2| hypothetical protein POPTR_0010s20870g [Populus trichocarpa]
Length=973

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 117/184 (64%), Gaps = 12/184 (7%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A    G +G+DSR++G          A   E+QN  RL N + G     
Sbjct  424  GSLPPLFENAAAAAMAG-TGLDSRALGALGPNLMATAA---ELQNHSRLGNHTAGL----  475

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQY  364
            PL+DPLYLQYLRS + +AA L ALN+P+++RE +GN+Y D L  QK  L  L++SQKSQY
Sbjct  476  PLVDPLYLQYLRSNEYAAAQLAALNDPMLDREYVGNAY-DLL--QKLQLETLMSSQKSQY  532

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G +NH YYGN   G G+SY GSPL G +LPNS  G G P+R+ ERNM F+  
Sbjct  533  GVPYLGKSGSLNHNYYGNPGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNMLFSPA  592

Query  545  MRNL  556
            MRNL
Sbjct  593  MRNL  596



>ref|XP_004490876.1| PREDICTED: pumilio homolog 1-like isoform X2 [Cicer arietinum]
Length=1013

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 4/186 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L ++    +A+G + ID R +G G  L P L A+  E+QN  R  N + G++ Q
Sbjct  452  SGNLPLLFEHAAPSSALGMNVIDPRGLGRGANLAPLLAAS--ELQNASRFGNHAAGSTHQ  509

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQ  361
             PLMDP+YLQYLRS++L+AA + ALN    NRE   NS  D L LQKA++  L+A QK  
Sbjct  510  LPLMDPMYLQYLRSSELAAAQMAALNESARNREHTNNSLTDLLGLQKAYIESLIAPQKQH  569

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            +  P   K+  +NH  YG+ + G G+SYPGSPLAGS  PNS +G GSP+   ERNM   S
Sbjct  570  FSAPYIGKSASMNHNSYGSPSHGLGMSYPGSPLAGSAFPNSIYGQGSPMSQSERNMRL-S  628

Query  542  GMRNLG  559
            GMRN+ 
Sbjct  629  GMRNVA  634



>ref|XP_004490875.1| PREDICTED: pumilio homolog 1-like isoform X1 [Cicer arietinum]
Length=1014

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 4/186 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            SG+LP L ++    +A+G + ID R +G G  L P L A+  E+QN  R  N + G++ Q
Sbjct  453  SGNLPLLFEHAAPSSALGMNVIDPRGLGRGANLAPLLAAS--ELQNASRFGNHAAGSTHQ  510

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQ  361
             PLMDP+YLQYLRS++L+AA + ALN    NRE   NS  D L LQKA++  L+A QK  
Sbjct  511  LPLMDPMYLQYLRSSELAAAQMAALNESARNREHTNNSLTDLLGLQKAYIESLIAPQKQH  570

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            +  P   K+  +NH  YG+ + G G+SYPGSPLAGS  PNS +G GSP+   ERNM   S
Sbjct  571  FSAPYIGKSASMNHNSYGSPSHGLGMSYPGSPLAGSAFPNSIYGQGSPMSQSERNMRL-S  629

Query  542  GMRNLG  559
            GMRN+ 
Sbjct  630  GMRNVA  635



>ref|XP_011016453.1| PREDICTED: pumilio homolog 1-like isoform X1 [Populus euphratica]
Length=990

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 12/184 (7%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A    G +G+DSR++G          A   E+QN  RL N + G     
Sbjct  447  GSLPPLFENAAAAAMAG-TGLDSRALGALGPNLMATAA---ELQNHSRLGNHAAGV----  498

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQY  364
            P++DPLYLQYLRS + ++A L ALN+P+++RE +GN+Y D L  QK  L  L++SQKSQY
Sbjct  499  PVVDPLYLQYLRSNEYASAQLAALNDPMLDREYVGNAY-DLL--QKLQLETLMSSQKSQY  555

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G     K+G +NH YYGN+  G G+SY GSPL G +LPNS  G G P+R+ ERNM F+  
Sbjct  556  GVAYLGKSGSLNHNYYGNTGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNMRFSPA  615

Query  545  MRNL  556
            MRNL
Sbjct  616  MRNL  619



>ref|XP_011016454.1| PREDICTED: pumilio homolog 1-like isoform X2 [Populus euphratica]
Length=883

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 12/184 (7%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A    G +G+DSR++G          A   E+QN  RL N + G     
Sbjct  447  GSLPPLFENAAAAAMAG-TGLDSRALGALGPNLMATAA---ELQNHSRLGNHAAGV----  498

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQY  364
            P++DPLYLQYLRS + ++A L ALN+P+++RE +GN+Y D L  QK  L  L++SQKSQY
Sbjct  499  PVVDPLYLQYLRSNEYASAQLAALNDPMLDREYVGNAY-DLL--QKLQLETLMSSQKSQY  555

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G     K+G +NH YYGN+  G G+SY GSPL G +LPNS  G G P+R+ ERNM F+  
Sbjct  556  GVAYLGKSGSLNHNYYGNTGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNMRFSPA  615

Query  545  MRNL  556
            MRNL
Sbjct  616  MRNL  619



>ref|XP_004486985.1| PREDICTED: pumilio homolog 2-like [Cicer arietinum]
Length=1050

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 129/187 (69%), Gaps = 6/187 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ + G+DSR +GGGL       +   ++ +L R+ N     ++Q
Sbjct  496  TGNLPPLFENVAAASAMASPGMDSRILGGGLASGVASPS---DVHSLSRIGNPIASGALQ  552

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQY+R+ + + A L ALN+P ++R  LGNSYM+ LELQKA+LG LL+ QKS 
Sbjct  553  APFVDPMYLQYMRTPEYATAQLAALNDPSVDRNYLGNSYMNILELQKAYLGSLLSPQKSP  612

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+GG N HGYYGN+  G G+SYPGSP+A S+  +SP G GSP+R+ + NMHF 
Sbjct  613  YNVPMGGKSGGSNHHGYYGNAAYGVGLSYPGSPMANSLS-SSPVGSGSPIRHNDLNMHFA  671

Query  539  SGMRNLG  559
            SGMRN+ 
Sbjct  672  SGMRNVA  678



>ref|XP_008777342.1| PREDICTED: pumilio homolog 2-like isoform X2 [Phoenix dactylifera]
Length=989

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 123/184 (67%), Gaps = 7/184 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +N  A  ++   G DSR++GGG+  PP+L + A E+QNL ++ N +   S+Q
Sbjct  438  TGNLPSLFENAAAAASVSL-GTDSRALGGGIFAPPHLTSHA-ELQNLGQIGNQTAA-SLQ  494

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
            +PL DPLY+QYL++ + +A    + NNP +    +GNSYMD L LQKA++G L   + QY
Sbjct  495  SPLADPLYIQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGLQKAYVGALLQPQKQY  554

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G    G+YGN   G G++YPG+PLA  I   SP GPGSP+R+GERNM F SG
Sbjct  555  GMPLLGKSGA--QGFYGNPAFGLGMAYPGNPLASPIA--SPVGPGSPLRHGERNMQFPSG  610

Query  545  MRNL  556
            +RNL
Sbjct  611  LRNL  614



>ref|XP_008777335.1| PREDICTED: pumilio homolog 2-like isoform X1 [Phoenix dactylifera]
Length=1035

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 123/184 (67%), Gaps = 7/184 (4%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +N  A  ++   G DSR++GGG+  PP+L + A E+QNL ++ N +   S+Q
Sbjct  484  TGNLPSLFENAAAAASVSL-GTDSRALGGGIFAPPHLTSHA-ELQNLGQIGNQTAA-SLQ  540

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
            +PL DPLY+QYL++ + +A    + NNP +    +GNSYMD L LQKA++G L   + QY
Sbjct  541  SPLADPLYIQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGLQKAYVGALLQPQKQY  600

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G    G+YGN   G G++YPG+PLA  I   SP GPGSP+R+GERNM F SG
Sbjct  601  GMPLLGKSGA--QGFYGNPAFGLGMAYPGNPLASPIA--SPVGPGSPLRHGERNMQFPSG  656

Query  545  MRNL  556
            +RNL
Sbjct  657  LRNL  660



>ref|XP_011089489.1| PREDICTED: pumilio homolog 2-like [Sesamum indicum]
Length=1048

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 122/187 (65%), Gaps = 10/187 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            S +LP L +N  A +A+   G+DSR +GG      ++       QNL RL N   G+++Q
Sbjct  499  SPNLPPLFENAAAASAMAVPGMDSRLLGGSNLGAASVD------QNLGRLGNQIAGSALQ  552

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DPLYLQYLR+ + +AA + ALN+P ++R  +GNSYMD L  QKA+LG LL+  KSQ
Sbjct  553  APFVDPLYLQYLRTAEYAAAQVAALNDPSVDRNYMGNSYMDLL--QKAYLGNLLSPPKSQ  610

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   KT   + HGYY N T G G+SYPGSPLA  ++PNS  GPGSP+R+GE NM F 
Sbjct  611  YNVPLGGKTSASSPHGYYANPTFGIGLSYPGSPLASPVIPNSAGGPGSPMRHGEFNMRFP  670

Query  539  SGMRNLG  559
             G+RN+ 
Sbjct  671  GGLRNVA  677



>ref|XP_010906596.1| PREDICTED: pumilio homolog 2-like isoform X2 [Elaeis guineensis]
Length=985

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 122/184 (66%), Gaps = 6/184 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +N  A +A  + G DSR++GGG+  PP+L +   ++QNL R+ N +   ++Q
Sbjct  433  TGNLPSLFENAVATSAPVSLGTDSRALGGGIFAPPHLTSHT-DLQNLGRIGNQTAA-TLQ  490

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
            +P+ DPLY+QYL++ + +A    + NNP +    +GNSYMD L  QKA+ G L   + QY
Sbjct  491  SPIADPLYVQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGFQKAYAGALLQPQKQY  550

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G    G+YGN   G G+SYPG+PLA  I+  SP GPGSP+R+GER+M F SG
Sbjct  551  GMPLLDKSGA--QGFYGNPAFGLGMSYPGNPLASPII--SPVGPGSPLRHGERHMQFASG  606

Query  545  MRNL  556
            +RNL
Sbjct  607  LRNL  610



>ref|XP_010906595.1| PREDICTED: pumilio homolog 2-like isoform X1 [Elaeis guineensis]
Length=1031

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 122/184 (66%), Gaps = 6/184 (3%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +N  A +A  + G DSR++GGG+  PP+L +   ++QNL R+ N +   ++Q
Sbjct  479  TGNLPSLFENAVATSAPVSLGTDSRALGGGIFAPPHLTSHT-DLQNLGRIGNQTAA-TLQ  536

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
            +P+ DPLY+QYL++ + +A    + NNP +    +GNSYMD L  QKA+ G L   + QY
Sbjct  537  SPIADPLYVQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGFQKAYAGALLQPQKQY  596

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSG  544
            G P   K+G    G+YGN   G G+SYPG+PLA  I+  SP GPGSP+R+GER+M F SG
Sbjct  597  GMPLLDKSGA--QGFYGNPAFGLGMSYPGNPLASPII--SPVGPGSPLRHGERHMQFASG  652

Query  545  MRNL  556
            +RNL
Sbjct  653  LRNL  656



>ref|XP_008785558.1| PREDICTED: pumilio homolog 2-like [Phoenix dactylifera]
Length=1042

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 3/142 (2%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++QNL R+ N +   ++Q+PL DPLY+QYL++ + +A      +NP      +GNSYMD 
Sbjct  529  DLQNLGRIGNQT-ATALQSPLADPLYVQYLKAVEYTAQVAATHSNPAAETGFVGNSYMDL  587

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
            L LQKA+ G L   + QYG P   K+G +N  +YGN   G G+SYPGSPLA  I   SP 
Sbjct  588  LGLQKAYGGTLLQPQKQYGMPLLGKSGALNQSFYGNPAFGLGMSYPGSPLASPIA--SPV  645

Query  491  GPGSPVRYGERNMHFTSGMRNL  556
            GPGSP+R+GERNM F SG+RNL
Sbjct  646  GPGSPLRHGERNMRFPSGLRNL  667



>gb|EYU45944.1| hypothetical protein MIMGU_mgv1a000618mg [Erythranthe guttata]
Length=1042

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 117/187 (63%), Gaps = 20/187 (11%)
 Frame = +2

Query  14   LPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPL  193
            LP L +N  A +AIG   +D R +G       +        QN +RL N   G++   P 
Sbjct  496  LPPLFENAAAASAIG---MDPRMLGASNFSGAD--------QNHNRLGNQMSGHA---PY  541

Query  194  MDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYG  367
            +DPLYLQYLR+ + +AA   A L++P ++R  +GNSYMD L  QKA+LG LL+ QKSQYG
Sbjct  542  VDPLYLQYLRTAEYAAAAQVAALSDPSVDRNYMGNSYMDLL--QKAYLGNLLSPQKSQYG  599

Query  368  FPSFSKTGGIN--HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
             P   K GG    HGYY N   G G+SYPGSPLA  +LPNS  GPGSP+R+GE NM FT 
Sbjct  600  VPMAGKGGGATSPHGYYANHAFGIGLSYPGSPLANQVLPNSGGGPGSPMRHGEFNMRFTG  659

Query  542  GMRNLGA  562
            GMRN+ A
Sbjct  660  GMRNVAA  666



>ref|XP_004507166.1| PREDICTED: pumilio homolog 2-like isoform X1 [Cicer arietinum]
 ref|XP_004507167.1| PREDICTED: pumilio homolog 2-like isoform X2 [Cicer arietinum]
 ref|XP_004507168.1| PREDICTED: pumilio homolog 2-like isoform X3 [Cicer arietinum]
Length=1030

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 123/186 (66%), Gaps = 9/186 (5%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+LP L +NV A +A+ +  +DSR     L       A ++++ +L  + N   G ++Q
Sbjct  479  TGNLPPLFENVAAASALASPRMDSR----ILGGGLASGAGSSDMHSLGGMGNQIAGGALQ  534

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQ  361
             P +DP+YLQY+R+++ +AA L ALNNP +++  L NSYM+ LELQKA+LG +L+ QKSQ
Sbjct  535  APFVDPMYLQYVRTSEYAAAQLAALNNPSVDQNYLDNSYMNLLELQKAYLGSVLSPQKSQ  594

Query  362  YGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y  P   K+G  N HGYYGN   G G+SYPGSP+A S    SP G GSP+R+ + NM F 
Sbjct  595  YNVPMGGKSGNSNHHGYYGNPAYGVGLSYPGSPMANS---GSPVGSGSPIRHNDLNMRFA  651

Query  539  SGMRNL  556
            SGMRNL
Sbjct  652  SGMRNL  657



>ref|XP_010922284.1| PREDICTED: pumilio homolog 2-like [Elaeis guineensis]
Length=1010

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 95/142 (67%), Gaps = 3/142 (2%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++QNL R+ N +   ++Q+PL DPLY+QYL++ + +A    + +NP +     GNSYMD 
Sbjct  497  DLQNLGRIGNQTAA-ALQSPLADPLYVQYLKAVEYTAQVAASHSNPSVETGFAGNSYMDL  555

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
            L LQKA++G L   + QYG P   K+G +N  +YG+   G G+SYP SPLA  I   SP 
Sbjct  556  LGLQKAYVGTLLQPQKQYGVPLLGKSGALNQSFYGSPAFGLGMSYPVSPLASPIA--SPV  613

Query  491  GPGSPVRYGERNMHFTSGMRNL  556
            GPGSP+R+GERNM F SG+RNL
Sbjct  614  GPGSPLRHGERNMRFPSGLRNL  635



>ref|XP_006350783.1| PREDICTED: pumilio homolog 2-like isoform X1 [Solanum tuberosum]
Length=993

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 109/182 (60%), Gaps = 11/182 (6%)
 Frame = +2

