BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP019H05 465 bp,:Filtered

Length=432
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN64512.1|  hypothetical protein VITISV_004351                     203   4e-62   Vitis vinifera
ref|XP_004153848.1|  PREDICTED: LOW QUALITY PROTEIN: NADH-ubiquin...    204   2e-60   
ref|XP_003588352.1|  NADH dehydrogenase subunit                         209   2e-59   
gb|KJB09778.1|  hypothetical protein B456_001G164600                    183   4e-52   Gossypium raimondii
ref|NP_064003.1|  orf300 gene product                                   160   3e-45   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI23503.3|  unnamed protein product                                162   3e-44   Vitis vinifera
emb|CAA34729.1|  unnamed protein product                                161   6e-44   Beta vulgaris subsp. vulgaris [field beet]
sp|P15688.2|NU2M_BETVU  RecName: Full=NADH-ubiquinone oxidoreduct...    161   9e-44   Beta vulgaris [beet]
ref|XP_006401945.1|  hypothetical protein EUTSA_v10015951mg             158   2e-43   
ref|YP_173427.1|  hypothetical protein NitaMp087                        145   3e-40   Nicotiana tabacum [American tobacco]
ref|NP_671807.1|  NADH-ubiquinone/plastoquinone (complex I) protein     144   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|YP_009091715.1|  orf214                                             144   9e-40   
gb|AHY20322.1|  NADH dehydrogenase subunit 2 (mitochondrion)            143   2e-39   Brassica juncea var. tumida [zha cai]
ref|XP_011043349.1|  PREDICTED: NADH-ubiquinone oxidoreductase ch...    144   3e-39   Populus euphratica
ref|XP_004173103.1|  PREDICTED: NADH-ubiquinone oxidoreductase ch...    139   9e-38   
gb|AGC78980.1|  hypothetical protein                                    139   1e-37   Vicia faba [broad bean]
ref|XP_010647127.1|  PREDICTED: LOW QUALITY PROTEIN: NADH-ubiquin...    127   2e-32   
ref|XP_011069475.1|  PREDICTED: NADH-ubiquinone oxidoreductase ch...    124   5e-32   Sesamum indicum [beniseed]
ref|XP_002534810.1|  NADH dehydrogenase, putative                       115   1e-28   
gb|EHK62692.1|  hypothetical protein M3S_K16                            110   4e-27   Sorghum bicolor [broomcorn]
gb|EMS45534.1|  NADH-ubiquinone oxidoreductase chain 2                  108   6e-27   Triticum urartu
gb|EPS74676.1|  hypothetical protein M569_00051                         112   6e-27   Genlisea aurea
gb|EMS61551.1|  NADH-ubiquinone oxidoreductase chain 2                  110   1e-26   Triticum urartu
ref|XP_009385759.1|  PREDICTED: NADH-ubiquinone oxidoreductase ch...    109   1e-26   
ref|YP_005090358.1|  NADH dehydrogenase subunit 2                       110   1e-25   Phoenix dactylifera
gb|EMS44984.1|  NADH-ubiquinone oxidoreductase chain 2                  106   2e-25   Triticum urartu
gb|AFW86834.1|  hypothetical protein ZEAMMB73_135095                    103   3e-24   
gb|KEH38129.1|  hypothetical protein MTR_2g461800                       100   1e-23   Medicago truncatula
ref|YP_006280921.1|  NADH dehydrogenase subunit 2                       104   2e-23   Spirodela polyrhiza
gb|AGK25068.1|  NADH dehydrogenase subunit 2                          99.8    5e-23   Calycanthus floridus [Carolina-allspice]
ref|YP_004849337.1|  NADH dehydrogenase subunit 2                       102   1e-22   Cucumis sativus [cucumbers]
ref|YP_002608350.1|  NADH dehydrogenase subunit 2                       102   1e-22   Vitis vinifera
ref|YP_003587345.1|  NADH dehydrogenase subunit 2                       102   2e-22   Cucurbita pepo
gb|AHX81378.1|  NADH dehydrogenase subunit 2                            100   2e-22   Hirtella racemosa
gb|AJM70215.1|  NADH dehydrogenase subunit 2                            100   2e-22   Nicotiana tabacum/Hyoscyamus niger cybrid
ref|YP_005090405.1|  nad2 gene product                                  100   4e-22   Dorcoceras hygrometricum
ref|YP_009049686.1|  NADH dehydrogenase subunit 2                       100   5e-22   Capsicum annuum
ref|YP_173350.1|  NADH dehydrogenase subunit 2                          100   5e-22   Nicotiana tabacum [American tobacco]
dbj|BAO50900.1|  NADH dehydrogenase subunit 2                           100   6e-22   Hevea brasiliensis [jebe]
emb|CAJ70645.1|  NADH dehydrogenase subunit 2                         99.0    6e-22   Helianthus annuus
ref|YP_004237258.1|  NADH dehydrogenase subunit 2                       100   6e-22   Ricinus communis
ref|YP_002608182.2|  NADH dehydrogenase subunit 2                       100   6e-22   Carica papaya [mamon]
gb|AEN56103.1|  NADH dehydrogenase subunit 2                            100   6e-22   Cucumis melo subsp. melo
ref|YP_006666123.1|  NADH dehydrogenase subunit 2                       100   7e-22   Malus domestica [apple tree]
ref|YP_009045710.1|  NADH dehydrogenase subunit 2                       100   7e-22   Batis maritima
sp|P93401.2|NU2M_OENBE  RecName: Full=NADH-ubiquinone oxidoreduct...    100   9e-22   Oenothera berteroana [Bertero's evening primrose]
ref|YP_004927565.1|  nad2                                               100   9e-22   Brassica carinata [Abyssinian mustard]
gb|ABS50624.1|  NADH dehydrogenase subunit 2                          99.8    9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_085584.1|  NADH dehydrogenase subunit 2                          100   9e-22   
ref|YP_004927490.1|  nad2                                               100   1e-21   Brassica oleracea
ref|NP_064064.2|  nad2 gene product                                     100   1e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|AEK01280.1|  nad2                                                    100   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|YP_006291809.1|  nad2 gene product                                  100   1e-21   Daucus carota subsp. sativus
ref|YP_003587227.1|  NADH dehydrogenase subunit 2                       100   1e-21   Citrullus lanatus [wild melon]
ref|YP_008802483.1|  NADH dehydrogenase subunit 2 (mitochondrion)     99.8    1e-21   Asclepias syriaca
emb|CBX33211.1|  NADH dehydrogenase subunit 2                         99.8    1e-21   Beta vulgaris subsp. maritima [sea beet]
gb|AEX98100.1|  NADH dehydrogenase subunit 2                          98.2    1e-21   Ferrocalamus rimosivaginus
ref|YP_008999580.1|  NADH dehydrogenase subunit 2                     99.8    1e-21   Vaccinium macrocarpon [American cranberry]
gb|AHC94293.1|  NADH dehydrogenase subunit 2                          99.4    1e-21   Amborella trichopoda
ref|YP_740397.1|  NADH dehydrogenase subunit 2                        99.4    2e-21   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABE98698.1|  NADH dehydrogenase subunit 2                          99.4    2e-21   Zea mays subsp. mays [corn]
ref|YP_588266.1|  NADH dehydrogenase subunit 2                        99.4    2e-21   Zea mays subsp. mays [corn]
ref|YP_008080914.1|  NADH dehydrogenase subunit 2                     99.4    2e-21   Butomus umbellatus [flowering-rush]
gb|AHA47117.1|  NADH dehydrogenase subunit 2                          99.0    2e-21   Amborella trichopoda
gb|AGI48793.1|  NADH dehydrogenase subunit 2                          99.0    3e-21   Lolium perenne [perennial ryegrass]
gb|ABY55185.1|  NADH dehydrogenase subunit 2                          99.0    3e-21   Bambusa oldhamii
ref|YP_008757352.1|  NADH dehydrogenase subunit 2                     98.6    3e-21   Aegilops speltoides
ref|YP_398391.1|  nad2                                                98.6    3e-21   
ref|YP_005090477.1|  NADH dehydrogenase subunit 2                     98.6    3e-21   Lotus japonicus
emb|CAA63783.1|  NADH dehydrogenase subunit II                        97.1    3e-21   Solanum tuberosum [potatoes]
ref|YP_005090433.1|  NADH dehydrogenase subunit 2                     98.6    3e-21   Millettia pinnata [karumtree]
ref|NP_054402.1|  NADH dehydrogenase subunit 2                        98.6    4e-21   Marchantia paleacea
emb|CAC50353.1|  NADH dehydrogenase subunit 2                         97.4    4e-21   Ricciocarpos natans
emb|CAC48197.1|  NADH dehydrogenase subunit 2                         97.4    4e-21   Sphaerocarpos donnellii
gb|AHF22684.1|  NADH dehydrogenase subunit 2                          98.6    4e-21   Fragaria iinumae
emb|CAC20910.1|  NADH dehydrogenase subunit 2                         97.4    4e-21   Sphagnum fallax
gb|ACZ34318.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Chamaebryum pottioides
emb|CAC19938.1|  NADH dehydrogenase subunit 2                         97.4    5e-21   Ceratodon purpureus
emb|CAC20859.1|  NADH dehydrogenase subunit 2                         97.4    5e-21   Racomitrium lanuginosum
gb|ABX25853.1|  NADH dehydrogenase subunit 2                          97.4    5e-21   Coscinodon cribrosus
emb|CAC21197.1|  NADH dehydrogenase subunit 2                         97.4    5e-21   Timmia megapolitana subsp. bavarica
gb|ABX25854.1|  NADH dehydrogenase subunit 2                          97.4    5e-21   Grimmia donniana
emb|CAC50255.1|  NADH dehydrogenase subunit 2                         97.4    5e-21   Corsinia coriandrina
emb|CAC19874.1|  NADH dehydrogenase subunit 2                         97.4    5e-21   Bartramia halleriana
gb|ACZ34319.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Gigaspermum repens
emb|CAC20246.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Hedwigia ciliata