Query  14   LPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPL  193
            LP L +   A + +   G+DSR +G                QNL R+ N   G+++Q   
Sbjct  450  LPPLFETAAAASGMALPGMDSRMLGASHLNSGVSE------QNLSRMGNQMSGSALQASF  503

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            MDP+YLQYL  T    A + ALN+P ++R  + NSYMD L  QKA+LG   S KSQYG P
Sbjct  504  MDPMYLQYL--TAEYVAQVAALNDPSMDRNYMANSYMDLL--QKAYLGNALSPKSQYGVP  559

Query  374  -SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
             S   +G  +HGYYGN   G G+SYPGSPLA  ++PNSP GPGSP+R+G+ NM F   MR
Sbjct  560  LSSKGSGSSHHGYYGNPAFGVGLSYPGSPLASPVVPNSPVGPGSPMRHGDYNMRFPGAMR  619

Query  551  NL  556
            N+
Sbjct  620  NV  621



>ref|XP_006350784.1| PREDICTED: pumilio homolog 2-like isoform X2 [Solanum tuberosum]
Length=942

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 109/182 (60%), Gaps = 11/182 (6%)
 Frame = +2

Query  14   LPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPL  193
            LP L +   A + +   G+DSR +G                QNL R+ N   G+++Q   
Sbjct  450  LPPLFETAAAASGMALPGMDSRMLGASHLNSGVSE------QNLSRMGNQMSGSALQASF  503

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            MDP+YLQYL  T    A + ALN+P ++R  + NSYMD L  QKA+LG   S KSQYG P
Sbjct  504  MDPMYLQYL--TAEYVAQVAALNDPSMDRNYMANSYMDLL--QKAYLGNALSPKSQYGVP  559

Query  374  -SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
             S   +G  +HGYYGN   G G+SYPGSPLA  ++PNSP GPGSP+R+G+ NM F   MR
Sbjct  560  LSSKGSGSSHHGYYGNPAFGVGLSYPGSPLASPVVPNSPVGPGSPMRHGDYNMRFPGAMR  619

Query  551  NL  556
            N+
Sbjct  620  NV  621



>ref|XP_007141399.1| hypothetical protein PHAVU_008G192100g [Phaseolus vulgaris]
 gb|ESW13393.1| hypothetical protein PHAVU_008G192100g [Phaseolus vulgaris]
Length=1028

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 11/186 (6%)
 Frame = +2

Query  5    SGHLPYLSDNVG-AGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSV  181
            SG+LP   +N   A +A+G + +DSR++G G+ L P L A   E+QN  RL + + G++ 
Sbjct  472  SGNLPPFFENAAVAASALGLNAMDSRALGRGVALGPLLAAT--ELQNSSRLGSHAAGSTQ  529

Query  182  QNPLMDPLYLQYLRSTDL-SAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQK  355
            Q PLMDPLYLQYLRS D+ SAA + AL   +INRE       D L LQKA++  L+A Q 
Sbjct  530  QLPLMDPLYLQYLRSGDVASAAQIAALKESVINREC-----TDLLGLQKAYVESLIAPQN  584

Query  356  SQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHF  535
            S +  P  SK+  ++   +GN + G   SYPGSPLAGS+ PNS +GPGSP+   ERNM  
Sbjct  585  SHFNVPYLSKSATLSPNSFGNPSYGLATSYPGSPLAGSLFPNSLYGPGSPMNQSERNMRL  644

Query  536  TSGMRN  553
             SGMRN
Sbjct  645  -SGMRN  649



>ref|XP_011076804.1| PREDICTED: pumilio homolog 2-like isoform X2 [Sesamum indicum]
Length=957

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 123/185 (66%), Gaps = 9/185 (5%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G++P L +NV AGTAIG SG+D R++ GGL L  NLLAAAAE++NL RL N S  +++  
Sbjct  409  GNIPPLFENVTAGTAIGISGVDPRALSGGLALGSNLLAAAAEMENLARLGNHSSRDAL--  466

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYG  367
             LMDP Y+QYLR+ + S A    L     +RESL NS+M+ L LQKA+   L  QKSQY 
Sbjct  467  -LMDPSYIQYLRANEYSTAAGADLRT---SRESLANSHMELLALQKAYFEAL-HQKSQYS  521

Query  368  FPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGP-GSPVRYGERNMHFTSG  544
              +F K+  +++G++GNS  G G  YP +P+ G I PNSP G  G P+++ E+ MHF + 
Sbjct  522  L-AFGKSSTLSNGFHGNSAFGVGFPYPVNPMGGPIYPNSPIGSGGGPIKHVEQMMHFPAS  580

Query  545  MRNLG  559
            +RN+ 
Sbjct  581  LRNVA  585



>ref|XP_011002642.1| PREDICTED: pumilio homolog 1-like [Populus euphratica]
Length=1000

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 119/189 (63%), Gaps = 17/189 (9%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G LP L +N  A    G +G+DSR++G          A   E+QN  RL N + G     
Sbjct  446  GSLPPLFENAAAAAMAG-TGLDSRALGALGPNLMATAA---ELQNHSRLGNHTAGV----  497

Query  188  PLMDPLYLQYLRSTD-----LSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLAS  349
            PL+DPLYLQYLRS +     LSAA L ALN+P+++RE +GN+Y D L  QK  L  L++S
Sbjct  498  PLVDPLYLQYLRSNEYASAQLSAAQLAALNDPMLDREYVGNAY-DLL--QKLQLETLMSS  554

Query  350  QKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNM  529
            QKSQYG P   K+G +NH YYGN+  G G+SY GSPL G +LPNS  G G P+R+ ERNM
Sbjct  555  QKSQYGVPYLGKSGSLNHNYYGNTGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNM  614

Query  530  HFTSGMRNL  556
             F+  MRNL
Sbjct  615  RFSPAMRNL  623



>ref|XP_011076803.1| PREDICTED: pumilio homolog 2-like isoform X1 [Sesamum indicum]
Length=965

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 123/185 (66%), Gaps = 9/185 (5%)
 Frame = +2

Query  8    GHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQN  187
            G++P L +NV AGTAIG SG+D R++ GGL L  NLLAAAAE++NL RL N S  +++  
Sbjct  417  GNIPPLFENVTAGTAIGISGVDPRALSGGLALGSNLLAAAAEMENLARLGNHSSRDAL--  474

Query  188  PLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYG  367
             LMDP Y+QYLR+ + S A    L     +RESL NS+M+ L LQKA+   L  QKSQY 
Sbjct  475  -LMDPSYIQYLRANEYSTAAGADLRT---SRESLANSHMELLALQKAYFEAL-HQKSQYS  529

Query  368  FPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGP-GSPVRYGERNMHFTSG  544
              +F K+  +++G++GNS  G G  YP +P+ G I PNSP G  G P+++ E+ MHF + 
Sbjct  530  L-AFGKSSTLSNGFHGNSAFGVGFPYPVNPMGGPIYPNSPIGSGGGPIKHVEQMMHFPAS  588

Query  545  MRNLG  559
            +RN+ 
Sbjct  589  LRNVA  593



>gb|AES99404.2| pumilio-family RNA-binding repeatprotein [Medicago truncatula]
Length=1012

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 113/186 (61%), Gaps = 16/186 (9%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            S +LP+  ++    + +G + +DSR +  G  L P L A+  E+QN  RL N + G++ Q
Sbjct  463  SANLPHFFEHAAPSSPLGMNAMDSRGLARGANLGPLLAAS--ELQNASRLGNHAAGSTHQ  520

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQ  361
             PL+DPLYLQYLRS +++AA                NS  D L LQKA++  L+A QK+Q
Sbjct  521  LPLIDPLYLQYLRSGEVAAAQRN-------------NSITDLLGLQKAYIESLIAQQKAQ  567

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            +  P   K+  +NH  YGN + G G+SYPGSPLAGS  P+S +GPGSP+   ERNM   +
Sbjct  568  FSVPYLGKSASMNHNSYGNPSYGHGMSYPGSPLAGSPFPSSMYGPGSPMSQSERNMRLAA  627

Query  542  GMRNLG  559
            GMRN+ 
Sbjct  628  GMRNVA  633



>ref|XP_003616446.1| Pumilio-like protein [Medicago truncatula]
Length=1066

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 113/186 (61%), Gaps = 16/186 (9%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            S +LP+  ++    + +G + +DSR +  G  L P L A+  E+QN  RL N + G++ Q
Sbjct  484  SANLPHFFEHAAPSSPLGMNAMDSRGLARGANLGPLLAAS--ELQNASRLGNHAAGSTHQ  541

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-GLLASQKSQ  361
             PL+DPLYLQYLRS +++AA                NS  D L LQKA++  L+A QK+Q
Sbjct  542  LPLIDPLYLQYLRSGEVAAAQRN-------------NSITDLLGLQKAYIESLIAQQKAQ  588

Query  362  YGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            +  P   K+  +NH  YGN + G G+SYPGSPLAGS  P+S +GPGSP+   ERNM   +
Sbjct  589  FSVPYLGKSASMNHNSYGNPSYGHGMSYPGSPLAGSPFPSSMYGPGSPMSQSERNMRLAA  648

Query  542  GMRNLG  559
            GMRN+ 
Sbjct  649  GMRNVA  654



>ref|XP_010920533.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
Length=1048

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 113/181 (62%), Gaps = 5/181 (3%)
 Frame = +2

Query  11   HLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNP  190
            ++P LS+N    + + + G+D R+   G     +  +  A++Q L+ + N +   ++Q P
Sbjct  503  NVPPLSENAPVASGMASPGMDFRA--TGGFSSGSNFSGVADLQTLNSIGNYTAAAALQMP  560

Query  191  LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            + +PLY+QYLR+ + +A      N+P + R  +GNSY D L +Q+A+LGLL  Q  QYG 
Sbjct  561  I-NPLYVQYLRAAEYAAQVAANFNDPSMERGYMGNSYADLLGIQRAYLGLLLQQDKQYGM  619

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
            P   K GG++HG+YGN   G G  YPGSPL+  +LP SP GPGS +R+ ERN+  +SG+R
Sbjct  620  PFIGKAGGLHHGFYGNPAFGLG--YPGSPLSSPVLPASPGGPGSSLRHSERNIRLSSGIR  677

Query  551  N  553
            N
Sbjct  678  N  678



>ref|XP_002311179.2| hypothetical protein POPTR_0008s05850g [Populus trichocarpa]
 gb|EEE88546.2| hypothetical protein POPTR_0008s05850g [Populus trichocarpa]
Length=999

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 98/148 (66%), Gaps = 13/148 (9%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTD-----LSAANLTALNNPIINRESLGN  295
            E+QNL R  N + G     PL+DPLYLQYLRS +     L+ A L ALN P+++RE +GN
Sbjct  482  ELQNLSRFGNQTAGV----PLVDPLYLQYLRSDEYAAAQLATAQLAALNEPMLDREYVGN  537

Query  296  SYMDYLELQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSI  472
            +Y D L  QK  L  LL+SQ SQYG P   K+G +NH YYGN+  G G+SY GSPL G +
Sbjct  538  AY-DLL--QKLQLETLLSSQNSQYGVPYLGKSGSLNHNYYGNTGFGLGMSYSGSPLGGPV  594

Query  473  LPNSPFGPGSPVRYGERNMHFTSGMRNL  556
            LPN   G G PVR+ ERNM F+ GMRNL
Sbjct  595  LPNLLAGSGGPVRHSERNMRFSPGMRNL  622



>ref|XP_004147681.1| PREDICTED: pumilio homolog 1-like [Cucumis sativus]
 ref|XP_004161912.1| PREDICTED: pumilio homolog 1-like [Cucumis sativus]
Length=1016

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 98/145 (68%), Gaps = 2/145 (1%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESL-GNSYMD  307
            E QN +RL N +  N +Q   +DP Y+QYL S + +AA +  +++P ++ +SL GN YMD
Sbjct  494  EFQNNNRLENHNAMNGMQLSGLDPSYIQYLGSNEYAAAQVGGISDPPLDSDSLMGNGYMD  553

Query  308  YLELQKAHLG-LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNS  484
             L +QKA+LG LL+ Q SQ+  P F K+G +NH YYGN   G G+SYPGSPLAGS+LP S
Sbjct  554  LLGVQKAYLGALLSPQNSQFVLPYFGKSGSLNHNYYGNPGYGLGMSYPGSPLAGSLLPGS  613

Query  485  PFGPGSPVRYGERNMHFTSGMRNLG  559
            P G G+ + +  + + F+SGMRN  
Sbjct  614  PAGSGNALNHISKALRFSSGMRNFA  638



>gb|KGN50567.1| hypothetical protein Csa_5G182720 [Cucumis sativus]
Length=1051

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 98/145 (68%), Gaps = 2/145 (1%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESL-GNSYMD  307
            E QN +RL N +  N +Q   +DP Y+QYL S + +AA +  +++P ++ +SL GN YMD
Sbjct  529  EFQNNNRLENHNAMNGMQLSGLDPSYIQYLGSNEYAAAQVGGISDPPLDSDSLMGNGYMD  588

Query  308  YLELQKAHLG-LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNS  484
             L +QKA+LG LL+ Q SQ+  P F K+G +NH YYGN   G G+SYPGSPLAGS+LP S
Sbjct  589  LLGVQKAYLGALLSPQNSQFVLPYFGKSGSLNHNYYGNPGYGLGMSYPGSPLAGSLLPGS  648

Query  485  PFGPGSPVRYGERNMHFTSGMRNLG  559
            P G G+ + +  + + F+SGMRN  
Sbjct  649  PAGSGNALNHISKALRFSSGMRNFA  673



>ref|XP_010557243.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=919

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 111/185 (60%), Gaps = 28/185 (15%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGN-SV  181
            SG+ P+L  NV A +A+G SG+DSR  GG             E  NL R+ N   G  ++
Sbjct  390  SGNFPHLYGNVAAASALGLSGVDSRLFGGQNLS---------ESHNLGRVSNQMTGGVAL  440

Query  182  QNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQ  361
            Q+PL +P+YLQYL+++D  AA L A N+  + R  LGNSYM+ LELQK          SQ
Sbjct  441  QSPLSNPMYLQYLKTSDY-AAQLAANNDLSMERGFLGNSYMNLLELQK----------SQ  489

Query  362  YGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Y      K+GG NH GYYG+ T G+ +SYPGSPLA  ++P+S  GP SP+R    NM + 
Sbjct  490  Y------KSGGSNHHGYYGSPTFGSSMSYPGSPLASHVIPDSLVGPASPMRRSGVNMRYP  543

Query  539  SGMRN  553
            SGMRN
Sbjct  544  SGMRN  548



>ref|XP_010321733.1| PREDICTED: LOW QUALITY PROTEIN: pumilio homolog 1-like [Solanum 
lycopersicum]
Length=987

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 90/142 (63%), Gaps = 8/142 (6%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q L R+ N   GN+V    MDP+YLQYL +    AA +  LN+P ++R  +GNSY+D   
Sbjct  482  QTLSRMGNQMGGNAVPASFMDPMYLQYLSAE--YAAQVAVLNDPSLDRNYMGNSYVDLF-  538

Query  317  LQKAHLGLLASQKSQYGFPSFSKTGGINH-GYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
             QKA+L  +  QKSQYG P  SKT G  H GYYGNS  G G+SYPGSPLA    P SP G
Sbjct  539  -QKAYLSSVLPQKSQYGVPLNSKTSGSGHPGYYGNSAFGVGLSYPGSPLAS---PVSPVG  594

Query  494  PGSPVRYGERNMHFTSGMRNLG  559
            PGSP+R+ + NM F   +RN+ 
Sbjct  595  PGSPMRHSDYNMRFPGRIRNIA  616



>ref|XP_008461691.1| PREDICTED: pumilio homolog 1-like [Cucumis melo]
Length=1047