gb|AAW63668.1|  NADH dehydrogenase subunit 2                          93.2    5e-21   Nymphaea sp. Bergthorsson 0401
gb|ABX25851.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Physcomitrium pyriforme
emb|CAC20735.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Orthodontium lineare
emb|CAC20380.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Hygrohypnum ochraceum
emb|CAC20163.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Fissidens cristatus
emb|CAC20902.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Rhacocarpus purpurascens
gb|ACZ34320.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Oedipodiella australis
gb|ACZ34316.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Timmia austriaca
gb|ABX25856.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Timmiella sp. VKLBN991028
emb|CAC19940.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Cinclidotus riparius
emb|CAC20597.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Isothecium alopecurum
gb|ABX25848.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Dawsonia sp. VKL981115
emb|CAC21233.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Ulota crispa
emb|CAC20849.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Pogonatum urnigerum
emb|CAC21201.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Syntrichia latifolia
emb|CAC20605.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Leucobryum glaucum
emb|CAC20107.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Dichodontium pellucidum
emb|CAC21215.1|  NADH dehydrogenase subunit 2                         97.1    5e-21   Tetraphis pellucida
gb|ABX25857.1|  NADH dehydrogenase subunit 2                          97.1    5e-21   Splachnum ampullaceum
gb|ABX25852.1|  NADH dehydrogenase subunit 2                          97.1    6e-21   Discelium nudum
emb|CAC20934.1|  NADH dehydrogenase subunit 2                         97.1    6e-21   Schistostega pennata
emb|CAC21176.1|  NADH dehydrogenase subunit 2                         97.1    6e-21   Herzogiella seligeri
ref|YP_009047587.1|  NADH dehydrogenase subunit 2                     97.8    6e-21   Sphagnum palustre
emb|CAC20025.1|  NADH dehydrogenase subunit 2                         97.1    6e-21   Trichodon cylindricus
emb|CAC21171.1|  NADH dehydrogenase subunit 2                         97.1    6e-21   Scorpidium scorpioides
gb|AAW63666.1|  NADH dehydrogenase subunit 2                          93.2    6e-21   Eschscholzia californica
emb|CAC20793.1|  NADH dehydrogenase subunit 2                         97.1    6e-21   Physcomitrella patens
gb|AHI16173.1|  NADH dehydrogenase subunit 2                          97.8    6e-21   Bryum argenteum
ref|YP_009040979.1|  NADH dehydrogenase subunit 2 (mitochondrion)     97.8    6e-21   Tetraphis pellucida
ref|YP_009047507.1|  NADH dehydrogenase subunit 2                     97.8    6e-21   Bartramia pomiformis
emb|CAC20216.1|  NADH dehydrogenase subunit 2                         97.1    6e-21   Funaria hygrometrica
gb|AEB39977.1|  NADH dehydrogenase subunit 2                          97.8    6e-21   Funaria hygrometrica
ref|YP_009047667.1|  NADH dehydrogenase subunit 2                     97.8    6e-21   Funaria hygrometrica
ref|YP_009112126.1|  NADH dehydrogenase subunit 2                     97.8    7e-21   Dilutineuron laevigatum
emb|CAC20162.1|  NADH dehydrogenase subunit 2                         97.1    7e-21   Fontinalis antipyretica
ref|YP_539019.1|  NADH dehydrogenase subunit 2                        97.8    7e-21   Physcomitrella patens
ref|YP_009047388.1|  NADH dehydrogenase subunit 2                     97.8    7e-21   Callicladium imponens
gb|AHI16185.1|  NADH dehydrogenase subunit 2                          97.8    7e-21   Tetraplodon fuegianus
ref|YP_009047428.1|  NADH dehydrogenase subunit 2                     97.8    7e-21   Ulota hutchinsiae
gb|AJJ48453.1|  NADH dehydrogenase subunit 2                          97.8    7e-21   Niphotrichum ericoides
ref|YP_009047348.1|  NADH dehydrogenase subunit 2                     97.8    7e-21   Climacium americanum
ref|YP_003275956.1|  NADH dehydrogenase subunit 2                     97.4    8e-21   Pleurozia purpurea
ref|YP_009047308.1|  NADH dehydrogenase subunit 2                     97.4    8e-21   Ptychomnion cygnisetum
ref|YP_004927653.1|  NADH dehydrogenase subunit 2                     96.3    8e-21   Treubia lacunosa
ref|YP_004927624.1|  NADH dehydrogenase subunit 2                     97.4    8e-21   Anomodon rugelii
ref|YP_717099.1|  NADH dehydrogenase subunit 2                        97.4    8e-21   Brassica napus [oilseed rape]
gb|ADG85358.1|  NADH dehydrogenase subunit 2                          97.4    9e-21   Silene latifolia
ref|YP_003875489.1|  NADH dehydrogenase subunit 2                     97.4    9e-21   Silene latifolia
dbj|BAD83439.2|  NADH dehydrogenase subunit 2                         97.4    9e-21   Nicotiana tabacum [American tobacco]
ref|YP_009041151.1|  NADH dehydrogenase subunit 2                     97.4    1e-20   Rhazya stricta
sp|O05000.2|NU2M_ARATH  RecName: Full=NADH-ubiquinone oxidoreduct...  97.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD66742.1|  NADH dehydrogenase subunit 2                         97.1    1e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|AFI44275.1|  NADH dehydrogenase subunit 2                          97.1    1e-20   Silene vulgaris [maiden's-tears]
gb|AAW63671.1|  NADH dehydrogenase subunit 2                          93.6    1e-20   Piper betle
ref|YP_004935348.1|  NADH dehydrogenase subunit 2                     97.1    1e-20   
emb|CAC19821.1|  NADH dehydrogenase subunit 2                         96.3    1e-20   Aulacomnium androgynum
pir||A42491  NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain ...  97.1    1e-20
gb|AGK25062.1|  NADH dehydrogenase subunit 2                          93.6    1e-20   Magnolia stellata [shide-kobushi]
gb|ABX25849.1|  NADH dehydrogenase subunit 2                          95.9    1e-20   Oligotrichum hercynicum
gb|AAW63665.1|  NADH dehydrogenase subunit 2                          91.7    2e-20   Agave attenuata
gb|AHI16181.1|  NADH dehydrogenase subunit 2                          96.7    2e-20   Scapania nemorea
gb|AAW63669.1|  NADH dehydrogenase subunit 2                          92.8    2e-20   Lonicera sp. Bergthorsson 0301
emb|CAC48183.1|  NADH dehydrogenase subunit 2                         95.5    2e-20   Fossombronia pusilla
emb|CAA74779.1|  NADH dehydrogenase subunit 2                         96.3    3e-20   Triticum aestivum [Canadian hard winter wheat]
emb|CAC50352.1|  NADH dehydrogenase subunit 2                         95.1    3e-20   Pellia epiphylla
emb|CAC19837.1|  NADH dehydrogenase subunit 2                         95.1    3e-20   Andreaea nivalis
emb|CAC20737.1|  NADH dehydrogenase subunit 2                         95.1    3e-20   Orthodicranum montanum
gb|AGL75392.1|  NADH dehydrogenase subunit 2                          95.9    3e-20   Utricularia gibba [humped bladderwort]
ref|YP_514681.1|  NADH dehydrogenase subunit 2                        95.9    4e-20   Oryza sativa Indica Group [Indian rice]
ref|YP_007905691.1|  NADH dehydrogenase subunit 2                     95.5    4e-20   Liriodendron tulipifera
gb|AHI16176.1|  NADH dehydrogenase subunit 2                          95.5    4e-20   Dicranum scoparium
ref|YP_007516850.1|  NADH dehydrogenase subunit 2                     95.5    5e-20   Glycine max [soybeans]
ref|YP_004222802.1|  NADH dehydrogenase subunit 2                     95.5    5e-20   Vigna radiata [mung bean]
ref|YP_008816026.1|  NADH dehydrogenase subunit 2                     95.9    5e-20   Closterium baillyanum
gb|AGC78841.1|  NADH dehydrogenase subunit 2                          95.5    5e-20   Vicia faba [broad bean]
emb|CAC20844.1|  NADH dehydrogenase subunit 2                         94.4    5e-20   Pottia truncata
emb|CAC19870.1|  NADH dehydrogenase subunit 2                         94.0    7e-20   Buxbaumia aphylla
emb|CAC20587.1|  NADH dehydrogenase subunit 2                         94.0    7e-20   Homalia trichomanoides
ref|YP_009047468.1|  NADH dehydrogenase subunit 2                     94.7    8e-20   Buxbaumia aphylla
ref|NP_943686.1|  NADH dehydrogenase subunit 2                        94.4    1e-19   Chara vulgaris
ref|YP_006073022.1|  nad2 gene product                                94.4    1e-19   Nitella hyalina
gb|AHI16172.1|  NADH dehydrogenase subunit 2                          93.6    2e-19   Bazzania trilobata
gb|AAW63667.1|  NADH dehydrogenase subunit 2                          89.0    2e-19   Platanus occidentalis [American sycamore]
gb|AAW63664.1|  NADH dehydrogenase subunit 2                          89.0    3e-19   Liriodendron tulipifera
gb|AHI16168.1|  NADH dehydrogenase subunit 2                          93.2    3e-19   Andreaea rothii
emb|CAC20152.1|  NADH dehydrogenase subunit 2                         92.0    4e-19   Encalypta streptocarpa
emb|CAC19868.1|  NADH dehydrogenase subunit 2                         92.0    4e-19   Atrichum undulatum
ref|YP_009047547.1|  NADH dehydrogenase subunit 2                     92.4    5e-19   Atrichum angustatum
emb|CAC50351.1|  NADH dehydrogenase subunit 2                         91.7    6e-19   Plagiochila asplenioides
gb|AAW63670.1|  NADH dehydrogenase subunit 2                          86.7    2e-18   Amborella trichopoda
ref|YP_006234244.1|  nad2 gene product                                90.9    2e-18   Phlegmariurus squarrosus