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESL-GNSYMD  307
            E QN +RL N +  N +Q P +DP Y+QYL S + +AA +  +++P ++ +SL GN YMD
Sbjct  526  EFQN-NRLENHNAMNGMQLPGLDPSYIQYLGSNEYAAAQVGGISDPPLDSDSLMGNGYMD  584

Query  308  YLELQKAHLG-LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNS  484
             L +QKA+LG LL+ Q SQ+  P F K+G +NH Y GN + G G+SYPGSPLAGS+LP S
Sbjct  585  LLGVQKAYLGALLSPQNSQFVLPYFGKSGSLNHNYCGNPSYGLGMSYPGSPLAGSLLPGS  644

Query  485  PFGPGSPVRYGERNMHFTSGMRNLG  559
            P G G+ + +  + + F+SGMRN  
Sbjct  645  PAGSGNALNHISKALRFSSGMRNFA  669



>ref|XP_010685712.1| PREDICTED: pumilio homolog 2-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=1028

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 113/190 (59%), Gaps = 25/190 (13%)
 Frame = +2

Query  14   LPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLH------RLRNSSLGN  175
            LP L +NV A +A+G  G+DSR M GG+             QNL       RL N   GN
Sbjct  490  LPPLLENVAAASAMGVHGLDSRVMAGGMPSG----------QNLTASAESGRLGNPMSGN  539

Query  176  SVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQ  352
            ++Q  L D +YLQYLRS + +A          +N +S    YM+ L  QKA+LG +++ Q
Sbjct  540  ALQASLADAMYLQYLRSAEYAAQAAA------MNDQSPDKYYMELL--QKAYLGSVMSPQ  591

Query  353  KSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMH  532
            KSQ+G P  +K+GG NHGYYGN   G G+ YPGSPL   ++PNSP G GSP+R+ + +M 
Sbjct  592  KSQFGAPMGNKSGGSNHGYYGNHAYGVGMGYPGSPLTSPVIPNSPGGAGSPIRHNDYSMR  651

Query  533  FTSGMRNLGA  562
            + S MRNLG+
Sbjct  652  YPSAMRNLGS  661



>ref|XP_010685713.1| PREDICTED: pumilio homolog 2-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=1026

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 113/190 (59%), Gaps = 25/190 (13%)
 Frame = +2

Query  14   LPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLH------RLRNSSLGN  175
            LP L +NV A +A+G  G+DSR M GG+             QNL       RL N   GN
Sbjct  490  LPPLLENVAAASAMGVHGLDSRVMAGGMPSG----------QNLTASAESGRLGNPMSGN  539

Query  176  SVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQ  352
            ++Q  L D +YLQYLRS + +A          +N +S    YM+ L  QKA+LG +++ Q
Sbjct  540  ALQASLADAMYLQYLRSAEYAAQAAA------MNDQSPDKYYMELL--QKAYLGSVMSPQ  591

Query  353  KSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMH  532
            KSQ+G P  +K+GG NHGYYGN   G G+ YPGSPL   ++PNSP G GSP+R+ + +M 
Sbjct  592  KSQFGAPMGNKSGGSNHGYYGNHAYGVGMGYPGSPLTSPVIPNSPGGAGSPIRHNDYSMR  651

Query  533  FTSGMRNLGA  562
            + S MRNLG+
Sbjct  652  YPSAMRNLGS  661



>ref|XP_006827416.1| hypothetical protein AMTR_s00009p00067490 [Amborella trichopoda]
 gb|ERM94832.1| hypothetical protein AMTR_s00009p00067490 [Amborella trichopoda]
Length=1037

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMD  307
            ++Q+++R  N  +G  +Q PLMDPLYLQY++     A ++T  L +P   R  +GNSY+D
Sbjct  514  DVQSMNRAVNQ-VGAGLQMPLMDPLYLQYMQRAVEYAGHVTGNLGDPSAGRNYMGNSYVD  572

Query  308  YLELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP  487
             L LQKA+LGLLA QKSQY  P  SK+ G+NHGY+GN + G G+ Y   P+A S+L  S 
Sbjct  573  LLGLQKAYLGLLAQQKSQYAMPFLSKSDGLNHGYFGNGSCGVGMQYSEFPVANSLLSAS-  631

Query  488  FGPGSPVRYGERNMHFTSGMRNLGA  562
             G G+P+R GERN  F +   + GA
Sbjct  632  LGVGNPIRQGERNHRFPAMRSSAGA  656



>ref|XP_006358700.1| PREDICTED: pumilio homolog 2-like [Solanum tuberosum]
Length=972

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 91/142 (64%), Gaps = 8/142 (6%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q L R+ N   GN++    +DP+YLQYL +    AA + ALN+P ++R  +GNSY+D L 
Sbjct  467  QTLSRMGNQMGGNALPASYVDPMYLQYLSAE--YAAQVAALNDPSLDRNYMGNSYVDLL-  523

Query  317  LQKAHLGLLASQKSQYGFPSFSKTGGI-NHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
             QKA+L  +  QKSQYG P  SKT    +HGYYGN   G G+SYPGSPLA    P SP G
Sbjct  524  -QKAYLSNVLPQKSQYGVPLNSKTSSSGHHGYYGNPAFGVGLSYPGSPLAS---PVSPVG  579

Query  494  PGSPVRYGERNMHFTSGMRNLG  559
            PGSP+R+ + NM F   MRN+ 
Sbjct  580  PGSPMRHSDYNMRFPGRMRNIA  601



>ref|XP_009381078.1| PREDICTED: pumilio homolog 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1057

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 2/142 (1%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++Q L R+ N +   ++Q  L DPLY+QYL++ + +A       +P + R  +GNSY D 
Sbjct  548  DLQTLSRIGNQTAAAALQTSLNDPLYVQYLKAAEYTAQIAANCCDPSLERGYMGNSYADL  607

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
            L + KA++  L  Q++QY  P  SK+G +NH YYGN   G G  YPGSPLA SI   SP 
Sbjct  608  LGIPKAYVESLLQQENQYNMPFLSKSGRLNHSYYGNPAFGLGNLYPGSPLASSIA--SPV  665

Query  491  GPGSPVRYGERNMHFTSGMRNL  556
            G GSP+   ERNM F+S +RNL
Sbjct  666  GHGSPLNLSERNMRFSSNLRNL  687



>ref|XP_009381077.1| PREDICTED: pumilio homolog 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1070

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 2/142 (1%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++Q L R+ N +   ++Q  L DPLY+QYL++ + +A       +P + R  +GNSY D 
Sbjct  548  DLQTLSRIGNQTAAAALQTSLNDPLYVQYLKAAEYTAQIAANCCDPSLERGYMGNSYADL  607

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
            L + KA++  L  Q++QY  P  SK+G +NH YYGN   G G  YPGSPLA SI   SP 
Sbjct  608  LGIPKAYVESLLQQENQYNMPFLSKSGRLNHSYYGNPAFGLGNLYPGSPLASSIA--SPV  665

Query  491  GPGSPVRYGERNMHFTSGMRNL  556
            G GSP+   ERNM F+S +RNL
Sbjct  666  GHGSPLNLSERNMRFSSNLRNL  687



>gb|ABW81063.1| Mpt5-1 [Arabidopsis lyrata subsp. lyrata]
Length=969

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 104/178 (58%), Gaps = 18/178 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNPLMDP  202
            DNV A +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ + DP
Sbjct  430  DNVSAASALGFSGMDSR---LHGGGFVSSGQNLSESRNLGRFSNRMMGGGTGIQSHMADP  486

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY  S DL       LN+P ++   +G+SYM  LELQ+A LG   +QKSQYG P   
Sbjct  487  MYHQYADSLDL-------LNDPSMDMNFMGSSYMSMLELQRAFLG---AQKSQYGLPY--  534

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H YYG+ T G+ ISYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  535  KSGSPNSHSYYGSPTFGSNISYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSAARN  592



>ref|XP_002881034.1| mpt5-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57293.1| mpt5-1 [Arabidopsis lyrata subsp. lyrata]
Length=969

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 104/178 (58%), Gaps = 18/178 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNPLMDP  202
            DNV A +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ + DP
Sbjct  430  DNVSAASALGFSGMDSR---LHGGGFVSSGQNLSESRNLGRFSNRMMGGGTGLQSHMADP  486

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY  S DL       LN+P ++   +G+SYM  LELQ+A LG   +QKSQYG P   
Sbjct  487  MYHQYADSLDL-------LNDPSMDMNFMGSSYMSMLELQRAFLG---AQKSQYGLPY--  534

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H YYG+ T G+ ISYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  535  KSGSPNSHSYYGSPTFGSNISYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSAARN  592



>ref|XP_009402270.1| PREDICTED: pumilio homolog 3-like [Musa acuminata subsp. malaccensis]
Length=1038

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 87/142 (61%), Gaps = 2/142 (1%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++QN+ ++ N S   +V+  L DPLY+Q++R+ + +A       +  + R   GNS  D 
Sbjct  518  DLQNISQIGNQSAVAAVRAQLNDPLYVQHIRAAEYTAQVAATYGDSSMERGYTGNSCADL  577

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
              +QKAH+  L   + QYG P   K+G +N GYY N     G++YPGSPLAG I  +SP 
Sbjct  578  PGIQKAHIESLLQSQKQYGIPLLGKSGSLNQGYYANPAFALGLAYPGSPLAGQI--DSPV  635

Query  491  GPGSPVRYGERNMHFTSGMRNL  556
            GPGSP+R GER+M F  G+RNL
Sbjct  636  GPGSPLRLGERSMQFPYGLRNL  657



>gb|ABW81111.1| putative pumilio Mpt5 [Boechera divaricarpa]
Length=975

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 108/178 (61%), Gaps = 12/178 (7%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSV--QNPLMDP  202
            +NV A +A+G SG+DS+          +     +E +NL R  N  +G  V  Q+ + DP
Sbjct  430  ENVSAASALGFSGMDSK---LYGGGYVSSGQNLSESRNLGRFSNQMMGGGVGLQSHMADP  486

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY R ++ +A  L  LN+P ++R  +GNSYM  LELQ+A+LG   +QKSQYG P   
Sbjct  487  MYHQYARFSE-NADALDLLNDPSMDRNFMGNSYMSMLELQRAYLG---AQKSQYGVPY--  540

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T G+ +SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  541  KSGSPNSHSDYGSPTFGSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSTTRN  598



>ref|XP_006409965.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
 ref|XP_006409966.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
 gb|ESQ51418.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
 gb|ESQ51419.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
Length=969

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 108/185 (58%), Gaps = 18/185 (10%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+   + ++V A + +G SG+D R     L          +E +NL R+ N  +   +Q
Sbjct  430  AGNFSPMYEDVSAASTLGFSGMDPR-----LHGRGFNGQNLSESRNLGRINNRMMSAGLQ  484

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
            + + DP+Y QY  S DL       LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQY
Sbjct  485  SHIADPMYHQYADSLDL-------LNDPAMDRSFMGNSYMNMLELQRAYLG---AQKSQY  534

Query  365  GFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTS  541
            G P   K+G  N H YYG+ T G+ +SYPGSPLA  ++ NS   P SP+R GE NM + S
Sbjct  535  GVPY--KSGSPNSHSYYGSPTFGSNMSYPGSPLAHHVMHNSLVAPCSPMRRGEVNMRYPS  592

Query  542  GMRNL  556
              RN 
Sbjct  593  ATRNF  597



>ref|XP_010937586.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
Length=1063

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 104/174 (60%), Gaps = 4/174 (2%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            + +LP L D+    + +   G+DS S  GG     +  + AA++QNL+R+ N +   ++Q
Sbjct  509  ASNLPPLFDSAAVASGMATPGMDS-SAAGGGFSSESNFSGAADLQNLNRIGNHTAAAALQ  567

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
             P+ +PLY QY ++ + +A      N+P + R  LGNSY D L +QKA+LG L     QY
Sbjct  568  MPI-NPLYFQYSKAAEYAAQVPANFNDPSMERGYLGNSYSDLLGVQKAYLGALLQPWQQY  626

Query  365  GFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERN  526
            G PS  K+GG+NHG+YGN   G G  YPGS LA  +   SP GPGSP+RY E +
Sbjct  627  GMPSVGKSGGLNHGFYGNPAFGLG--YPGSSLASPVFCASPVGPGSPLRYSESD  678



>gb|ABW81068.1| Mpt5-3 [Arabidopsis lyrata subsp. lyrata]
Length=968

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 111/182 (61%), Gaps = 12/182 (7%)
 Frame = +2

Query  17   PYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNP  190
            P + +N  A +A+G SG+DSR          +     +E +N+ R+ N  +G    +Q+ 
Sbjct  414  PPMYENASAASAMGFSGMDSR---LHGGGFVSSGQNLSESRNIGRVGNRMMGGGTGLQSH  470

Query  191  LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            L DP+Y QY R ++ +A +   LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG 
Sbjct  471  LADPMYHQYARFSE-NADSFDLLNDPSMDRSYMGNSYMNMLELQRAYLG---AQKSQYGL  526

Query  371  PSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGM  547
            P   K+G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  
Sbjct  527  PY--KSGSPNSHSYYGSPTFGSNMSYPGSPLAHPGMPNSLMSPYSPMRRGEVNMRYPSAT  584

Query  548  RN  553
            RN
Sbjct  585  RN  586



>ref|XP_002879203.1| mpt5-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55462.1| mpt5-3 [Arabidopsis lyrata subsp. lyrata]
Length=973

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 12/182 (7%)
 Frame = +2

Query  17   PYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNP  190
            P + +N  A +A+G SG+DSR          +     +E +N+ R+ N  +G    +Q+ 
Sbjct  424  PPMYENASAASAMGFSGMDSR---LHGGGFVSSGQNLSESRNIGRVGNRMMGGGTGLQSH  480

Query  191  LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            + DP+Y QY R ++ +A +   LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG 
Sbjct  481  MADPMYHQYARFSE-NADSFDLLNDPSMDRSYMGNSYMNMLELQRAYLG---AQKSQYGL  536

Query  371  PSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGM  547
            P   K+G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  
Sbjct  537  PY--KSGSPNSHSYYGSPTFGSNMSYPGSPLAHPGMPNSLMSPYSPMRRGEVNMRYPSAT  594

Query  548  RN  553
            RN
Sbjct  595  RN  596



>gb|ABW81112.1| putative pumilio Mpt5-2 [Boechera divaricarpa]
Length=967

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 107/178 (60%), Gaps = 20/178 (11%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSV--QNPLMDP  202
            DN  A +A+  SG+DSR           L     E +NL R+ N  +G +   Q+ + DP
Sbjct  430  DNYSAASALEISGMDSR-----------LHGGGFESRNLGRVNNRMMGGAAGHQSHMADP  478

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y +Y R ++ +  +L  LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG P   
Sbjct  479  MYHKYGRFSE-NVDSLDLLNDPAMDRNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--  532

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  RN
Sbjct  533  KSGSPNSHSYYGSPTFGSNMSYPGSPLAHHAMPNSLMSPCSPMRRGEVNMRYPSATRN  590



>gb|ABW81162.1| PMpt5-1 [Capsella rubella]
Length=961

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 109/178 (61%), Gaps = 17/178 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +NV A +A+G SG+DSR            +   +E +NL R  N  +G    +Q+ ++DP
Sbjct  434  ENVSAASALGFSGMDSR--------LHGGVQNLSEPRNLGRFSNRMMGGGAGLQSHMVDP  485

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY R ++ +  +L  LN+P ++R  + NSYM+ LELQ+A+LG   +QKSQYG P   
Sbjct  486  MYNQYGRFSE-NVDSLDLLNDPAMDRNFMNNSYMNMLELQRAYLG---AQKSQYGVPY--  539

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T G+ +SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  540  KSGSPNSHSDYGSPTFGSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRN  597



>ref|XP_010253957.1| PREDICTED: pumilio homolog 4-like [Nelumbo nucifera]
Length=1033

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 85/138 (62%), Gaps = 5/138 (4%)
 Frame = +2

Query  143  LHRLRNSSLGNSVQNPLMDPLYLQYL-RSTDLSAANLTALNNPIINRESLGNSYMDYLEL  319
            L+R RN  LG+  Q P MDPLYLQYL R+TDL+A   +ALN+  + R  LG S  D L  
Sbjct  525  LNRSRNQ-LGSGNQLPAMDPLYLQYLQRTTDLAAQTASALNDASLGRNFLGTSQADLLGF  583

Query  320  QKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGP  496
            QKA+L  L+A QK QYG P   K+ G+NHGYYGN   G G+ YPG+PL G  L  S  G 
Sbjct  584  QKAYLEALIAQQKQQYGIPFLGKSDGLNHGYYGNPGFGLGLPYPGNPLVGVGL--SSLGA  641

Query  497  GSPVRYGERNMHFTSGMR  550
            GSP+R  ER     S  R
Sbjct  642  GSPIRQNERMSRLPSMTR  659



>ref|XP_009802143.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana sylvestris]
Length=971

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 88/135 (65%), Gaps = 13/135 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG  337
            S +GN +  P  MDP+YLQYL     +A  + ALN+P ++R  +GNSY+D L  QKA+LG
Sbjct  478  SRMGNQMGGPSFMDPMYLQYL-----TAEYVAALNDPSLDRNYMGNSYIDLL--QKAYLG  530

Query  338  LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYG  517
             +  QKSQYG  S   +G  +HGYYGN   G G+SYPGSPLA  ++P SP GPGSP+R+ 
Sbjct  531  NVVPQKSQYGVKS---SGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMRHS  587

Query  518  ERNMHFTSGMRNLGA  562
            + N      MRN+ A
Sbjct  588  DYNN--MRRMRNIAA  600



>ref|XP_009802144.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana sylvestris]
Length=947

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 88/135 (65%), Gaps = 13/135 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG  337
            S +GN +  P  MDP+YLQYL     +A  + ALN+P ++R  +GNSY+D L  QKA+LG
Sbjct  454  SRMGNQMGGPSFMDPMYLQYL-----TAEYVAALNDPSLDRNYMGNSYIDLL--QKAYLG  506

Query  338  LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYG  517
             +  QKSQYG  S   +G  +HGYYGN   G G+SYPGSPLA  ++P SP GPGSP+R+ 
Sbjct  507  NVVPQKSQYGVKS---SGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMRHS  563

Query  518  ERNMHFTSGMRNLGA  562
            + N      MRN+ A
Sbjct  564  DYNN--MRRMRNIAA  576



>ref|XP_004970555.1| PREDICTED: pumilio homolog 2-like [Setaria italica]
Length=1056

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 2/127 (2%)
 Frame = +2

Query  179  VQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKS  358
            +Q+PL DP Y+QYL++T  +     +  +P + R  +GNSY +   +QKA++  L  Q+ 
Sbjct  563  LQSPLSDPFYVQYLKATQYATQGAGSYGDPSLERGYMGNSYGNLTAVQKAYIEALLQQQK  622

Query  359  QYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            QY  P   K+   NHGYYGN   G G++YPGSPL   +   SP GPGSP+R GERN+ F 
Sbjct  623  QYEMPLLGKSNASNHGYYGNLPFGMGMAYPGSPLGSPVA--SPSGPGSPLRLGERNLRFP  680

Query  539  SGMRNLG  559
            S +RNLG
Sbjct  681  SNLRNLG  687



>gb|ABW74568.1| Mpt5 [Boechera divaricarpa]
Length=970

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 108/178 (61%), Gaps = 12/178 (7%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +N  A +A+G SG+DSR          +     +E +N+ R+ N  +G    +Q+ L DP
Sbjct  425  ENASAASALGFSGMDSR---LHEGGFVSSGQNLSESRNIGRVGNRMMGGGAGLQSHLADP  481

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y Q+ R ++ +A +   LN+P ++R  +GNSYM+ LELQ+A+LG   +QKS YG P   
Sbjct  482  MYPQFARFSE-NADSFDLLNDPSVDRSFMGNSYMNMLELQRAYLG---AQKSHYGLPY--  535

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H YYG+ T G+ ISYPGSPLA   +PNS   P SP+R GE NM + S  RN
Sbjct  536  KSGSPNSHSYYGSPTFGSNISYPGSPLAHHGMPNSLMSPYSPMRRGEVNMRYPSATRN  593



>ref|XP_006409963.1| hypothetical protein EUTSA_v10016185mg [Eutrema salsugineum]
 gb|ESQ51416.1| hypothetical protein EUTSA_v10016185mg [Eutrema salsugineum]
Length=971

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 98/168 (58%), Gaps = 14/168 (8%)
 Frame = +2

Query  50   AIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRST  229
            A+G SGIDSR          +     +E +NL RL N  +G  +Q  ++DP+Y QY  S 
Sbjct  441  ALGFSGIDSR---LHGGGFVSSGQNLSESRNLGRLSNRMMGGGLQPHIVDPMYHQYADSL  497

Query  230  DLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFSKTGGINHGY  409
            DL       LN+P ++R  +GNSYM+ LELQ+A+ G   S KSQYG P +      +H Y
Sbjct  498  DL-------LNDPAMDRSFMGNSYMNMLELQRAYQG---SPKSQYGVP-YKSGSPTSHSY  546

Query  410  YGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            YG+ T G+ +SYPGSPLA  +L NS   P SP+R GE NM + S  RN
Sbjct  547  YGSPTFGSNMSYPGSPLAHHVLQNSLLSPCSPLRRGEVNMRYPSAARN  594



>ref|XP_006409962.1| hypothetical protein EUTSA_v10016184mg [Eutrema salsugineum]
 gb|ESQ51415.1| hypothetical protein EUTSA_v10016184mg [Eutrema salsugineum]
Length=976

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 107/186 (58%), Gaps = 15/186 (8%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+   + ++V A +A+G SG+D R          +     +E +NL R+ N  +G  +Q
Sbjct  426  TGNFSPMYEDVSAASALGFSGMDHR---LHGRGYVSSGQNLSESRNLGRISNRMMGGGLQ  482

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQY  364
            + + DP Y QY R  +    N    N+P I+R  +GNSYM+ LELQ+A+LG   +QKSQY
Sbjct  483  SHIADPTYHQYGRFPE----NADLFNDPAIDRSFMGNSYMNMLELQRAYLG---AQKSQY  535

Query  365  GFPSFSKTGGIN-HGYYGNSTL--GAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHF  535
            G P   K+G  N   YYG+ TL  G  +SYPGSPLA  ++PN    P SPVR GE NM +
Sbjct  536  GVPY--KSGSPNSRSYYGSPTLQYGCNMSYPGSPLAHHVMPNPLVAPCSPVRRGEVNMRY  593

Query  536  TSGMRN  553
             S  RN
Sbjct  594  PSATRN  599



>ref|XP_010418800.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=1253

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 105/178 (59%), Gaps = 18/178 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +NV A +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ + DP
Sbjct  404  ENVSAASAMGFSGMDSR---LHGGGYVSSGQNLSESRNLGRFSNRMMGGGAGLQSHMADP  460

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY  S DL       LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG P   
Sbjct  461  MYHQYADSLDL-------LNDPSMDRNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--  508

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T  + +SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  509  KSGSPNSHSDYGSPTFASNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRN  566


 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 104/178 (58%), Gaps = 18/178 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +NV A +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ + DP
Sbjct  816  ENVSAASAMGFSGMDSR---LHGGGYVSSGQNLSESRNLGRFSNRMMGGGAGLQSHMADP  872

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY  S DL       LN+P ++R  +GNSYM  LELQ+A+LG   +QKSQYG P   
Sbjct  873  MYHQYADSLDL-------LNDPSMDRNFMGNSYMGMLELQRAYLG---AQKSQYGVPY--  920

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T  + +SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  921  KSGSPNSHSDYGSPTFASNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRN  978



>ref|XP_006293694.1| hypothetical protein CARUB_v10022652mg [Capsella rubella]
 gb|EOA26592.1| hypothetical protein CARUB_v10022652mg [Capsella rubella]
Length=811

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 105/177 (59%), Gaps = 20/177 (11%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLY  208
            DN  A +A+G SG+DSR           L     E +NL R      G  +Q+ + DP+Y
Sbjct  276  DNYSAASALGFSGMDSR-----------LHGGGFESRNLGRSNRMMGGGGLQSHMADPMY  324

Query  209  LQYLR-STDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFSK  385
             QY R S ++ A +L  LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG P   K
Sbjct  325  HQYGRYSENVDALDL--LNDPAMDRSFMGNSYMNMLELQRAYLG---AQKSQYGVPY--K  377

Query  386  TGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            +G  N H YYG+ T G+ +SYPGSPLA   + NS   P SP+R GE NM + S  RN
Sbjct  378  SGSPNSHSYYGSPTFGSNMSYPGSPLAHHAMQNSLMSPCSPMRRGEVNMRYPSATRN  434



>ref|XP_010469982.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=975

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 20/172 (12%)
 Frame = +2

Query  47   TAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNPLMDPLYLQYL  220
            +A+G SG+DSR           L     E +NL R+ N  +G    +Q+ + DP+Y QY 
Sbjct  444  SALGFSGMDSR-----------LHGGGFESRNLGRVSNRMMGGGTGLQSHMADPMYHQYG  492

Query  221  RSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFSKTGGIN  400
            R ++ +  +L  LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG P   K+G  N
Sbjct  493  RYSE-NVDSLDLLNDPAMDRNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--KSGSPN  546

Query  401  -HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
             H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  RN
Sbjct  547  SHSYYGSPTFGSNMSYPGSPLAHHAMPNSLLSPCSPMRRGEVNMRYPSATRN  598



>ref|XP_010510528.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010510530.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010510531.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010510532.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=984

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 109/179 (61%), Gaps = 12/179 (7%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +N  A +A G SG+DSR          +     +E +N+ R+ N  +G +  +Q+ + DP
Sbjct  439  ENASAASAFGFSGMDSR---LHGGGFVSSGQNLSEPRNIGRVGNRMMGGNAGLQSHMADP  495

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY R +D +A +   LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG P   
Sbjct  496  MYHQYGRFSD-NADSFDLLNDPSMDRSFMGNSYMNMLELQRAYLG---AQKSQYGVPY--  549

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
            K+G  N H Y+G+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  RN 
Sbjct  550  KSGSPNSHSYFGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVNMRYPSATRNF  608



>ref|XP_006644998.1| PREDICTED: pumilio homolog 2-like [Oryza brachyantha]
Length=1058

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 86/143 (60%), Gaps = 4/143 (3%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++QNL R  N +    + +PL DP Y+QYL++T  +A      ++P + R  +G+ Y D 
Sbjct  551  DVQNLGRTGNQT-ATGLLSPLSDPFYVQYLKATQYAAQGAANCSDPSLERGFMGSQYGDL  609

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
              +QKA++  L  Q+ QYG P   K+   N GYYGN   G G+SYPGSPL   +   SP 
Sbjct  610  TAVQKAYIEALLQQQKQYGMP-LGKSTTSNQGYYGNLAFGMGMSYPGSPLGSPVA--SPS  666

Query  491  GPGSPVRYGERNMHFTSGMRNLG  559
            GPGSP+R  ERNM F S +RNLG
Sbjct  667  GPGSPLRLSERNMRFPSNLRNLG  689



>dbj|BAB89558.1| putative pumilio domain-containing protein PPD1 [Oryza sativa 
Japonica Group]
 gb|EAZ14131.1| hypothetical protein OsJ_04054 [Oryza sativa Japonica Group]
Length=1048

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 4/143 (3%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++ NL R  N +    + +PL DP Y+QYL++T  +A      ++P + R  +G+ Y D 
Sbjct  541  DVHNLGRTGNQT-ATGLLSPLSDPFYVQYLKATQYAAQGTANCSDPSLERGFMGSQYGDL  599

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
              +QKA++  L  Q+ QYG P   K+   NHGYYGN   G G++YPGSPL   +   SP 
Sbjct  600  TAVQKAYIEALLQQQKQYGMP-LGKSTTSNHGYYGNLAFGMGMAYPGSPLGSPVA--SPS  656

Query  491  GPGSPVRYGERNMHFTSGMRNLG  559
            GPGSP+R  ERNM F S +RNLG
Sbjct  657  GPGSPLRLSERNMRFPSNLRNLG  679



>ref|NP_001044782.1| Os01g0844800 [Oryza sativa Japonica Group]
 dbj|BAF06696.1| Os01g0844800 [Oryza sativa Japonica Group]
 dbj|BAG94300.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1060

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 4/143 (3%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++ NL R  N +    + +PL DP Y+QYL++T  +A      ++P + R  +G+ Y D 
Sbjct  553  DVHNLGRTGNQT-ATGLLSPLSDPFYVQYLKATQYAAQGTANCSDPSLERGFMGSQYGDL  611

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
              +QKA++  L  Q+ QYG P   K+   NHGYYGN   G G++YPGSPL   +   SP 
Sbjct  612  TAVQKAYIEALLQQQKQYGMP-LGKSTTSNHGYYGNLAFGMGMAYPGSPLGSPVA--SPS  668

Query  491  GPGSPVRYGERNMHFTSGMRNLG  559
            GPGSP+R  ERNM F S +RNLG
Sbjct  669  GPGSPLRLSERNMRFPSNLRNLG  691



>gb|EAY76473.1| hypothetical protein OsI_04410 [Oryza sativa Indica Group]
Length=1046

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 4/143 (3%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++ NL R  N +    + +PL DP Y+QYL++T  +A      ++P + R  +G+ Y D 
Sbjct  539  DVHNLGRTGNQT-ATGLLSPLSDPFYVQYLKATQYAAQGTANCSDPSLERGFMGSQYGDL  597

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
              +QKA++  L  Q+ QYG P   K+   NHGYYGN   G G++YPGSPL   +   SP 
Sbjct  598  TAVQKAYIEALLQQQKQYGMP-LGKSTTSNHGYYGNLAFGMGMAYPGSPLGSPVA--SPS  654

Query  491  GPGSPVRYGERNMHFTSGMRNLG  559
            GPGSP+R  ERNM F S +RNLG
Sbjct  655  GPGSPLRLSERNMRFPSNLRNLG  677



>gb|ABW81161.1| unknown [Capsella rubella]
Length=991

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 105/177 (59%), Gaps = 20/177 (11%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLY  208
            DN  A +A+G SG+DSR           L     E +NL R      G  +Q+ + DP+Y
Sbjct  425  DNYSAASALGFSGMDSR-----------LHGGGFESRNLGRSNRMMGGGGLQSHMADPMY  473

Query  209  LQYLR-STDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFSK  385
             QY R S ++ A +L  LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG P   K
Sbjct  474  HQYGRYSENVDALDL--LNDPAMDRSFMGNSYMNMLELQRAYLG---AQKSQYGVPY--K  526

Query  386  TGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            +G  N H YYG+ T G+ +SYPGSPLA   + NS   P SP+R GE NM + S  RN
Sbjct  527  SGSPNSHSYYGSPTFGSNMSYPGSPLAHHAMQNSLMSPCSPMRRGEVNMRYPSATRN  583



>ref|XP_006293626.1| hypothetical protein CARUB_v10022579mg [Capsella rubella]
 gb|EOA26524.1| hypothetical protein CARUB_v10022579mg [Capsella rubella]
Length=968

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 104/176 (59%), Gaps = 18/176 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQNPLMDPLY  208
            DN  A +A+G SG+ SR           L     E +NL R      G  +Q+ + DP+Y
Sbjct  433  DNYSAASALGYSGMGSR-----------LHGGGFESRNLGRSNRMMGGGGLQSHMADPMY  481

Query  209  LQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFSKT  388
             QY R ++ +  +L  LN+P ++R  +GNSYM+ LELQ+A+LG   +QKSQYG P   K+
Sbjct  482  HQYGRYSE-NVDSLDLLNDPAMDRSFMGNSYMNMLELQRAYLG---AQKSQYGVPY--KS  535