ref|YP_004935316.1|  NADH dehydrogenase subunit 2                     90.5    3e-18   
ref|YP_006460152.1|  NADH dehydrogenase subunit 2 (mitochondrion)     90.5    3e-18   Erythranthe guttata [common monkey flower]
emb|CAC20113.1|  NADH dehydrogenase subunit 2                         89.7    3e-18   Diphyscium sessile
gb|ADT62143.1|  NADH dehydrogenase subunit 2                          90.1    3e-18   Isoetes engelmannii
ref|YP_008964105.1|  NADH dehydrogenase subunit 2 (mitochondrion)     90.1    3e-18   Ajuga reptans
ref|YP_004935280.1|  NADH dehydrogenase subunit 2                     90.1    4e-18   
gb|ADG85359.1|  NADH dehydrogenase subunit 2                          89.0    9e-18   Silene noctiflora [sticky cockle]
ref|YP_008816105.1|  NADH dehydrogenase subunit 2                     88.6    1e-17   Microspora stagnorum
ref|YP_009120841.1|  NADH dehydrogenase subunit 2                     88.2    2e-17   
ref|XP_002534064.1|  NADH dehydrogenase, putative                     82.4    2e-17   
ref|YP_002860279.1|  NADH dehydrogenase subunit 2                     87.4    3e-17   Nothoceros aenigmaticus
emb|CAC21203.1|  NADH dehydrogenase subunit 2                         86.7    4e-17   Takakia lepidozioides
emb|CAC48190.1|  NADH dehydrogenase subunit 2                         85.9    8e-17   Spinulum annotinum
gb|ABC67258.1|  NADH dehydrogenase subunit 2                          79.3    2e-16   Huperzia selago
emb|CAC50074.1|  NADH dehydrogenase subunit 2                         84.0    3e-16   Haplomitrium mnioides
ref|YP_003412119.1|  NADH dehydrogenase subunit 2                     84.3    5e-16   Phaeoceros laevis
emb|CAC50078.1|  NADH dehydrogenase subunit 2                         83.6    5e-16   Phaeoceros laevis
gb|ADG85361.1|  NADH dehydrogenase subunit 2                          80.5    6e-16   Silene paradoxa
ref|YP_008816070.1|  NADH dehydrogenase subunit 2                     84.3    6e-16   Entransia fimbriata
ref|XP_006380080.1|  hypothetical protein POPTR_0008s21700g           77.8    2e-15   
gb|AEA11188.1|  NADH dehydrogenase subunit 2                          82.0    3e-15   Selaginella moellendorffii
ref|NP_689374.1|  NADH dehydrogenase subunit 2                        80.9    6e-15   Chaetosphaeridium globosum
ref|YP_008816165.1|  NADH dehydrogenase subunit 2                     80.5    1e-14   Roya obtusa
gb|AAW63672.1|  NADH dehydrogenase subunit 2                          75.1    2e-14   Zamia integrifolia
gb|ABC67256.1|  NADH dehydrogenase subunit 2                          70.5    4e-13   Asplenium scolopendrium
gb|ADG85360.1|  NADH dehydrogenase subunit 2                          71.6    1e-12   Silene conica
ref|YP_001661394.1|  NADH dehydrogenase subunit 2                     73.6    3e-12   Cycas taitungensis
gb|AGZ19396.1|  NADH dehydrogenase subunit 2 (mitochondrion)          72.4    7e-12   Chlorella sp. ArM0029B
emb|CAC50070.1|  NADH dehydrogenase subunit 2                         71.6    8e-12   Anthoceros agrestis
ref|YP_002860127.1|  NADH dehydrogenase subunit 2                     71.6    1e-11   Micromonas commoda
ref|WP_028836600.1|  hypothetical protein                             70.9    2e-11   
ref|YP_009094924.1|  NADH dehydrogenase subunit 2                     70.1    4e-11   Chlorella variabilis
gb|ABC67255.1|  NADH dehydrogenase subunit 2                          64.7    6e-11   Isoetes velata
ref|YP_009112909.1|  NADH dehydrogenasesubunit 2                      67.8    2e-10   Auxenochlorella protothecoides
ref|YP_009049990.1|  NADH dehydrogenase subunit 2                     67.8    2e-10   Chlorella sorokiniana
gb|AIM56874.1|  NADH dehydrogenase subunit 2                          67.0    3e-10   Chlorella sorokiniana
ref|YP_008994797.2|  NADH dehydrogenase subunit 2                     67.4    3e-10   Bathycoccus prasinos
emb|CCO13931.1|  NADH dehydrogenase subunit 2 (Partial)               67.4    3e-10   Bathycoccus prasinos
ref|WP_038367685.1|  NADH:ubiquinone oxidoreductase subunit N         66.2    7e-10   Bosea sp. UNC402CLCol
gb|ABX82544.1|  NADH dehydrogenase subunit 2                          65.9    1e-09   Trebouxia aggregata
emb|CAC50076.1|  NADH dehydrogenase subunit 2                         64.7    2e-09   Isoetes duriei
gb|ACI02101.1|  NADH dehydrogenase subunit 2                          64.7    2e-09   Isoetes engelmannii
ref|XP_003616255.1|  NADH-ubiquinone oxidoreductase chain             61.2    2e-09   
gb|ACI95887.1|  NADH dehydrogenase subunit 2                          64.7    2e-09   Isoetes engelmannii
ref|WP_028837851.1|  hypothetical protein                             64.7    3e-09   
ref|YP_006280965.1|  nad2 gene product                                64.7    3e-09   Helicosporidium sp. ex Simulium jonesi
ref|YP_665650.1|  NADH dehydrogenase subunit 2                        64.3    4e-09   Nephroselmis olivacea
ref|WP_026987514.1|  NADH-quinone oxidoreductase subunit N            63.9    4e-09   Fodinicurvata fenggangensis
ref|WP_022728999.1|  NADH:ubiquinone oxidoreductase subunit N         63.9    4e-09   Fodinicurvata sediminis
ref|NP_042274.1|  NADH dehydrogenase (ubiquinone), subunit 2          63.9    5e-09   Prototheca wickerhamii
ref|WP_018391209.1|  NADH:ubiquinone oxidoreductase subunit N         63.2    8e-09   Ancylobacter sp. FA202
emb|CBK23821.2|  unnamed protein product                              63.2    9e-09   Blastocystis hominis
ref|WP_043831494.1|  NADH-quinone oxidoreductase subunit N            62.4    1e-08   Roseomonas aerilata
ref|WP_027841396.1|  NADH:ubiquinone oxidoreductase subunit N         62.4    1e-08   
ref|WP_012974700.1|  NADH:ubiquinone oxidoreductase subunit N         62.4    1e-08   Azospirillum lipoferum
ref|WP_020178860.1|  hypothetical protein                             62.0    2e-08   Methylopila sp. M107
ref|XP_003637898.1|  NADH-ubiquinone oxidoreductase chain             57.8    2e-08   
ref|WP_038279122.1|  NADH:ubiquinone oxidoreductase subunit N         62.0    2e-08   
ref|YP_717298.1|  nad2                                                62.0    2e-08   Ostreococcus tauri
gb|AGR42885.1|  NADH dehydrogenase subunit 2                          62.0    2e-08   Ostreococcus tauri
gb|AGR42713.1|  NADH dehydrogenase subunit 2                          62.0    2e-08   Ostreococcus tauri
ref|YP_665693.1|  NADH dehydrogenase subunit 2                        61.6    2e-08   Mesostigma viride
ref|WP_037263396.1|  hypothetical protein                             61.6    2e-08   Rhodospirillales bacterium URHD0088
dbj|GAK44556.1|  proton-translocating NADH-quinone oxidoreductase...  61.6    3e-08   Tepidicaulis marinus
dbj|GAN48061.1|  proton-translocating NADH-quinone oxidoreductase...  61.6    3e-08   Methylobacterium sp. ME121
ref|WP_018038576.1|  hypothetical protein                             61.6    3e-08   
ref|WP_024575301.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  61.6    3e-08   Afipia
ref|YP_001315136.1|  NADH dehydrogenase subunit 2                     61.6    3e-08   Chlorokybus atmophyticus
ref|WP_013166657.1|  NADH:ubiquinone oxidoreductase subunit N         61.2    3e-08   Starkeya novella
gb|KCW68351.1|  hypothetical protein EUGRSUZ_F02010                   58.5    3e-08   Eucalyptus grandis [rose gum]
ref|WP_011158486.1|  NADH:ubiquinone oxidoreductase subunit N         61.2    4e-08   Rhodopseudomonas palustris
ref|WP_011472866.1|  NADH:ubiquinone oxidoreductase subunit N         61.2    4e-08   Rhodopseudomonas palustris
ref|WP_024830240.1|  NADH:ubiquinone oxidoreductase subunit N         61.2    4e-08   
ref|WP_012496372.1|  NADH:ubiquinone oxidoreductase subunit N         61.2    4e-08   Rhodopseudomonas palustris
ref|YP_009121387.1|  NADH dehydrogenase subunit 2                     61.2    4e-08   Thecamonas trahens
ref|XP_006826187.1|  hypothetical protein AMTR_s04080p00001290        57.4    4e-08   
ref|WP_029005221.1|  NADH:ubiquinone oxidoreductase subunit N         61.2    4e-08   Azorhizobium doebereinerae
ref|WP_010686005.1|  proton-translocating NADH-quinone oxidoreduc...  61.2    4e-08   Methylobacterium mesophilicum
ref|WP_020092244.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  60.8    4e-08   Methylobacterium
ref|WP_008836431.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    4e-08   
ref|WP_012319025.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  60.8    4e-08   Methylobacterium
ref|WP_002728374.1|  NADH:ubiquinone oxidoreductase subunit N         60.8    5e-08   Phaeospirillum molischianum
ref|WP_029355804.1|  NADH:ubiquinone oxidoreductase subunit N         60.8    5e-08   Bosea sp. 117
ref|WP_012334134.1|  NADH:ubiquinone oxidoreductase subunit N         60.8    5e-08   Methylobacterium sp. 4-46
ref|WP_018259834.1|  NADH:ubiquinone oxidoreductase subunit N         60.8    6e-08   Methylobacterium sp. WSM2598
gb|ADU04592.1|  NADH dehydrogenase subunit 2                          60.8    6e-08   Mesostigma viride
ref|WP_027289094.1|  NADH-quinone oxidoreductase subunit N            60.1    8e-08   Rhodovibrio salinarum
ref|WP_007560733.1|  NADH:ubiquinone oxidoreductase subunit N         60.1    8e-08   Methylobacterium
ref|WP_018687658.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  60.1    8e-08   Ahrensia
ref|WP_020185817.1|  hypothetical protein                             60.1    8e-08   Methylopila sp. 73B
ref|WP_043236784.1|  NADH:ubiquinone oxidoreductase subunit N         60.1    9e-08   Bosea sp. LC85
ref|WP_042693489.1|  NADH-quinone oxidoreductase subunit N            59.3    9e-08   Azospirillum sp. B506
ref|WP_008386063.1|  NADH:ubiquinone oxidoreductase subunit N         60.1    1e-07   Rhodovulum sp. PH10
ref|WP_002715635.1|  proton-translocating NADH-quinone oxidoreduc...  59.7    1e-07   Afipia felis
ref|WP_008876516.1|  NADH:ubiquinone oxidoreductase, membrane sub...  59.7    1e-07   Mesorhizobium metallidurans
ref|WP_006203234.1|  NADH:ubiquinone oxidoreductase subunit N         59.7    1e-07   Mesorhizobium amorphae
ref|WP_021776292.1|  Acyl-acyl-carrier-protein--UDP-N-acetylgluco...  59.7    1e-07   Candidatus Micropelagos thuwalensis
ref|YP_002221402.1|  NADH dehydrogenase subunit 2                     59.7    1e-07   Blastocystis sp. ATCC 50177/Nand II
gb|ACD10933.1|  NADH dehydrogenase subunit 2                          59.3    1e-07   Blastocystis sp. ATCC 50177/Nand II
ref|WP_011663952.1|  NADH:ubiquinone oxidoreductase subunit N         59.3    1e-07   Rhodopseudomonas palustris
ref|WP_037016471.1|  NADH:ubiquinone oxidoreductase subunit N         59.3    2e-07   Rhizobiales bacterium YIM 77505
ref|WP_043354226.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  59.3    2e-07   Methylobacterium
gb|EJW22221.1|  NADH dehydrogenase subunit N                          59.3    2e-07   
ref|WP_038299357.1|  NADH:ubiquinone oxidoreductase subunit N         59.3    2e-07   
ref|WP_011503277.1|  NADH:ubiquinone oxidoreductase subunit N         59.3    2e-07   
ref|WP_009868521.1|  COG1007: NADH:ubiquinone oxidoreductase subu...  59.3    2e-07   
dbj|GAK71117.1|  NADH-quinone oxidoreductase subunit N                58.9    2e-07   
ref|WP_015930666.1|  NADH:ubiquinone oxidoreductase subunit N         58.9    2e-07   
gb|EMD84280.1|  NADH-ubiquinone oxidoreductase chain N                58.9    2e-07   
ref|WP_040879282.1|  NADH:ubiquinone oxidoreductase subunit N         58.9    2e-07   
ref|WP_038281188.1|  NADH-quinone oxidoreductase subunit N            58.9    2e-07   
ref|WP_027277460.1|  NADH:ubiquinone oxidoreductase subunit N         58.9    2e-07   
ref|WP_036351490.1|  NADH:ubiquinone oxidoreductase subunit N         58.9    2e-07   
ref|WP_023676617.1|  NADH:ubiquinone oxidoreductase subunit N         58.9    2e-07   
ref|WP_012116590.1|  NADH:ubiquinone oxidoreductase subunit N         58.9    2e-07   
ref|WP_014248406.1|  NADH:ubiquinone oxidoreductase subunit N         58.9    2e-07   
ref|WP_009340773.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    2e-07   
ref|WP_011441475.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    3e-07   
ref|WP_035829758.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    3e-07   
gb|AEX98186.1|  NADH dehydrogenase subunit 2                          58.5    3e-07   
gb|AEX98132.1|  NADH dehydrogenase subunit 2                          58.5    3e-07   
ref|WP_012563084.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    3e-07   
ref|WP_019906847.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    3e-07   
ref|WP_011385153.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    3e-07   
ref|YP_006460209.1|  NADH dehydrogenase subunit 2                     58.5    3e-07   
ref|WP_018428447.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    3e-07   
ref|WP_022719585.1|  NADH:ubiquinone oxidoreductase subunit N         58.5    3e-07   
ref|WP_029008465.1|  NADH-quinone oxidoreductase subunit N            58.2    3e-07   
ref|WP_042619652.1|  NADH:ubiquinone oxidoreductase subunit N         58.2    4e-07   
ref|WP_027145285.1|  NADH:ubiquinone oxidoreductase subunit N         58.2    4e-07   
ref|WP_027156079.1|  NADH:ubiquinone oxidoreductase subunit N         58.2    4e-07   
ref|WP_023757145.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_014240133.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_027051256.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_015317351.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_023798866.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_006335666.1|  NADH:ubiquinone oxidoreductase, membrane sub...  57.8    5e-07   
ref|WP_009491129.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_023763320.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_010910098.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_013894822.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_023769787.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.8    5e-07   
ref|WP_023779182.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_038647488.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_027025983.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_019858927.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_027034802.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_031233856.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    5e-07   
ref|WP_029352043.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
gb|EPR21096.1|  NADH:ubiquinone oxidoreductase subunit N              57.4    5e-07   
ref|WP_013531102.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.8    5e-07   
ref|WP_029584480.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_023720737.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    5e-07   
ref|WP_013635954.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    6e-07   
ref|WP_024079555.1|  NADH-quinone oxidoreductase subunit N            57.8    6e-07   
ref|WP_013215889.1|  NADH:ubiquinone oxidoreductase subunit N         57.8    6e-07   
gb|KJF74760.1|  NADH:ubiquinone oxidoreductase subunit N              57.4    6e-07   
ref|XP_005966781.1|  PREDICTED: NADH-ubiquinone oxidoreductase ch...  57.4    6e-07   
ref|WP_003512691.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    6e-07   
ref|WP_003496438.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    6e-07   
ref|WP_041797570.1|  NADH-quinone oxidoreductase subunit N            57.4    6e-07   
ref|WP_041007639.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    6e-07   
ref|WP_027170849.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
emb|CCG09333.1|  Proton-translocating NADH-quinone oxidoreductase...  57.4    7e-07   
ref|WP_018042029.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_024847589.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_020012334.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    7e-07   
ref|WP_041011893.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_022556035.1|  MULTISPECIES: NADH-quinone oxidoreductase ch...  57.4    7e-07   
gb|KJF68755.1|  NADH:ubiquinone oxidoreductase subunit N              57.4    7e-07   
ref|WP_006697996.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_004441335.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    7e-07   
ref|WP_042643150.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_036814804.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_012631854.1|  NADH-quinone oxidoreductase subunit N            57.4    7e-07   
ref|WP_012524518.1|  NADH-quinone oxidoreductase subunit N            57.4    7e-07   
ref|WP_011419474.1|  NADH-quinone oxidoreductase subunit N            57.4    7e-07   
ref|WP_037089246.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_027029557.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_027058099.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_029015958.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_021133686.1|  NADH dehydrogenase subunit N                     57.4    7e-07   
ref|WP_040982016.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_029167778.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    7e-07   
ref|WP_023735915.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    8e-07   
ref|WP_035218873.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    8e-07   
ref|WP_010971515.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    8e-07   
ref|WP_040999141.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    8e-07   
ref|WP_027168989.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    8e-07   
ref|WP_023830508.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    8e-07   
ref|WP_023685205.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    8e-07   
ref|WP_003521512.1|  NADH:ubiquinone oxidoreductase subunit N         57.4    8e-07   
ref|WP_028794894.1|  NADH-quinone oxidoreductase subunit N            57.4    8e-07   
ref|WP_023690960.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    8e-07   
ref|WP_023753472.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    8e-07   
ref|WP_023731229.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    8e-07   
ref|WP_023706136.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.4    8e-07   
ref|WP_023829416.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_023827337.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_023700373.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
emb|CCQ73864.1|  NADH-quinone oxidoreductase chain N (NADH dehydr...  57.4    8e-07   
ref|WP_023751641.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_023741632.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  57.0    8e-07   
ref|WP_023690301.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_003502395.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_027044905.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_023822173.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_023670807.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_023727691.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    8e-07   