Query  389  GGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  RN
Sbjct  536  GSPNSHSYYGSPTFGSNMSYPGSPLAHHAMPNSLMSPCSPMRRGEVNMRYPSATRN  591



>ref|XP_010414430.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414431.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414432.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414433.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=984

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 109/179 (61%), Gaps = 12/179 (7%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRL--RNSSLGNSVQNPLMDP  202
            +N  A +A+G SG+DSR          +     +E +N+ R+  R +  G  +Q+ + DP
Sbjct  439  ENASAASALGFSGMDSR---LHGGGYVSSGQNLSEPRNIGRVGNRMTGGGAGLQSHMADP  495

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY R +D +A +   LN+P ++R  +GNSY++ LELQ+A+LG   +QKSQYG P   
Sbjct  496  MYHQYGRFSD-NADSFDLLNDPAMDRNFMGNSYVNMLELQRAYLG---AQKSQYGVPY--  549

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRNL  556
            K+G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  RN 
Sbjct  550  KSGSPNSHSYYGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVNMRYPSATRNF  608



>ref|XP_010473984.1| PREDICTED: pumilio homolog 2-like, partial [Camelina sativa]
Length=898

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +N  A +A+G SG+DSR          +     +E +N+ R+ N  +G +  +Q+ + DP
Sbjct  351  ENASAASALGFSGMDSR---LHGGGFVSSGQNLSEPRNIGRVGNRMMGGNAGLQSHMADP  407

Query  203  LYLQYLRSTDLSAANLTALNNPIINRE--SLGNSYMDYLELQKAHLGLLASQKSQYGFPS  376
            +Y QY R +D +A +   LN+P ++R    +GNSYM+ LELQ+A+LG   +QKSQYGFP 
Sbjct  408  MYHQYGRFSD-NADSFDLLNDPSMDRSFMGMGNSYMNMLELQRAYLG---AQKSQYGFPY  463

Query  377  FSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
              K+G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM   S  RN
Sbjct  464  --KSGSPNSHSYYGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVNMRHPSATRN  521

Query  554  L  556
             
Sbjct  522  F  522



>ref|XP_010414415.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414416.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414417.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414418.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=992

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 104/172 (60%), Gaps = 20/172 (12%)
 Frame = +2

Query  47   TAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNPLMDPLYLQYL  220
            +A+G SG+DSR           L     E +NL R+ N  +G    +Q+ + DP+Y QY 
Sbjct  461  SALGFSGMDSR-----------LNGGGFESRNLGRVSNRMMGGGTGLQSHMADPMYHQYG  509

Query  221  RSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFSKTGGIN  400
            R ++ +  +L  LN+P + R  +GNSYM+ LELQ+A+LG   +QKSQYG P   K+G  N
Sbjct  510  RFSE-NVDSLDLLNDPAMGRNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--KSGSPN  563

Query  401  -HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
             H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE NM + S  RN
Sbjct  564  SHSYYGSPTFGSNMSYPGSPLAHHAMPNSLLSPCSPMRRGEINMRYPSATRN  615



>ref|XP_002456623.1| hypothetical protein SORBIDRAFT_03g039600 [Sorghum bicolor]
 gb|EES01743.1| hypothetical protein SORBIDRAFT_03g039600 [Sorghum bicolor]
Length=1057

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 80/127 (63%), Gaps = 2/127 (2%)
 Frame = +2

Query  179  VQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKS  358
            +Q+PL DP Y+QYL++T  +A    +  +P + R  +GNSY +   +QKA++  L  Q+ 
Sbjct  564  LQSPLSDPFYVQYLKATQYAAQGAGSYGDPSLERGYMGNSYANLNAVQKAYIEALLQQQK  623

Query  359  QYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFT  538
            Q+  P   K+   NHGYYGN   G G++YPGSPL   +   S  GPGSP+R GERN+ F 
Sbjct  624  QFEMPLLGKSTTSNHGYYGNLAFGMGMAYPGSPLNSPVASQS--GPGSPLRLGERNLRFP  681

Query  539  SGMRNLG  559
            S +RNLG
Sbjct  682  SNLRNLG  688



>ref|XP_002863049.1| hypothetical protein ARALYDRAFT_920647 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39308.1| hypothetical protein ARALYDRAFT_920647 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 86/129 (67%), Gaps = 7/129 (5%)
 Frame = +2

Query  170  GNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLAS  349
            G  +Q+ L DP+Y QY R ++ +A +   LN+P ++R  +GNSYM+ LELQ+A+LG   +
Sbjct  4    GTGLQSHLADPMYHQYARFSE-NADSFDLLNDPSMDRSYMGNSYMNMLELQRAYLG---A  59

Query  350  QKSQYGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERN  526
            QKSQYG P   K+G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R GE N
Sbjct  60   QKSQYGLPY--KSGSPNSHSYYGSPTFGSNMSYPGSPLAHPGMPNSLMSPYSPMRRGEVN  117

Query  527  MHFTSGMRN  553
            M + S  RN
Sbjct  118  MRYPSATRN  126



>ref|XP_010241847.1| PREDICTED: pumilio homolog 4-like [Nelumbo nucifera]
 ref|XP_010241848.1| PREDICTED: pumilio homolog 4-like [Nelumbo nucifera]
Length=1032

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = +2

Query  155  RNSSLGNSVQNPLMDPLYLQYL-RSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAH  331
            R + LG+ +Q P+MDPLYLQYL R++D +    + L +  + R  LG S  D    QKA+
Sbjct  524  RGNQLGSGIQLPVMDPLYLQYLQRTSDYAEQGASGLTDASLGRNYLGTSEADLFGFQKAY  583

Query  332  LG-LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPV  508
            L  LLA QK QYG     K  G+NHGYYGN   G G+ YPG+PLA   LP+   GPGSP+
Sbjct  584  LEVLLAQQKQQYGLAFLGKPSGLNHGYYGNPAFGLGLPYPGNPLANPGLPS--IGPGSPI  641

Query  509  RYGERNMHFTSGMRN  553
            R  ER   F S +R+
Sbjct  642  RQSERISRFPSMIRS  656



>ref|XP_009597138.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana tomentosiformis]
Length=947

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 85/135 (63%), Gaps = 13/135 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG  337
            S +GN +  P  MDP+YLQYL     +A  + ALN+P ++R  +GNSY+D L  QKA+LG
Sbjct  454  SRMGNQMGGPSFMDPMYLQYL-----TAEYVAALNDPSVDRNYMGNSYIDLL--QKAYLG  506

Query  338  LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYG  517
                QKSQYG  S   +G  +HGYYGN   G G+SYPGSPLA  ++  S  GPGSP+R+ 
Sbjct  507  NAVPQKSQYGVKS---SGSGHHGYYGNPAFGVGLSYPGSPLASPVITGSSVGPGSPMRHS  563

Query  518  ERNMHFTSGMRNLGA  562
            + N      MRN+ A
Sbjct  564  DYNN--MRRMRNIAA  576



>ref|XP_009597137.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana tomentosiformis]
Length=971

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 85/135 (63%), Gaps = 13/135 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG  337
            S +GN +  P  MDP+YLQYL     +A  + ALN+P ++R  +GNSY+D L  QKA+LG
Sbjct  478  SRMGNQMGGPSFMDPMYLQYL-----TAEYVAALNDPSVDRNYMGNSYIDLL--QKAYLG  530

Query  338  LLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYG  517
                QKSQYG  S   +G  +HGYYGN   G G+SYPGSPLA  ++  S  GPGSP+R+ 
Sbjct  531  NAVPQKSQYGVKS---SGSGHHGYYGNPAFGVGLSYPGSPLASPVITGSSVGPGSPMRHS  587

Query  518  ERNMHFTSGMRNLGA  562
            + N      MRN+ A
Sbjct  588  DYNN--MRRMRNIAA  600



>ref|NP_180483.1| pumilio 1 [Arabidopsis thaliana]
 sp|Q9ZW07.1|PUM1_ARATH RecName: Full=Pumilio homolog 1; Short=APUM-1; Short=AtPUM1 [Arabidopsis 
thaliana]
 gb|AAC95215.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
 gb|AEC08222.1| pumilio 1 [Arabidopsis thaliana]
Length=968

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 105/179 (59%), Gaps = 22/179 (12%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            DNV   +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ ++DP
Sbjct  431  DNV---SALGFSGMDSR---HHGRGFVSSGQNLSESRNLGRFSNRMMGGGAGLQSHMVDP  484

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLG-NSYMDYLELQKAHLGLLASQKSQYGFPSF  379
            +Y QY  S DL       LN+P ++R  +G +SYMD LELQ+A+LG   +QKSQYG P  
Sbjct  485  MYNQYADSLDL-------LNDPSMDRNFMGGSSYMDMLELQRAYLG---AQKSQYGVPY-  533

Query  380  SKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
             K+G  N H YYG+ T G+ +SYPGSPLA   +PNS   P SP+R  E NM F S  RN
Sbjct  534  -KSGSPNSHSYYGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRDEVNMRFPSATRN  591



>ref|XP_010535459.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535460.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535461.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=980

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 26/190 (14%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+ P   +N  A +A+G  G DSR +GGG             + + H  R +   +++Q
Sbjct  443  TGNFPPHLENGNAASALGLQGFDSRVLGGG-------------LSSGHTDRTAMGSSALQ  489

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGN-SYMDYL-ELQKAHLG-LLASQK  355
            +P +DPLY+QYLR+++  AA L ALN+P+++   LGN SYM+ L E+Q+A++  LL++QK
Sbjct  490  HPFVDPLYVQYLRTSEY-AAQLAALNDPMMDHNLLGNNSYMNNLAEMQRAYIDQLLSAQK  548

Query  356  SQYGFPSFSKTGG--INHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNM  529
             QY      K GG     GYYG       +SYPGSPLA   LPNSP G GSP+R+ + NM
Sbjct  549  QQYVASVGGKYGGGSNQRGYYG-------MSYPGSPLANPGLPNSPVGSGSPMRHNDLNM  601

Query  530  HFTSGMRNLG  559
             + S MRNL 
Sbjct  602  SYPSRMRNLA  611



>gb|EMT17283.1| Pumilio-like protein [Aegilops tauschii]
Length=946

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 85/143 (59%), Gaps = 6/143 (4%)
 Frame = +2

Query  134  IQNLHRL--RNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMD  307
            + +LH L   N+     +Q+PL DP Y+QYL++   +A      ++P + R  +G+SY D
Sbjct  472  LSDLHNLGRSNNQTATGLQSPLSDPFYVQYLKTAQYTAQEAANYSDPYLERGFVGSSYAD  531

Query  308  YLELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP  487
               +QKA++  L  QK QYG P   K+   NHGYY N   G G++YPGSPL   +   SP
Sbjct  532  LTPVQKAYVEALLQQK-QYGMP-LGKSVASNHGYYSNLGYGMGLAYPGSPLGSPVA--SP  587

Query  488  FGPGSPVRYGERNMHFTSGMRNL  556
             GPGSP+R GERN+ F S  R+L
Sbjct  588  SGPGSPIRLGERNLRFPSNTRSL  610



>ref|XP_010469980.1| PREDICTED: pumilio homolog 2 [Camelina sativa]
 ref|XP_010469981.1| PREDICTED: pumilio homolog 2 [Camelina sativa]
Length=984

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 102/178 (57%), Gaps = 18/178 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +NV A +A+G SG+DSR          +     +E +N  R  N  +G    +Q+ + DP
Sbjct  445  ENVSAASAMGFSGMDSR---LHGGGYVSSGQNLSESRNFGRFSNRMMGGGAGLQSHMADP  501

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY       A +L  LN+P ++R  +GNSYM  LELQ+A+LG   +Q SQYG P   
Sbjct  502  MYHQY-------ADSLDHLNDPSMDRIFMGNSYMGMLELQRAYLG---AQNSQYGVPY--  549

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T  + +SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  550  KSGSPNSHSDYGSPTFTSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRN  607



>emb|CDM84977.1| unnamed protein product [Triticum aestivum]
Length=1047

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 85/143 (59%), Gaps = 6/143 (4%)
 Frame = +2

Query  134  IQNLHRL--RNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMD  307
            + +LH L   N+     +Q+PL DP Y+QYL++   +A      ++P + R  +G+SY D
Sbjct  538  LSDLHNLGRSNNQTATGLQSPLSDPFYVQYLKTAQYTAQEAANYSDPYLERGFMGSSYAD  597

Query  308  YLELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP  487
               +QKA++  L  QK QYG P   K+   NHGYY N   G G++YPGSPL   +   SP
Sbjct  598  LTPVQKAYVEALLQQK-QYGMP-LGKSVSSNHGYYSNLGYGMGMAYPGSPLGSPVA--SP  653

Query  488  FGPGSPVRYGERNMHFTSGMRNL  556
             GPGSP+R GERN+ F S  R+L
Sbjct  654  SGPGSPIRLGERNLRFPSNTRSL  676



>ref|NP_180482.1| pumilio 2 [Arabidopsis thaliana]
 ref|NP_001189630.1| pumilio 2 [Arabidopsis thaliana]
 sp|Q9ZW06.1|PUM2_ARATH RecName: Full=Pumilio homolog 2; Short=APUM-2; Short=AtPUM2 [Arabidopsis 
thaliana]
 gb|AAC95216.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
 gb|AEC08220.1| pumilio 2 [Arabidopsis thaliana]
 gb|AEC08221.1| pumilio 2 [Arabidopsis thaliana]
Length=972

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 102/178 (57%), Gaps = 21/178 (12%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNPLMDP  202
            +N  A +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ + DP
Sbjct  436  ENASAASAMGFSGMDSR---LHGGGYVSSGQNLSESRNLGRFSNRMMGGGTGLQSHMADP  492

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY  S DL       LN+P ++   +GNSYM+ LELQ+A+LG   +QKSQYG P   
Sbjct  493  MYHQYADSLDL-------LNDPSMDVNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--  540

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T G   SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  541  KSGSPNSHTDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRN  595



>gb|EMS59607.1| Pumilio-like protein 2 [Triticum urartu]
Length=1001

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 85/143 (59%), Gaps = 6/143 (4%)
 Frame = +2

Query  134  IQNLHRL--RNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMD  307
            + +LH L   N+     +Q+PL DP Y+QYL++   +A      ++P + R  +G+SY D
Sbjct  476  LSDLHNLGRSNNQTATGLQSPLSDPFYVQYLKTAQYTAQEAANYSDPYLERGFMGSSYAD  535

Query  308  YLELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP  487
               +QKA++  L  QK QYG P   K+   NHGY+ N   G G++YPGSPL   +   SP
Sbjct  536  LTPVQKAYVEALLQQK-QYGMP-VGKSVASNHGYFSNLGYGMGMTYPGSPLGSPVA--SP  591

Query  488  FGPGSPVRYGERNMHFTSGMRNL  556
             GPGSP+R GERN+ F S  R+L
Sbjct  592  SGPGSPIRLGERNLRFPSNTRSL  614



>dbj|BAE98746.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
Length=736

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 102/178 (57%), Gaps = 21/178 (12%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNPLMDP  202
            +N  A +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ + DP
Sbjct  436  ENASAASAMGFSGMDSR---LHGGGYVSSGQNLSESRNLGRFSNRMMGGGTGLQSHMADP  492

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY  S DL       LN+P ++   +GNSYM+ LELQ+A+LG   +QKSQYG P   
Sbjct  493  MYHQYADSLDL-------LNDPSMDVNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--  540

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T G   SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  541  KSGSPNSHTDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRN  595



>ref|XP_006295787.1| hypothetical protein CARUB_v10024911mg [Capsella rubella]
 gb|EOA28685.1| hypothetical protein CARUB_v10024911mg [Capsella rubella]
Length=979

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 104/178 (58%), Gaps = 17/178 (10%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDP  202
            +NV A +A+G SGIDSR                +E +NL R  N  +G    +Q+ + DP
Sbjct  439  ENVSAASALGFSGIDSR--------LHGGGQNLSEPRNLGRFSNRMMGGGAGLQSHMADP  490

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY R ++ +  +L  LN+P ++R  + NSYM+ LELQ+A+L    +QKS YG P   
Sbjct  491  MYNQYGRFSE-NVDSLDLLNDPAMDRNFMNNSYMNMLELQRAYL---RAQKSHYGVPY--  544

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N +  YG+ T  + +SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  545  KSGSPNSYSGYGSPTFESNMSYPGSPLAHHLLPNSLVSPCSPMRQGEVNMRYPSATRN  602



>gb|AAM20149.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
Length=972

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 102/178 (57%), Gaps = 21/178 (12%)
 Frame = +2

Query  29   DNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLG--NSVQNPLMDP  202
            +N  A +A+G SG+DSR          +     +E +NL R  N  +G    +Q+ + DP
Sbjct  436  ENASATSAMGFSGMDSR---LHGGGYVSSGQNLSESRNLGRFSNRMMGGGTGLQSHMADP  492

Query  203  LYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFS  382
            +Y QY  S DL       LN+P ++   +GNSYM+ LELQ+A+LG   +QKSQYG P   
Sbjct  493  MYHQYADSLDL-------LNDPSMDVNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--  540

Query  383  KTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
            K+G  N H  YG+ T G   SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  541  KSGSPNSHTDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSATRN  595



>gb|ABW81064.1| AlMpt5-2 [Arabidopsis lyrata subsp. lyrata]
Length=949

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 103/172 (60%), Gaps = 15/172 (9%)
 Frame = +2

Query  47   TAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNS--VQNPLMDPLYLQYL  220
            +A+G SG+DSR          +     +E +N  RL N  LG    +Q+ + DP+Y QY 
Sbjct  438  SAMGLSGMDSR---LHGGGYVSSGQNLSESRNFGRLSNRMLGGGAGLQSHMADPMYHQYA  494

Query  221  RSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFPSFSKTGGIN  400
            R ++ +A +L  LN+P ++   +GNSYM+ LELQ+A+LG   +QKSQYG P   K+G  N
Sbjct  495  RFSE-NADSLDLLNDPSMDMNFMGNSYMNMLELQRAYLG---AQKSQYGVPY--KSGSPN  548

Query  401  -HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
             H  YG+ T G   SYPGSPLA  +LPNS   P SP+R GE NM + S  RN
Sbjct  549  SHSDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSAARN  597



>ref|XP_008658750.1| PREDICTED: pumilio homolog 1-like [Zea mays]
Length=762

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 23/123 (19%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            +DP Y+QYL       A L A  ++P+++R  LGNSYMD L   KA++G L   + QYG 
Sbjct  399  IDPAYIQYL-------AQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQKQYG-  450

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                        YYGN  LG  + YPGSPLA  +LP+SP  PGSP+R+GERNM F SGMR
Sbjct  451  ------------YYGN--LGFNLGYPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMR  496

Query  551  NLG  559
            N G
Sbjct  497  NFG  499



>tpg|DAA46484.1| TPA: hypothetical protein ZEAMMB73_346749 [Zea mays]
Length=752

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 23/123 (19%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            +DP Y+QYL       A L A  ++P+++R  LGNSYMD L   KA++G L   + QYG 
Sbjct  399  IDPAYIQYL-------AQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQKQYG-  450

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                        YYGN  LG  + YPGSPLA  +LP+SP  PGSP+R+GERNM F SGMR
Sbjct  451  ------------YYGN--LGFNLGYPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMR  496

Query  551  NLG  559
            N G
Sbjct  497  NFG  499



>gb|AFW82890.1| hypothetical protein ZEAMMB73_959107 [Zea mays]
Length=869

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 23/123 (19%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            +DP Y+QYL       A L A  ++P+++R  LGNSYMD L   KA++G L   + QYG 
Sbjct  395  IDPAYIQYL-------AQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQKQYG-  446

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                        YYGN  LG  + YPGSPLA  +LP+SP  PGSP+R+GERNM F SGMR
Sbjct  447  ------------YYGN--LGFNLGYPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMR  492

Query  551  NLG  559
            N G
Sbjct  493  NFG  495



>ref|NP_001146200.1| uncharacterized protein LOC100279770 [Zea mays]
 gb|ACL53455.1| unknown [Zea mays]
Length=873

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 23/123 (19%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            +DP Y+QYL       A L A  ++P+++R  LGNSYMD L   KA++G L   + QYG 
Sbjct  399  IDPAYIQYL-------AQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQKQYG-  450

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                        YYGN  LG  + YPGSPLA  +LP+SP  PGSP+R+GERNM F SGMR
Sbjct  451  ------------YYGN--LGFNLGYPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMR  496

Query  551  NLG  559
            N G
Sbjct  497  NFG  499



>gb|ACN27840.1| unknown [Zea mays]
 gb|AFW82889.1| hypothetical protein ZEAMMB73_959107 [Zea mays]
Length=873

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 23/123 (19%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            +DP Y+QYL       A L A  ++P+++R  LGNSYMD L   KA++G L   + QYG 
Sbjct  399  IDPAYIQYL-------AQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQKQYG-  450

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                        YYGN  LG  + YPGSPLA  +LP+SP  PGSP+R+GERNM F SGMR
Sbjct  451  ------------YYGN--LGFNLGYPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMR  496

Query  551  NLG  559
            N G
Sbjct  497  NFG  499



>ref|XP_006279123.1| hypothetical protein CARUB_v10008047mg, partial [Capsella rubella]
 gb|EOA12021.1| hypothetical protein CARUB_v10008047mg, partial [Capsella rubella]
Length=695

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 7/129 (5%)
 Frame = +2

Query  170  GNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLAS  349
            G  +Q+ ++DP+Y QY R ++ +   L  LN+P ++R  + NSYM+ LELQ+A+LG   +
Sbjct  441  GAGLQSHMVDPMYNQYGRFSE-NVDCLDLLNDPAMDRNFMNNSYMNMLELQRAYLG---A  496

Query  350  QKSQYGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERN  526
            QKSQYG P   K+G  N H  YG+ T G+ +SYPGSPLA  +LPNS   P SP+R GE N
Sbjct  497  QKSQYGVPY--KSGSPNSHSDYGSPTFGSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVN  554

Query  527  MHFTSGMRN  553
            M + S  RN
Sbjct  555  MRYPSATRN  563



>ref|XP_010535467.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535468.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535469.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=988

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 111/190 (58%), Gaps = 26/190 (14%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+ P   +N  A +A+G  G DSR +GGG             I + H  R +   +++Q
Sbjct  452  TGNFPPHLENGNAASALGLQGFDSRVLGGG-------------ISSGHTDRMTMGSSALQ  498

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGN-SYMDYL-ELQKAHLG-LLASQK  355
            +P  DPLY+QYLR+++  AA L ALN+P+++   LGN SYM+ L E+Q+A++   L++QK
Sbjct  499  HPFADPLYVQYLRTSEY-AAQLGALNDPMMDHNPLGNNSYMNNLAEMQRAYVDQFLSAQK  557

Query  356  SQYGFPSFSKTGG--INHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNM  529
             QY      K GG     GYYG       +SYPGSPLA    PNSP G GSP+R+ + NM
Sbjct  558  LQYVASVGGKYGGGSNQRGYYG-------MSYPGSPLANPDFPNSPVGSGSPMRHNDLNM  610

Query  530  HFTSGMRNLG  559
             + S MRNL 
Sbjct  611  SYPSRMRNLA  620



>ref|XP_002440447.1| hypothetical protein SORBIDRAFT_09g001090 [Sorghum bicolor]
 gb|EES18877.1| hypothetical protein SORBIDRAFT_09g001090 [Sorghum bicolor]
Length=878

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 74/123 (60%), Gaps = 23/123 (19%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGF  370
            +DP Y+QYL       A L A  ++P+++R  LGNSYMD L  QKA+LG L   + QYG 
Sbjct  404  IDPAYIQYL-------AQLAATCDDPLMDRGHLGNSYMDLLGTQKANLGPLLQSQKQYG-  455

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                        YYGN  LG  + Y GSPL   +LP+SP  PGSP+R+GERNM F SGMR
Sbjct  456  ------------YYGN--LGFNLGYAGSPLTSPVLPSSPIAPGSPLRHGERNMRFPSGMR  501

Query  551  NLG  559
            N G
Sbjct  502  NFG  504



>ref|NP_180478.1| pumilio 3 [Arabidopsis thaliana]
 sp|Q9ZW02.1|PUM3_ARATH RecName: Full=Pumilio homolog 3; Short=APUM-3; Short=AtPUM3 [Arabidopsis 
thaliana]
 gb|AAC95220.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
 gb|AEC08216.1| pumilio 3 [Arabidopsis thaliana]
Length=964

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 92/144 (64%), Gaps = 10/144 (7%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNP--LMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYM  304
            E +N+ R+ N  +     +P  L DP+Y QY R ++ +A +   LN+P ++R + GNSYM
Sbjct  451  ESRNIGRVGNRMMEGGTGHPSHLADPMYHQYARFSE-NADSFDLLNDPSMDR-NYGNSYM  508

Query  305  DYLELQKAHLGLLASQKSQYGFPSFSKTGGIN-HGYYGNSTLGAGISYPGSPLAGSILPN  481
            + LE+Q+A+LG   SQKSQYG P   K+G  N H YYG+ T G+ +SYPGSPLA   +PN
Sbjct  509  NMLEIQRAYLG---SQKSQYGLPY--KSGSPNSHSYYGSPTFGSNMSYPGSPLAHHGMPN  563

Query  482  SPFGPGSPVRYGERNMHFTSGMRN  553
            S   P SP+R GE NM + +  RN
Sbjct  564  SLMSPYSPMRRGEVNMRYPAATRN  587



>ref|XP_010535464.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535466.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=986

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 112/190 (59%), Gaps = 26/190 (14%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+ P   +N  A +A+G  G DSR +GGG             + + H  R +   +++Q
Sbjct  450  TGNFPPHLENGNAASALGLQGFDSRVLGGG-------------MSSGHTDRMTMGSSALQ  496

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGN-SYMDYL-ELQKAHLG-LLASQK  355
            +P  DPLY+QYLR+++  AA L ALN+P+++   LGN SYM+ L E+Q+A++  LL++QK
Sbjct  497  HPFADPLYVQYLRTSEY-AAQLGALNDPMMDHNLLGNNSYMNNLAEMQRAYIDQLLSAQK  555

Query  356  SQYGFPSFSKTGG--INHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNM  529
             QY      K GG     GY+G       +SYPGSPLA    PNSP G GSP+R+ + NM
Sbjct  556  QQYVASVGGKYGGGSNQRGYHG-------MSYPGSPLANPGFPNSPVGSGSPMRHNDLNM  608

Query  530  HFTSGMRNLG  559
             + S MRNL 
Sbjct  609  SYPSRMRNLA  618



>ref|XP_009616462.1| PREDICTED: pumilio homolog 2-like isoform X3 [Nicotiana tomentosiformis]
Length=794

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 86/137 (63%), Gaps = 14/137 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLG-NSYMDYLELQKAHL  334
            S +GN +  P  +DP+YLQYL  T    A + ALN+P ++R  +G NSY+D L  QKA+L
Sbjct  299  SRMGNQMGGPSFVDPMYLQYL--TAEYVAQVAALNDPSLDRSYMGGNSYVDLL--QKAYL  354

Query  335  GL-LASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVR  511
            G  +  QKSQY       +G  +HGYYGN   G G+SYPGSPLA  ++P SP GPGSP+R
Sbjct  355  GNNVLPQKSQY-----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVVPGSPVGPGSPMR  409

Query  512  YGERNMHFTSGMRNLGA  562
            + + N      MRN+ A
Sbjct  410  HSDYNN--MRRMRNIAA  424



>ref|XP_009779662.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009779663.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana sylvestris]
Length=975

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 86/137 (63%), Gaps = 14/137 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLG-NSYMDYLELQKAHL  334
            S +GN +  P  +DP+YLQYL  T    A + ALN+P ++R  +G NSY+D L  QKA+L
Sbjct  480  SRMGNQMGGPSFVDPMYLQYL--TAEYVAQVAALNDPSLDRSYMGGNSYVDLL--QKAYL  535

Query  335  GL-LASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVR  511
            G  +  QKSQY       +G  +HGYYGN   G G+SYPGSPLA  ++P SP GPGSP+R
Sbjct  536  GNNVLPQKSQY-----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMR  590

Query  512  YGERNMHFTSGMRNLGA  562
            + + N      MRN+ A
Sbjct  591  HSDYNN--MRRMRNIAA  605



>ref|XP_009779664.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana sylvestris]
Length=951

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 86/137 (63%), Gaps = 14/137 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLG-NSYMDYLELQKAHL  334
            S +GN +  P  +DP+YLQYL  T    A + ALN+P ++R  +G NSY+D L  QKA+L
Sbjct  456  SRMGNQMGGPSFVDPMYLQYL--TAEYVAQVAALNDPSLDRSYMGGNSYVDLL--QKAYL  511

Query  335  GL-LASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVR  511
            G  +  QKSQY       +G  +HGYYGN   G G+SYPGSPLA  ++P SP GPGSP+R
Sbjct  512  GNNVLPQKSQY-----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMR  566

Query  512  YGERNMHFTSGMRNLGA  562
            + + N      MRN+ A
Sbjct  567  HSDYNN--MRRMRNIAA  581



>ref|XP_009616459.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616460.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana tomentosiformis]
Length=975

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 86/137 (63%), Gaps = 14/137 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLG-NSYMDYLELQKAHL  334
            S +GN +  P  +DP+YLQYL  T    A + ALN+P ++R  +G NSY+D L  QKA+L
Sbjct  480  SRMGNQMGGPSFVDPMYLQYL--TAEYVAQVAALNDPSLDRSYMGGNSYVDLL--QKAYL  535

Query  335  GL-LASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVR  511
            G  +  QKSQY       +G  +HGYYGN   G G+SYPGSPLA  ++P SP GPGSP+R
Sbjct  536  GNNVLPQKSQY-----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVVPGSPVGPGSPMR  590

Query  512  YGERNMHFTSGMRNLGA  562
            + + N      MRN+ A
Sbjct  591  HSDYNN--MRRMRNIAA  605



>ref|XP_009616461.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana tomentosiformis]
Length=951

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 86/137 (63%), Gaps = 14/137 (10%)
 Frame = +2

Query  161  SSLGNSVQNP-LMDPLYLQYLRSTDLSAANLTALNNPIINRESLG-NSYMDYLELQKAHL  334
            S +GN +  P  +DP+YLQYL  T    A + ALN+P ++R  +G NSY+D L  QKA+L
Sbjct  456  SRMGNQMGGPSFVDPMYLQYL--TAEYVAQVAALNDPSLDRSYMGGNSYVDLL--QKAYL  511

Query  335  GL-LASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVR  511
            G  +  QKSQY       +G  +HGYYGN   G G+SYPGSPLA  ++P SP GPGSP+R
Sbjct  512  GNNVLPQKSQY-----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVVPGSPVGPGSPMR  566

Query  512  YGERNMHFTSGMRNLGA  562
            + + N      MRN+ A
Sbjct  567  HSDYNN--MRRMRNIAA  581



>ref|XP_004960534.1| PREDICTED: pumilio homolog 1-like [Setaria italica]
Length=871

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 78/129 (60%), Gaps = 24/129 (19%)
 Frame = +2

Query  176  SVQNPLMDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLGLLASQ  352
            S+Q P+ DP Y+QYL       A L A  ++P+++R  LGNSYMD L  QKA+LG L   
Sbjct  392  SLQTPI-DPAYIQYL-------AQLAASCDDPLMDRGHLGNSYMDLLGPQKANLGPLLQS  443