ref|WP_035673025.1|  NADH-quinone oxidoreductase subunit N            57.0    8e-07   
ref|WP_029558854.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    9e-07   
ref|WP_024278578.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    9e-07   
ref|WP_018698213.1|  hypothetical protein                             57.0    9e-07   
ref|WP_006312701.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    9e-07   
ref|WP_040969936.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    9e-07   
ref|WP_025899016.1|  hypothetical protein                             57.0    9e-07   
ref|YP_004339029.1|  NADH dehydrogenase subunit 2                     57.0    1e-06   
ref|WP_035899255.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    1e-06   
ref|WP_008617464.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    1e-06   
ref|WP_027672986.1|  NADH:ubiquinone oxidoreductase subunit N         57.0    1e-06   
emb|CAM77663.1|  NADH dehydrogenase subunit 2                         57.0    1e-06   
ref|WP_015597495.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_028000084.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_033368836.1|  NADH-quinone oxidoreductase subunit N            56.6    1e-06   
gb|KEO53647.1|  NADH:ubiquinone oxidoreductase subunit N              56.6    1e-06   
ref|WP_024924581.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  56.6    1e-06   
ref|WP_008125229.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_040059846.1|  NADH-quinone oxidoreductase subunit N            56.6    1e-06   
ref|WP_019196909.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_037991310.1|  NADH-quinone oxidoreductase subunit N            56.6    1e-06   
ref|WP_023815528.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_044416581.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_023823105.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_023698335.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_019643607.1|  hypothetical protein                             56.6    1e-06   
gb|AJD52230.1|  NADH:ubiquinone oxidoreductase subunit N              56.6    1e-06   
ref|WP_012483441.1|  NADH:ubiquinone oxidoreductase subunit N         56.6    1e-06   
ref|WP_026790171.1|  NADH:ubiquinone oxidoreductase subunit N         56.2    1e-06   
ref|WP_022711731.1|  NADH:ubiquinone oxidoreductase subunit N         56.2    1e-06   
ref|WP_009450012.1|  NADH:ubiquinone oxidoreductase subunit N         56.2    2e-06   
ref|WP_020593667.1|  hypothetical protein                             56.2    2e-06   
ref|WP_029205500.1|  NADH:ubiquinone oxidoreductase subunit N         56.2    2e-06   
ref|WP_029206189.1|  NADH:ubiquinone oxidoreductase subunit N         56.2    2e-06   
ref|WP_017943460.1|  hypothetical protein                             56.2    2e-06   
ref|WP_043948896.1|  NADH:ubiquinone oxidoreductase subunit N         56.2    2e-06   
ref|WP_037177521.1|  NADH:ubiquinone oxidoreductase subunit N         56.2    2e-06   
ref|WP_017971226.1|  hypothetical protein                             55.8    2e-06   
ref|WP_019014334.1|  hypothetical protein                             55.8    2e-06   
ref|WP_017269065.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_019460040.1|  MULTISPECIES: hypothetical protein               55.8    2e-06   
ref|WP_017274263.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_013502279.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_017970635.1|  hypothetical protein                             55.8    2e-06   
ref|WP_038604848.1|  hypothetical protein                             55.8    2e-06   
ref|WP_041536844.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_017263155.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_042708936.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_014526682.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_017273336.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
sp|A7HY36.1|NUON_PARL1  RecName: Full=NADH-quinone oxidoreductase...  55.8    2e-06   
ref|WP_010969150.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_003531859.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.8    2e-06   
ref|WP_037224861.1|  NADH-quinone oxidoreductase subunit N            55.8    2e-06   
gb|AIL65957.1|  NADH-quinone oxidoreductase subunit N                 55.8    2e-06   
ref|WP_029057155.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_013948501.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.8    2e-06   
ref|WP_008891219.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    2e-06   
ref|WP_024585829.1|  NADH:ubiquinone oxidoreductase subunit N         55.8    3e-06   
ref|WP_006190097.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.8    3e-06   
ref|WP_004690760.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.8    3e-06   
ref|WP_004688239.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.8    3e-06   
ref|WP_023512041.1|  NADH-quinone oxidoreductase subunit N 1          55.8    3e-06   
ref|WP_011975095.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.8    3e-06   
ref|WP_019443318.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_006072563.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_006165376.1|  proton-translocating NADH-quinone oxidoreduc...  55.5    3e-06   
gb|AEW13302.1|  proton-translocating NADH-quinone oxidoreductase      55.5    3e-06   
ref|WP_029564061.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_032450304.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_023598743.1|  NADH dehydrogenase subunit N                     55.5    3e-06   
ref|WP_004686482.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_006256141.1|  proton-translocating NADH-quinone oxidoreduc...  55.5    3e-06   
ref|WP_006152460.1|  proton-translocating NADH-quinone oxidoreduc...  55.5    3e-06   
gb|AIB17550.1|  NADH-ubiquinone oxidoreductase chain N                55.5    3e-06   
ref|WP_002963950.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.5    3e-06   
ref|WP_004683623.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  55.5    3e-06   
gb|ADZ65903.1|  NADH dehydrogenase subunit N                          55.5    3e-06   
ref|WP_006257261.1|  proton-translocating NADH-quinone oxidoreduc...  55.5    3e-06   
ref|WP_033069807.1|  NADH-quinone oxidoreductase subunit N            55.5    3e-06   
ref|WP_009462965.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
gb|AEW18033.1|  proton-translocating NADH-quinone oxidoreductase      55.5    3e-06   
ref|WP_006020754.1|  MULTISPECIES: proton-translocating NADH-quin...  55.5    3e-06   
ref|WP_037107785.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_008521848.1|  NADH:ubiquinone oxidoreductase subunit N         53.5    3e-06   
gb|AGE93626.1|  NADH dehydrogenase subunit 2                          55.5    3e-06   
dbj|BAQ44032.1|  NADH:ubiquinone oxidoreductase subunit N             55.5    3e-06   
ref|WP_037212610.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_037169343.1|  NADH:ubiquinone oxidoreductase subunit N         55.5    3e-06   
ref|WP_044826782.1|  NADH-quinone oxidoreductase subunit N            55.1    3e-06   
ref|WP_018011486.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    3e-06   
ref|WP_020696092.1|  hypothetical protein                             55.1    3e-06   
ref|WP_028880110.1|  NADH-quinone oxidoreductase subunit N            55.1    4e-06   
ref|WP_009540287.1|  NADH-ubiquinone oxidoreductase chain N           55.1    4e-06   
ref|WP_022735477.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    4e-06   
ref|WP_027316568.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    4e-06   
ref|WP_037121888.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    4e-06   
ref|WP_037150169.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    4e-06   
ref|WP_007197625.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    4e-06   
ref|WP_026619319.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    4e-06   
ref|WP_026612506.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    4e-06   
ref|WP_020085103.1|  hypothetical protein                             55.1    5e-06   
ref|WP_009799870.1|  NADH:ubiquinone oxidoreductase subunit N         55.1    5e-06   
gb|EPS59417.1|  hypothetical protein M569_15383                       52.8    5e-06   
ref|WP_011315130.1|  NADH:ubiquinone oxidoreductase subunit N         54.7    5e-06   
ref|WP_028744848.1|  NADH:ubiquinone oxidoreductase subunit N         54.7    5e-06   
ref|WP_007531809.1|  NADH:ubiquinone oxidoreductase subunit N         54.7    5e-06   
ref|WP_037127346.1|  NADH:ubiquinone oxidoreductase subunit N         54.7    5e-06   
ref|WP_018857046.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...  54.7    5e-06   
ref|WP_038312395.1|  NADH:ubiquinone oxidoreductase subunit N         54.7    5e-06   
ref|WP_034932922.1|  NADH-quinone oxidoreductase subunit N            54.7    5e-06   
gb|EIC07755.1|  NADH/Ubiquinone/plastoquinone (complex I)             52.8    6e-06   
gb|AFL51876.1|  NADH-quinone oxidoreductase subunit N                 54.7    6e-06   
ref|WP_016553620.1|  NADH:ubiquinone oxidoreductase subunit N         54.7    6e-06   