Query  353  KSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMH  532
            + QYG             YYGN  LG  + Y GSPL   +LP+SP  PGSP+R+G+R+M 
Sbjct  444  QKQYG-------------YYGN--LGFNLGYAGSPLTSPVLPSSPIAPGSPLRHGDRSMR  488

Query  533  FTSGMRNLG  559
            F SGMRN G
Sbjct  489  FPSGMRNFG  497



>ref|XP_009384840.1| PREDICTED: pumilio homolog 2-like [Musa acuminata subsp. malaccensis]
Length=1044

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = +2

Query  131  EIQNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDY  310
            ++++L ++ N S   ++Q P  DPLYLQYL++ + +A    +  +P + R  +GNS+ + 
Sbjct  527  DLKSLGQIGNQSAIAALQTPPSDPLYLQYLKAAEYTAQVAASYGDPSMERGYVGNSHAEL  586

Query  311  LELQKAHLGLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPF  490
            L +Q A++  L   + QY      K G  NHGYYG+     G+SYPGSPLAG I  +S  
Sbjct  587  LGVQNAYIASLLQSQKQYDPSLLGKFGFTNHGYYGSPAFDLGLSYPGSPLAGQI--DSQI  644

Query  491  GPGSPVRYGERNMHFTSGMRNL  556
            GPGS ++ GE    F  G+RNL
Sbjct  645  GPGSALKLGEHYTQFPYGLRNL  666



>ref|XP_010535463.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=1002

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 112/190 (59%), Gaps = 26/190 (14%)
 Frame = +2

Query  5    SGHLPYLSDNVGAGTAIGASGIDSRSMgggltlppnllaaaaEIQNLHRLRNSSLGNSVQ  184
            +G+ P   +N  A +A+G  G DSR +GGG++               H  R +   +++Q
Sbjct  451  TGNFPPHLENGNAASALGLQGFDSRVLGGGMSSG-------------HADRMTMGSSALQ  497

Query  185  NPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGN-SYMDYL-ELQKAHLG-LLASQK  355
            +P  DPLY+QYLR+++  AA+L ALN+P+++   LGN SYM+ L E+Q A++G LL++QK
Sbjct  498  HPFADPLYVQYLRTSEY-AAHLGALNDPMMDHNLLGNNSYMNNLAEMQSAYIGQLLSAQK  556

Query  356  SQYGFPSFSKTGG--INHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNM  529
             QY      K GG     GY+G       +SYPG+PLA    PNSP G GSP+R+ + NM
Sbjct  557  QQYVASVGGKYGGGSNQRGYHG-------MSYPGNPLANPGFPNSPVGSGSPMRHNDLNM  609

Query  530  HFTSGMRNLG  559
             + S M+ L 
Sbjct  610  SYPSRMKYLA  619



>gb|EYU19929.1| hypothetical protein MIMGU_mgv1a001211mg [Erythranthe guttata]
Length=865

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 14/123 (11%)
 Frame = +2

Query  191  LMDPLYLQYLRSTDLSAANLTALNNPIINRESL-GNSYMDYLELQKAHLGLLASQKSQYG  367
            LMDP YLQYLRS + S           +NRESL  NS  ++L LQKA++  L  QKSQYG
Sbjct  383  LMDPSYLQYLRSNEYS-----------LNRESLVANSQGEFLALQKAYVEALL-QKSQYG  430

Query  368  FPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGM  547
              ++ K+  +++G++GNS  G G SY G+P+   + PNSP G G P R+ E+ MHF S +
Sbjct  431  L-AYGKSSNLSNGFHGNSGYGVGFSYSGNPMGRPVYPNSPVGSGGPARHMEQMMHFPSSL  489

Query  548  RNL  556
            R +
Sbjct  490  RTV  492



>ref|XP_006653961.1| PREDICTED: pumilio homolog 1-like [Oryza brachyantha]
Length=877

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 81/131 (62%), Gaps = 18/131 (14%)
 Frame = +2

Query  170  GNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLA  346
              S+Q P+ DP Y+QYL++ +++A    + ++P++    LG+SYMD L  QKA+   LL 
Sbjct  389  ATSLQAPI-DPAYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYSSPLLQ  447

Query  347  SQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERN  526
            SQK              N GYYGN  LG G++Y GSPL   +LP+SP  PGSP+R+GER+
Sbjct  448  SQK--------------NCGYYGN--LGFGLNYAGSPLMSPVLPSSPAAPGSPLRHGERS  491

Query  527  MHFTSGMRNLG  559
            M   SGMRN G
Sbjct  492  MRLQSGMRNFG  502



>gb|EMS50302.1| Pumilio-like protein 3 [Triticum urartu]
Length=730

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 78/132 (59%), Gaps = 25/132 (19%)
 Frame = +2

Query  170  GNSVQNPLMDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLG-LL  343
            G+S+Q P+ DPLY+QYL      AA + A  ++P +    LGNSYMD L  QK  L  LL
Sbjct  248  GSSLQMPI-DPLYVQYL------AAQVAASYDDPFMAGGHLGNSYMDLLGPQKGCLSPLL  300

Query  344  ASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGER  523
             SQK              N+G YGN  LG G+ Y GSPL   +LP+SP   GSP+R+GER
Sbjct  301  QSQK--------------NYGCYGN--LGFGLGYGGSPLTSPVLPSSPVASGSPLRHGER  344

Query  524  NMHFTSGMRNLG  559
            +M F SGMRN G
Sbjct  345  SMRFASGMRNFG  356



>ref|NP_001170502.1| uncharacterized protein LOC100384506 [Zea mays]
 gb|ACR33883.1| unknown [Zea mays]
Length=440

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 20/122 (16%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            +DP Y+QYL      A      ++P+++R  LG+SYMD L  QKA+LG L   + QYG  
Sbjct  256  IDPAYIQYL------AQIAATWDDPLMDRSHLGSSYMDLLGTQKANLGPLLQSQKQYG--  307

Query  374  SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
                       Y GN     G  Y GSPL   +LP+SP  PGSP+R+G+RNM F  GMRN
Sbjct  308  -----------YCGNLGFNLG-GYAGSPLTSPVLPSSPIAPGSPLRHGDRNMRFPPGMRN  355

Query  554  LG  559
             G
Sbjct  356  FG  357



>gb|AAM22812.1|AF427791_3 BPM [Hordeum vulgare subsp. vulgare]
Length=911

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 77/132 (58%), Gaps = 25/132 (19%)
 Frame = +2

Query  170  GNSVQNPLMDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLG-LL  343
             +S+Q P+ DPLYLQYL      AA + A  ++P +    LG+SYMD L  QK  L  LL
Sbjct  429  ASSLQMPI-DPLYLQYL------AAQVAASYDDPFMASGHLGSSYMDLLGPQKGCLSPLL  481

Query  344  ASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGER  523
             SQK              N+G YGN  LG G+ Y GSPL   +LP+SP   GSP+R+GER
Sbjct  482  QSQK--------------NYGCYGN--LGFGLGYAGSPLTSPVLPSSPVASGSPLRHGER  525

Query  524  NMHFTSGMRNLG  559
            +M F SGMRN G
Sbjct  526  SMRFASGMRNFG  537



>gb|AFW74987.1| hypothetical protein ZEAMMB73_090092 [Zea mays]
Length=919

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 20/122 (16%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            +DP Y+QYL      A      ++P+++R  LG+SYMD L  QKA+LG L   + QYG  
Sbjct  396  IDPAYIQYL------AQIAATWDDPLMDRSHLGSSYMDLLGTQKANLGPLLQSQKQYG--  447

Query  374  SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
                       Y GN     G  Y GSPL   +LP+SP  PGSP+R+G+RNM F  GMRN
Sbjct  448  -----------YCGNLGFNLG-GYAGSPLTSPVLPSSPIAPGSPLRHGDRNMRFPPGMRN  495

Query  554  LG  559
             G
Sbjct  496  FG  497



>ref|XP_008648194.1| PREDICTED: uncharacterized protein LOC100384506 isoform X1 [Zea 
mays]
Length=871

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 20/122 (16%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            +DP Y+QYL      A      ++P+++R  LG+SYMD L  QKA+LG L   + QYG  
Sbjct  396  IDPAYIQYL------AQIAATWDDPLMDRSHLGSSYMDLLGTQKANLGPLLQSQKQYG--  447

Query  374  SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
                       Y GN     G  Y GSPL   +LP+SP  PGSP+R+G+RNM F  GMRN
Sbjct  448  -----------YCGNLGFNLG-GYAGSPLTSPVLPSSPIAPGSPLRHGDRNMRFPPGMRN  495

Query  554  LG  559
             G
Sbjct  496  FG  497



>gb|EEE62062.1| hypothetical protein OsJ_16846 [Oryza sativa Japonica Group]
Length=878

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGF  370
            +DP Y+QYL++ +++A    + ++P++    LG+SYMD L  QKA+   LL SQK     
Sbjct  397  IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLLQSQK-----  451

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                     N GYYGN  LG G+ Y GSPL   +LP+SP  PGSP+R+GER+M   SG+R
Sbjct  452  ---------NCGYYGN--LGFGLGYSGSPLMSPVLPSSPAAPGSPLRHGERSMRMQSGIR  500

Query  551  NLG  559
            N G
Sbjct  501  NFG  503



>gb|EEC78380.1| hypothetical protein OsI_18154 [Oryza sativa Indica Group]
Length=862

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGF  370
            +DP Y+QYL++ +++A    + ++P++    LG+SYMD L  QKA+   LL SQK     
Sbjct  381  IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLLQSQK-----  435

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                     N GYYGN  LG G+ Y GSPL   +LP+SP  PGSP+R+GER+M   SG+R
Sbjct  436  ---------NCGYYGN--LGFGLGYSGSPLMSPVLPSSPAAPGSPLRHGERSMRMQSGIR  484

Query  551  NLG  559
            N G
Sbjct  485  NFG  487



>dbj|BAH00903.1| unnamed protein product [Oryza sativa Japonica Group]
Length=882

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGF  370
            +DP Y+QYL++ +++A    + ++P++    LG+SYMD L  QKA+   LL SQK     
Sbjct  401  IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLLQSQK-----  455

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                     N GYYGN  LG G+ Y GSPL   +LP+SP  PGSP+R+GER+M   SG+R
Sbjct  456  ---------NCGYYGN--LGFGLGYSGSPLMSPVLPSSPAAPGSPLRHGERSMRMQSGIR  504

Query  551  NLG  559
            N G
Sbjct  505  NFG  507



>gb|AAU44141.1| putative pumilio/Mpt5 family RNA-binding protein [Oryza sativa 
Japonica Group]
Length=874

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGF  370
            +DP Y+QYL++ +++A    + ++P++    LG+SYMD L  QKA+   LL SQK     
Sbjct  225  IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLLQSQK-----  279

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                     N GYYGN  LG G+ Y GSPL   +LP+SP  PGSP+R+GER+M   SG+R
Sbjct  280  ---------NCGYYGN--LGFGLGYSGSPLMSPVLPSSPAAPGSPLRHGERSMRMQSGIR  328

Query  551  NLG  559
            N G
Sbjct  329  NFG  331



>gb|AAK73144.1|AC079022_17 putative pumilio/Mpt5 family RNA-binding protein [Oryza sativa]
Length=851

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LLASQKSQYGF  370
            +DP Y+QYL++ +++A    + ++P++    LG+SYMD L  QKA+   LL SQK     
Sbjct  370  IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLLQSQK-----  424

Query  371  PSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMR  550
                     N GYYGN  LG G+ Y GSPL   +LP+SP  PGSP+R+GER+M   SG+R
Sbjct  425  ---------NCGYYGN--LGFGLGYSGSPLMSPVLPSSPAAPGSPLRHGERSMRMQSGIR  473

Query  551  NLG  559
            N G
Sbjct  474  NFG  476



>ref|XP_003569112.1| PREDICTED: pumilio homolog 1-like, partial [Brachypodium distachyon]
Length=639

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 76/132 (58%), Gaps = 25/132 (19%)
 Frame = +2

Query  170  GNSVQNPLMDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLG-LL  343
             N++Q P+ DP Y+QYL      AA + A   +P +    LG+SYMD L  QKA L  LL
Sbjct  157  ANALQMPI-DPAYVQYL------AAQVAASYEDPYMASGLLGSSYMDLLGPQKACLSPLL  209

Query  344  ASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGER  523
             SQK              N+G YGN  LG G+ Y GSPL   +LP+SP   GSP+R+GER
Sbjct  210  QSQK--------------NYGCYGN--LGFGLGYAGSPLTSPVLPSSPVASGSPLRHGER  253

Query  524  NMHFTSGMRNLG  559
            +M F SGMRN G
Sbjct  254  SMRFASGMRNFG  265



>ref|XP_010231850.1| PREDICTED: pumilio homolog 1-like [Brachypodium distachyon]
Length=888

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 76/132 (58%), Gaps = 25/132 (19%)
 Frame = +2

Query  170  GNSVQNPLMDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLG-LL  343
             N++Q P+ DP Y+QYL      AA + A   +P +    LG+SYMD L  QKA L  LL
Sbjct  406  ANALQMPI-DPAYVQYL------AAQVAASYEDPYMASGLLGSSYMDLLGPQKACLSPLL  458

Query  344  ASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGER  523
             SQK              N+G YGN  LG G+ Y GSPL   +LP+SP   GSP+R+GER
Sbjct  459  QSQK--------------NYGCYGN--LGFGLGYAGSPLTSPVLPSSPVASGSPLRHGER  502

Query  524  NMHFTSGMRNLG  559
            +M F SGMRN G
Sbjct  503  SMRFASGMRNFG  514



>ref|XP_008233289.1| PREDICTED: pumilio homolog 4 [Prunus mume]
 ref|XP_008233290.1| PREDICTED: pumilio homolog 4 [Prunus mume]
Length=1021

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +2

Query  143  LHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQ  322
            ++RL N  +G+ + + +MDP Y+Q+L+  D +  N+T+ +    ++   G  + D   LQ
Sbjct  511  MNRLGNK-VGSGLHSSVMDPSYIQFLQRADYATRNVTSPSGYSPSKNHFGTLHGDLEGLQ  569

Query  323  KAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPG  499
            KA+L  LLA QK QY      K+GG NHGYYGN + G G++YPG+P+A S+ P+   G  
Sbjct  570  KAYLEALLAQQKQQYELSFLGKSGGFNHGYYGNPSYGLGMTYPGNPMANSVHPS--VGSS  627

Query  500  SPVRYGERNMHFTSGMR  550
            SP+   E+   F S +R
Sbjct  628  SPMFQNEKIERFNSMLR  644



>ref|XP_009396181.1| PREDICTED: pumilio homolog 1-like [Musa acuminata subsp. malaccensis]
Length=1011

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 75/131 (57%), Gaps = 4/131 (3%)
 Frame = +2

Query  167  LGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LL  343
            +G+  Q P+MD LY QYLRST  S        +       LG+S M+  E Q A+LG LL
Sbjct  509  VGSGFQGPIMDSLYAQYLRSTSDSLVRGPGNLDHYSGMNYLGSSQMNLPEYQTAYLGALL  568

Query  344  ASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSP-FGPGSPVRYGE  520
            A QK QY  P  SK+GG+NHG+  +   G G+ YPGSP + +I  +SP  G GSPVR  E
Sbjct  569  AQQKLQYSMPLLSKSGGLNHGFSSSHAFGIGMPYPGSPSSTTI--HSPNLGSGSPVRLNE  626

Query  521  RNMHFTSGMRN  553
            R     S MR+
Sbjct  627  RLSRIPSSMRS  637



>ref|XP_008365664.1| PREDICTED: pumilio homolog 4 [Malus domestica]
 ref|XP_008365729.1| PREDICTED: pumilio homolog 4 [Malus domestica]
Length=1021

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 84/139 (60%), Gaps = 5/139 (4%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q+L+RL N  +G  + + +MDP Y+Q+L+ TD +A N+T  +   +++   G  + D   
Sbjct  510  QSLNRLGNK-VGPGLHSSVMDPSYIQFLQRTDYAARNVTNPSGYPLSKNHFGTLHGDLEG  568

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            LQKA+L  LLA +K QY      K+GG NHGYYGN   G G+ YPG+P+A S+ P+   G
Sbjct  569  LQKAYLEALLAQRKQQYDLSILGKSGGFNHGYYGNPPYGLGM-YPGNPMANSLHPS--IG  625

Query  494  PGSPVRYGERNMHFTSGMR  550
             GSP+   E+   F S +R
Sbjct  626  YGSPMFESEKIARFNSMLR  644



>gb|EMT27786.1| Pumilio-like protein [Aegilops tauschii]
Length=727

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 75/130 (58%), Gaps = 25/130 (19%)
 Frame = +2

Query  176  SVQNPLMDPLYLQYLRSTDLSAANLTA-LNNPIINRESLGNSYMDYLELQKAHLG-LLAS  349
            S+Q P+ DPLY+QYL      AA + A  ++P +    LG+SYMD L  QK  L  LL S
Sbjct  247  SLQMPI-DPLYVQYL------AAQVAASYDDPFMASGHLGSSYMDLLGPQKGCLSPLLQS  299

Query  350  QKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNM  529
            QK              N+G YGN   G G+ Y GSPL   +LP+SP   GSP+R+GER+M
Sbjct  300  QK--------------NYGCYGNP--GFGLGYGGSPLTSPVLPSSPVASGSPLRHGERSM  343

Query  530  HFTSGMRNLG  559
             F SGMRN G
Sbjct  344  RFASGMRNFG  353



>ref|XP_002273503.1| PREDICTED: pumilio homolog 4 isoform X1 [Vitis vinifera]
 ref|XP_010658380.1| PREDICTED: pumilio homolog 4 isoform X1 [Vitis vinifera]
 emb|CBI31431.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 7/132 (5%)
 Frame = +2

Query  170  GNSVQNPL---MDPLYLQYLRST-DLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-  334
            GN V + L   M+P  + Y++ T D +     +  +P   R  +G S+ D L LQKA+L 
Sbjct  521  GNWVSSDLHSYMEPHGVHYMQGTSDYATRTAASQGDPSSVRNFIGTSHGDLLGLQKAYLE  580

Query  335  GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRY  514
             LLA QK QY  P   K+GG+N GYYGNS+ G G++YPG+P+A S LP+   G G+P+  
Sbjct  581  TLLAQQKQQYELPLLGKSGGLNQGYYGNSSYGLGMAYPGNPMANSALPS--VGSGNPMFQ  638

Query  515  GERNMHFTSGMR  550
             ++   FTS MR
Sbjct  639  NDQISCFTSMMR  650



>ref|XP_010658381.1| PREDICTED: pumilio homolog 4 isoform X2 [Vitis vinifera]
Length=1024

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 7/132 (5%)
 Frame = +2

Query  170  GNSVQNPL---MDPLYLQYLRST-DLSAANLTALNNPIINRESLGNSYMDYLELQKAHL-  334
            GN V + L   M+P  + Y++ T D +     +  +P   R  +G S+ D L LQKA+L 
Sbjct  519  GNWVSSDLHSYMEPHGVHYMQGTSDYATRTAASQGDPSSVRNFIGTSHGDLLGLQKAYLE  578

Query  335  GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRY  514
             LLA QK QY  P   K+GG+N GYYGNS+ G G++YPG+P+A S LP+   G G+P+  
Sbjct  579  TLLAQQKQQYELPLLGKSGGLNQGYYGNSSYGLGMAYPGNPMANSALPS--VGSGNPMFQ  636

Query  515  GERNMHFTSGMR  550
             ++   FTS MR
Sbjct  637  NDQISCFTSMMR  648



>ref|XP_009368908.1| PREDICTED: pumilio homolog 4 isoform X2 [Pyrus x bretschneideri]
Length=1021

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 84/139 (60%), Gaps = 5/139 (4%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q+L+RL N  +G  + + +MDP Y+Q+L+ TD +A N+T+ +   +++   G  + D   
Sbjct  510  QSLNRLGNK-VGPGLHSSVMDPSYIQFLQRTDYAARNVTSPSGYPLSKNHFGTLHGDLEG  568

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            LQKA+L  LLA +K QY       + G NHGYYG+   G G+ YPG+P+A S+ P+   G
Sbjct  569  LQKAYLEALLAQRKQQYELSVLGNSDGFNHGYYGSPPYGLGM-YPGNPMANSLHPS--IG  625

Query  494  PGSPVRYGERNMHFTSGMR  550
             GSP+   E+  HF S +R
Sbjct  626  YGSPMFESEKIAHFNSMLR  644



>ref|XP_009368909.1| PREDICTED: pumilio homolog 4 isoform X3 [Pyrus x bretschneideri]
Length=1020

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 84/139 (60%), Gaps = 5/139 (4%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q+L+RL N  +G  + + +MDP Y+Q+L+ TD +A N+T+ +   +++   G  + D   
Sbjct  509  QSLNRLGNK-VGPGLHSSVMDPSYIQFLQRTDYAARNVTSPSGYPLSKNHFGTLHGDLEG  567

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            LQKA+L  LLA +K QY       + G NHGYYG+   G G+ YPG+P+A S+ P+   G
Sbjct  568  LQKAYLEALLAQRKQQYELSVLGNSDGFNHGYYGSPPYGLGM-YPGNPMANSLHPS--IG  624

Query  494  PGSPVRYGERNMHFTSGMR  550
             GSP+   E+  HF S +R
Sbjct  625  YGSPMFESEKIAHFNSMLR  643



>ref|XP_009368907.1| PREDICTED: pumilio homolog 4 isoform X1 [Pyrus x bretschneideri]
Length=1023

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 84/139 (60%), Gaps = 5/139 (4%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q+L+RL N  +G  + + +MDP Y+Q+L+ TD +A N+T+ +   +++   G  + D   
Sbjct  512  QSLNRLGNK-VGPGLHSSVMDPSYIQFLQRTDYAARNVTSPSGYPLSKNHFGTLHGDLEG  570

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            LQKA+L  LLA +K QY       + G NHGYYG+   G G+ YPG+P+A S+ P+   G
Sbjct  571  LQKAYLEALLAQRKQQYELSVLGNSDGFNHGYYGSPPYGLGM-YPGNPMANSLHPS--IG  627

Query  494  PGSPVRYGERNMHFTSGMR  550
             GSP+   E+  HF S +R
Sbjct  628  YGSPMFESEKIAHFNSMLR  646



>ref|XP_010935723.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
 ref|XP_010935724.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
 ref|XP_010935725.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
Length=1031

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +2

Query  167  LGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLG-LL  343
            +G+  Q P+MDPLY QYL S+  +A +  A  +P + R  LG S+MD  E QKA+LG LL
Sbjct  530  VGSGFQLPIMDPLYAQYLHSSSNAAIHAAATLDPSLGRNYLGTSHMDLSEYQKAYLGALL  589

Query  344  ASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPG  451
              QK QYG P   K+G +NHG++G    G G+ YP 
Sbjct  590  TQQKLQYGMPLPGKSGSLNHGFFGGHAFGLGMPYPA  625



>ref|XP_007220282.1| hypothetical protein PRUPE_ppa000731mg [Prunus persica]
 gb|EMJ21481.1| hypothetical protein PRUPE_ppa000731mg [Prunus persica]
Length=1021

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 4/137 (3%)
 Frame = +2

Query  143  LHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQ  322
            ++RL N  +G+ + + +MDP Y+Q+L+  D +  N+ + +    ++   G  + D   LQ
Sbjct  511  MNRLGNK-VGSGLHSSVMDPSYIQFLQRADYATRNVNSPSGYPPSKNHFGTLHGDLEGLQ  569

Query  323  KAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPG  499
            KA+L  LLA QK QY      K+GG NHGYYGN + G G++YPG+ +A S+ P+   G  
Sbjct  570  KAYLEALLAQQKQQYELSLLGKSGGFNHGYYGNPSYGLGMTYPGNQMANSVHPS--VGSS  627

Query  500  SPVRYGERNMHFTSGMR  550
            SP+   E+   F S +R
Sbjct  628  SPMFQNEKIERFNSMLR  644



>emb|CDM82624.1| unnamed protein product [Triticum aestivum]
Length=759

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            +DPLY Q+LR+ +++A       +P++ R +LG+SYMD    Q  +LG L   + QY   
Sbjct  278  VDPLYAQFLRAAEIAAFAANC-EDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQKQYD--  334

Query  374  SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
                       YYGN  LG+G+ Y G+ L   + P SP GPGSP+R+ +R+M F S MRN
Sbjct  335  -----------YYGN--LGSGLGYAGNSLTSPVFPTSPGGPGSPLRHVDRSMRFQSSMRN  381

Query  554  LG  559
             G
Sbjct  382  FG  383



>gb|EMT10419.1| Pumilio-like protein [Aegilops tauschii]
Length=764

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            +DPLY Q+LR+ +++A       +P++ R +LG+SYMD    Q  +LG L   + QY   
Sbjct  284  VDPLYAQFLRAAEIAAFAANC-EDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQKQYD--  340

Query  374  SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
                       YYGN  LG+G+ Y G+ L   + P SP GPGSP+R+ +R+M F S MRN
Sbjct  341  -----------YYGN--LGSGLGYAGNSLTNPVFPTSPGGPGSPLRHVDRSMRFQSSMRN  387

Query  554  LG  559
             G
Sbjct  388  FG  389



>gb|EMS46736.1| Pumilio-like protein 1 [Triticum urartu]
Length=1197

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            +DPLY Q+LR+ +++A       +P++ R +LG+SYMD    Q  +LG L   + QY   
Sbjct  698  VDPLYAQFLRAAEIAAFAANC-EDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQKQYD--  754

Query  374  SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
                       YYGN  LG+G+ Y G+ L   + P SP GPGSP+R+ +R+M F S MRN
Sbjct  755  -----------YYGN--LGSGLGYAGNSLTSPVFPTSPGGPGSPLRHVDRSMRFQSSMRN  801

Query  554  LG  559
             G
Sbjct  802  FG  803



>dbj|BAK03395.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AHG29012.1| pumilio [Hordeum vulgare subsp. vulgare]
Length=886

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  194  MDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLELQKAHLGLLASQKSQYGFP  373
            +DPLY Q+LR+ +++A       +P++ R +LG+SYMD    Q  +LG L   + QY   
Sbjct  405  VDPLYAQFLRAAEIAAFAANC-EDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQKQYD--  461

Query  374  SFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFGPGSPVRYGERNMHFTSGMRN  553
                       YYGN  LG+G+ Y G+ L   + P SP GPGSP+R+ +R+M F S MRN
Sbjct  462  -----------YYGN--LGSGLGYAGNSLTSPVFPTSPGGPGSPLRHVDRSMRFQSSMRN  508

Query  554  LG  559
             G
Sbjct  509  FG  510



>ref|XP_008362674.1| PREDICTED: pumilio homolog 4-like isoform X2 [Malus domestica]
Length=1022

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 81/139 (58%), Gaps = 5/139 (4%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q L+RL N  +G  + +P+MDP Y+Q+LR +D +  N+T+ +   +++   G  + D   
Sbjct  511  QGLNRLGNK-VGPGLHSPVMDPSYIQFLRRSDHATCNVTSPSGYPLSKNHFGTLHGDLEG  569

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            +QKA+L  LL  +K QY      ++GG NHG+YGN   G G+ YPG+P+   + P+   G
Sbjct  570  IQKAYLEALLVQRKQQYELSLLGRSGGFNHGHYGNPPYGLGM-YPGNPMENYLHPS--IG  626

Query  494  PGSPVRYGERNMHFTSGMR  550
             GSP+   E+   F S +R
Sbjct  627  SGSPMFESEKIARFNSMLR  645



>ref|XP_008362673.1| PREDICTED: pumilio homolog 4-like isoform X1 [Malus domestica]
Length=1023

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 81/139 (58%), Gaps = 5/139 (4%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q L+RL N  +G  + +P+MDP Y+Q+LR +D +  N+T+ +   +++   G  + D   
Sbjct  512  QGLNRLGNK-VGPGLHSPVMDPSYIQFLRRSDHATCNVTSPSGYPLSKNHFGTLHGDLEG  570

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            +QKA+L  LL  +K QY      ++GG NHG+YGN   G G+ YPG+P+   + P+   G
Sbjct  571  IQKAYLEALLVQRKQQYELSLLGRSGGFNHGHYGNPPYGLGM-YPGNPMENYLHPS--IG  627

Query  494  PGSPVRYGERNMHFTSGMR  550
             GSP+   E+   F S +R
Sbjct  628  SGSPMFESEKIARFNSMLR  646



>ref|XP_007009913.1| Pumilio 4 isoform 2 [Theobroma cacao]
 gb|EOY18723.1| Pumilio 4 isoform 2 [Theobroma cacao]
Length=907

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q+L+R  N   G  + +PLMDP Y+QYL+ T    A   A  + +++   +G  + D   
Sbjct  521  QSLNRAGNQ--GADLLSPLMDPRYIQYLQRTSQYGARAAASPDSLLSGNYVGTLHGDLDG  578

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            LQKA+L  +LA QK QY  P   K   +NHGYYGN + G G+ + G+ +A S+LP+   G
Sbjct  579  LQKAYLEAILAQQKQQYELPLLGKAAALNHGYYGNPSYGLGMPFAGNSMANSVLPS--IG  636

Query  494  PGSPVRYGERNMHFTSGMR  550
             GS     +R   F S MR
Sbjct  637  SGSI--QNDRTARFNSMMR  653



>ref|XP_007009912.1| Pumilio 4 isoform 1 [Theobroma cacao]
 gb|EOY18722.1| Pumilio 4 isoform 1 [Theobroma cacao]
Length=1026

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q+L+R  N   G  + +PLMDP Y+QYL+ T    A   A  + +++   +G  + D   
Sbjct  521  QSLNRAGNQ--GADLLSPLMDPRYIQYLQRTSQYGARAAASPDSLLSGNYVGTLHGDLDG  578

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            LQKA+L  +LA QK QY  P   K   +NHGYYGN + G G+ + G+ +A S+LP+   G
Sbjct  579  LQKAYLEAILAQQKQQYELPLLGKAAALNHGYYGNPSYGLGMPFAGNSMANSVLPS--IG  636

Query  494  PGSPVRYGERNMHFTSGMR  550
             GS     +R   F S MR
Sbjct  637  SGSI--QNDRTARFNSMMR  653



>ref|XP_007009914.1| Pumilio 4 isoform 3 [Theobroma cacao]
 gb|EOY18724.1| Pumilio 4 isoform 3 [Theobroma cacao]
Length=767

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = +2

Query  137  QNLHRLRNSSLGNSVQNPLMDPLYLQYLRSTDLSAANLTALNNPIINRESLGNSYMDYLE  316
            Q+L+R  N   G  + +PLMDP Y+QYL+ T    A   A  + +++   +G  + D   
Sbjct  521  QSLNRAGNQ--GADLLSPLMDPRYIQYLQRTSQYGARAAASPDSLLSGNYVGTLHGDLDG  578

Query  317  LQKAHL-GLLASQKSQYGFPSFSKTGGINHGYYGNSTLGAGISYPGSPLAGSILPNSPFG  493
            LQKA+L  +LA QK QY  P   K   +NHGYYGN + G G+ + G+ +A S+LP+   G
Sbjct  579  LQKAYLEAILAQQKQQYELPLLGKAAALNHGYYGNPSYGLGMPFAGNSMANSVLPS--IG  636

Query  494  PGSPVRYGERNMHFTSGMR  550
             GS     +R   F S MR
Sbjct  637  SGSI--QNDRTARFNSMMR  653



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880