>emb|CAN64512.1| hypothetical protein VITISV_004351 [Vitis vinifera]
Length=282

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 110/135 (81%), Gaps = 17/135 (13%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PR  
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPR--  198

Query  190  KFGGPKAVLRAPDT*LTKSVATRMGMHATKDRVESDTETVYSISLYESTITTRDEP*FGE  369
                           LT+SVATRMGMHATKDRVESDT TVYSISLYESTITTRDEP FGE
Sbjct  199  ---------------LTESVATRMGMHATKDRVESDTSTVYSISLYESTITTRDEPWFGE  243

Query  370  LKLALGVMTPSYSAR  414
            LKLALGV+    +AR
Sbjct  244  LKLALGVIGLPVTAR  258



>ref|XP_004153848.1| PREDICTED: LOW QUALITY PROTEIN: NADH-ubiquinone oxidoreductase 
chain 2-like, partial [Cucumis sativus]
Length=472

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 114/144 (79%), Gaps = 21/144 (15%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PRVS
Sbjct  234  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRVS  293

Query  190  KFGGPKAVLRAPDT*LTKSVATRMGMHATKDRVESDTETVYSISLYESTITTRDEP*FGE  369
             FG PKAVLRAPDT                  VESDT TVYSISLYESTITTRDEP FGE
Sbjct  294  LFGRPKAVLRAPDT------------------VESDTSTVYSISLYESTITTRDEPWFGE  335

Query  370  LKLAL--GVM-TPSYSARSYTEVL  432
            LKLA   GV  TPSY ARSYTEVL
Sbjct  336  LKLAPRSGVXRTPSYCARSYTEVL  359



>ref|XP_003588352.1| NADH dehydrogenase subunit [Medicago truncatula]
Length=1094

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 114/143 (80%), Gaps = 20/143 (14%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSY GIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG WAAGR PRVS
Sbjct  655  AITFSITMFSYVGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCWAAGRLPRVS  714

Query  190  KFGGPKAVLRAPDT*LTKSVATRMGMHATKDRVESDTETVYSISLYESTITTRDEP*FGE  369
            +FGGPKAVLRAPDT                  VES+T TVYSISLYESTITTRDEP FGE
Sbjct  715  QFGGPKAVLRAPDT------------------VESETSTVYSISLYESTITTRDEPWFGE  756

Query  370  LKLALGVM--TPSYSARSYTEVL  432
            LK ALGV   TPSY ARSYTEVL
Sbjct  757  LKFALGVKKRTPSYCARSYTEVL  779



>gb|KJB09778.1| hypothetical protein B456_001G164600 [Gossypium raimondii]
Length=494

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 101/135 (75%), Gaps = 25/135 (19%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG WAAGR P   
Sbjct  235  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCWAAGRLP---  291

Query  190  KFGGPKAVLRAPDT*LTKSVATRMGMHATKDRVESDTETVYSISLYESTITTRDEP*FGE  369
                                  RMGMHATKDRVESDT TVYSISL+ESTITTRDEP FGE
Sbjct  292  ----------------------RMGMHATKDRVESDTSTVYSISLFESTITTRDEPWFGE  329

Query  370  LKLALGVMTPSYSAR  414
            LKLALGV+    +AR
Sbjct  330  LKLALGVIGLPVTAR  344



>ref|NP_064003.1| orf300 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris]
 ref|YP_004222370.1| hypothetical protein BevumaM_p137 [Beta vulgaris subsp. maritima]
 ref|YP_004842175.1| hypothetical protein BemaM_p131 [Beta macrocarpa]
 dbj|BAA99315.1| orf300 [Beta vulgaris subsp. vulgaris]
 emb|CBJ14009.1| hypothetical protein [Beta vulgaris subsp. maritima]
 emb|CBJ17585.1| hypothetical protein [Beta vulgaris subsp. maritima]
 emb|CBJ20703.1| hypothetical protein [Beta vulgaris subsp. maritima]
 emb|CBX24980.1| hypothetical protein [Beta macrocarpa]
 emb|CBL54137.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima]
Length=300

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 101/135 (75%), Gaps = 13/135 (10%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG WAAGR PRVS
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCWAAGRLPRVS  200

Query  190  KFGGPK--AVLRAPDT*LTKSVAT--RMGMHATKDRVES---DTETVYSISLYESTITTR  348
            +FG  +  +V R      T+S+    R G      ++ S      +VYSISLYESTITTR
Sbjct  201  QFGDRRQFSVHR------TRSLPNQLRHGWECMLRKIGSSLIHQPSVYSISLYESTITTR  254

Query  349  DEP*FGELKLALGVM  393
            DEP FGE +LALGV+
Sbjct  255  DEPWFGEFELALGVI  269


 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 55/90 (61%), Gaps = 20/90 (22%)
 Frame = +2

Query  194  LGDRRQFSVHRTRSLPNQLRHGWECMLRKIGLSLIQKPSTQYPCTSPQSL----------  343
             GDRRQFSVHRTRSLPNQLRHGWECMLRKIG SLI +PS  Y  +  +S           
Sbjct  202  FGDRRQFSVHRTRSLPNQLRHGWECMLRKIGSSLIHQPSV-YSISLYESTITTRDEPWFG  260

Query  344  -HEMNLSLVN*SWP*V**LPVTPRDRILRC  430
              E+ L ++         LPVT  DRILRC
Sbjct  261  EFELALGVIG--------LPVTAHDRILRC  282



>emb|CBI23503.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 92/135 (68%), Gaps = 35/135 (26%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA                     
Sbjct  403  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAP--------------------  442

Query  190  KFGGPKAVLRAPDT*LTKSVATRMGMHATKDRVESDTETVYSISLYESTITTRDEP*FGE  369
                           LT+SVATRMGMHATK RVES+T TVYSISLYESTITTRDEP FGE
Sbjct  443  ---------------LTESVATRMGMHATKHRVESNTSTVYSISLYESTITTRDEPWFGE  487

Query  370  LKLALGVMTPSYSAR  414
            LKLALGV+    +AR
Sbjct  488  LKLALGVIGLPVTAR  502



>emb|CAA34729.1| unnamed protein product [Beta vulgaris subsp. vulgaris]
Length=464

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 101/135 (75%), Gaps = 13/135 (10%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG WAAGR PRVS
Sbjct  305  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCWAAGRLPRVS  364

Query  190  KFGGPK--AVLRAPDT*LTKSVAT--RMGMHATKDRVES---DTETVYSISLYESTITTR  348
            +FG  +  +V R      T+S+    R G      ++ S      +VYSISLYESTITTR
Sbjct  365  QFGDRRQFSVHR------TRSLPNQLRHGWECMLRKIGSSLIHQPSVYSISLYESTITTR  418

Query  349  DEP*FGELKLALGVM  393
            DEP FGE +LALGV+
Sbjct  419  DEPWFGEFELALGVI  433


 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 55/86 (64%), Gaps = 12/86 (14%)
 Frame = +2

Query  194  LGDRRQFSVHRTRSLPNQLRHGWECMLRKIGLSLIQKPSTQYPCTSPQSLHEMNLSLVN*  373
             GDRRQFSVHRTRSLPNQLRHGWECMLRKIG SLI +PS         SL+E  ++  + 
Sbjct  366  FGDRRQFSVHRTRSLPNQLRHGWECMLRKIGSSLIHQPSVY-----SISLYESTITTRDE  420

Query  374  SW-------P*V**LPVTPRDRILRC  430
             W         V  LPVT  DRILRC
Sbjct  421  PWFGEFELALGVIGLPVTAHDRILRC  446



>sp|P15688.2|NU2M_BETVU RecName: Full=NADH-ubiquinone oxidoreductase chain 2; AltName: 
Full=NADH dehydrogenase subunit 2 (mitochondrion) [Beta vulgaris]
 emb|CAA34728.1| NADH:ubiquinone reductase subunit 2 [Beta vulgaris subsp. vulgaris]
Length=515

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 101/135 (75%), Gaps = 13/135 (10%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG WAAGR PRVS
Sbjct  356  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCWAAGRLPRVS  415

Query  190  KFGGPK--AVLRAPDT*LTKSVAT--RMGMHATKDRVES---DTETVYSISLYESTITTR  348
            +FG  +  +V R      T+S+    R G      ++ S      +VYSISLYESTITTR
Sbjct  416  QFGDRRQFSVHR------TRSLPNQLRHGWECMLRKIGSSLIHQPSVYSISLYESTITTR  469

Query  349  DEP*FGELKLALGVM  393
            DEP FGE +LALGV+
Sbjct  470  DEPWFGEFELALGVI  484


 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 55/86 (64%), Gaps = 12/86 (14%)
 Frame = +2

Query  194  LGDRRQFSVHRTRSLPNQLRHGWECMLRKIGLSLIQKPSTQYPCTSPQSLHEMNLSLVN*  373
             GDRRQFSVHRTRSLPNQLRHGWECMLRKIG SLI +PS         SL+E  ++  + 
Sbjct  417  FGDRRQFSVHRTRSLPNQLRHGWECMLRKIGSSLIHQPSVY-----SISLYESTITTRDE  471

Query  374  SW-------P*V**LPVTPRDRILRC  430
             W         V  LPVT  DRILRC
Sbjct  472  PWFGEFELALGVIGLPVTAHDRILRC  497



>ref|XP_006401945.1| hypothetical protein EUTSA_v10015951mg, partial [Eutrema salsugineum]
 gb|ESQ43398.1| hypothetical protein EUTSA_v10015951mg, partial [Eutrema salsugineum]
Length=414

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 90/135 (67%), Gaps = 35/135 (26%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA                     
Sbjct  291  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAP--------------------  330

Query  190  KFGGPKAVLRAPDT*LTKSVATRMGMHATKDRVESDTETVYSISLYESTITTRDEP*FGE  369
                           LT+SVAT MGMHATKDRVESDT TVYSISL ESTITTRDEP FGE
Sbjct  331  ---------------LTESVATPMGMHATKDRVESDTSTVYSISLVESTITTRDEPWFGE  375

Query  370  LKLALGVMTPSYSAR  414
            LK +LGV+    +AR
Sbjct  376  LKFSLGVIGLPVTAR  390



>ref|YP_173427.1| hypothetical protein NitaMp087 [Nicotiana tabacum]
 ref|XP_006338188.1| PREDICTED: NADH-ubiquinone oxidoreductase chain 2-like [Solanum 
tuberosum]
 dbj|BAD83492.1| hypothetical protein (mitochondrion) [Nicotiana tabacum]
Length=214

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PRV
Sbjct  140  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRV  199

Query  187  SKFGGPKAVLRAPDT  231
            SKFGGPKAVLRAPDT
Sbjct  200  SKFGGPKAVLRAPDT  214



>ref|NP_671807.1| NADH-ubiquinone/plastoquinone (complex I) protein [Arabidopsis 
thaliana]
 gb|AEC06079.1| NADH-ubiquinone/plastoquinone (complex I) protein [Arabidopsis 
thaliana]
Length=214

 Score =   144 bits (364),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PR+S
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRIS  200

Query  190  KFGGPKAVLRAPDT  231
            KFGGPKAVLRAPDT
Sbjct  201  KFGGPKAVLRAPDT  214



>ref|YP_009091715.1| orf214 (mitochondrion) [Panax ginseng]
 gb|AHJ81037.1| orf214 (mitochondrion) [Panax ginseng]
Length=214

 Score =   144 bits (363),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PRVS
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRVS  200

Query  190  KFGGPKAVLRAPDT  231
            +FGGPKAVLRAPDT
Sbjct  201  QFGGPKAVLRAPDT  214



>gb|AHY20322.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Brassica juncea var. tumida]
Length=214

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PR+S
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRIS  200

Query  190  KFGGPKAVLRAPDT  231
            +FGGPKAVLRAPDT
Sbjct  201  QFGGPKAVLRAPDT  214



>ref|XP_011043349.1| PREDICTED: NADH-ubiquinone oxidoreductase chain 2 [Populus euphratica]
Length=264

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PRVS
Sbjct  191  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRVS  250

Query  190  KFGGPKAVLRAPDT  231
            +FGGPKAVLRAPDT
Sbjct  251  QFGGPKAVLRAPDT  264



>ref|XP_004173103.1| PREDICTED: NADH-ubiquinone oxidoreductase chain 2-like [Cucumis 
sativus]
Length=214

 Score =   139 bits (349),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PRVS
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRVS  200

Query  190  KFGGPKAVLRAPDT  231
             FG PKAVLRAPDT
Sbjct  201  LFGRPKAVLRAPDT  214



>gb|AGC78980.1| hypothetical protein (mitochondrion) [Vicia faba]
Length=214

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSY GIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG WAAGR PRVS
Sbjct  141  AITFSITMFSYVGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCWAAGRLPRVS  200

Query  190  KFGGPKAVLRAPDT  231
            +FGGPKAVLRAPDT
Sbjct  201  QFGGPKAVLRAPDT  214



>ref|XP_010647127.1| PREDICTED: LOW QUALITY PROTEIN: NADH-ubiquinone oxidoreductase 
chain 2 [Vitis vinifera]
Length=267

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWA GR PR S
Sbjct  193  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAVGRLPRXS  252

Query  190  KFG-GPKAVLRAPDT  231
             +G G +AVLRAPDT
Sbjct  253  FWGTGGRAVLRAPDT  267



>ref|XP_011069475.1| PREDICTED: NADH-ubiquinone oxidoreductase chain 2, partial [Sesamum 
indicum]
Length=204

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PRV
Sbjct  140  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRV  199

Query  187  SKFGG  201
            S+FGG
Sbjct  200  SQFGG  204



>ref|XP_002534810.1| NADH dehydrogenase, putative [Ricinus communis]
 gb|EEF27573.1| NADH dehydrogenase, putative, partial [Ricinus communis]
Length=214

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR PRV
Sbjct  156  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLPRV  214



>gb|EHK62692.1| hypothetical protein M3S_K16, partial (mitochondrion) [Sorghum 
bicolor]
Length=164

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR P
Sbjct  107  LAMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLP  164



>gb|EMS45534.1| NADH-ubiquinone oxidoreductase chain 2 [Triticum urartu]
Length=135

 Score =   108 bits (271),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWA GR P
Sbjct  78   LAMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAVGRLP  135



>gb|EPS74676.1| hypothetical protein M569_00051, partial [Genlisea aurea]
Length=320

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 63/77 (82%), Gaps = 4/77 (5%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSY GIPPLAGFCSKFYLFFAAL CGAYFLA VGVVTSVI RWAAGR PRV
Sbjct  205  LAITFSITMFSYIGIPPLAGFCSKFYLFFAALSCGAYFLALVGVVTSVISRWAAGRLPRV  264

Query  187  SK---FGGPKA-VLRAP  225
            +K   F  P+  +L  P
Sbjct  265  TKRMFFDTPRTWILYEP  281



>gb|EMS61551.1| NADH-ubiquinone oxidoreductase chain 2 [Triticum urartu]
Length=197

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR P
Sbjct  141  AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLP  197



>ref|XP_009385759.1| PREDICTED: NADH-ubiquinone oxidoreductase chain 2 [Musa acuminata 
subsp. malaccensis]
Length=197

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            AITFSITMFSYAGIPPLAGFCSKFY+FFAALGCGAYFLA VGVVTSVIGRWAAGR P
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYMFFAALGCGAYFLALVGVVTSVIGRWAAGRLP  197



>ref|YP_005090358.1| NADH dehydrogenase subunit 2 (mitochondrion) [Phoenix dactylifera]
 gb|AEM43906.1| NADH dehydrogenase subunit 2 (mitochondrion) [Phoenix dactylifera]
Length=494

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAAGR P
Sbjct  376  AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAAGRLP  432



>gb|EMS44984.1| NADH-ubiquinone oxidoreductase chain 2 [Triticum urartu]
Length=197

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            A+TFSITMFSYAGIPPLAGFCSKFYL FAALGCGA FLA VGVVTSVIGRWAAGRFP
Sbjct  141  AMTFSITMFSYAGIPPLAGFCSKFYLVFAALGCGANFLAPVGVVTSVIGRWAAGRFP  197



>gb|AFW86834.1| hypothetical protein ZEAMMB73_135095 [Zea mays]
Length=197

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            +A+TFSITMFSYAGIP LAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGRWAA R P
Sbjct  140  LAMTFSITMFSYAGIPLLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRWAARRLP  197



>gb|KEH38129.1| hypothetical protein MTR_2g461800 [Medicago truncatula]
Length=131

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 53/60 (88%), Gaps = 2/60 (3%)
 Frame = +1

Query  259  MGMHATKDRVESDTETVYSISLYESTITTRDEP*FGELKLALGVM--TPSYSARSYTEVL  432
            MGMHATKDRVES+T TVYSISLYESTITTRDEP FGELK ALGV   TPSY A+SYTEVL
Sbjct  1    MGMHATKDRVESETSTVYSISLYESTITTRDEPWFGELKFALGVKKRTPSYCAQSYTEVL  60



>ref|YP_006280921.1| NADH dehydrogenase subunit 2 (mitochondrion) [Spirodela polyrhiza]
 gb|AFI54938.1| NADH dehydrogenase subunit 2 (mitochondrion) [Spirodela polyrhiza]
Length=476

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            A+TFSITMFSYAGIPPLAGFCSKF+LFFAALGCGAYFLA VG+VTSVIGRWAA  + R++
Sbjct  362  AMTFSITMFSYAGIPPLAGFCSKFFLFFAALGCGAYFLAPVGIVTSVIGRWAAFYYIRLA  421

Query  190  K  192
            K
Sbjct  422  K  422



>gb|AGK25068.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Calycanthus 
floridus]
Length=177

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  67   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  126

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  127  FFDTPRTWILYEP  139



>ref|YP_004849337.1| NADH dehydrogenase subunit 2 [Cucumis sativus]
 gb|ADZ10764.1| NADH dehydrogenase subunit 2 [Cucumis sativus]
Length=488

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  ++ 
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKIM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_002608350.1| NADH dehydrogenase subunit 2 [Vitis vinifera]
 emb|CAQ77578.1| NADH dehydrogenase subunit 2 [Vitis vinifera]
Length=488

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   RF +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRFAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_003587345.1| NADH dehydrogenase subunit 2 [Cucurbita pepo]
 gb|ACV96678.1| NADH dehydrogenase subunit 2 [Cucurbita pepo]
Length=488

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  ++
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKI  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>gb|AHX81378.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Hirtella 
racemosa]
 gb|AHX81381.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Hirtella 
physophora]
 gb|AHX81384.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Couepia 
guianensis]
 gb|AHX81387.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Licania 
heteromorpha]
 gb|AHX81390.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Chrysobalanus 
icaco]
 gb|AHX81393.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Parinari 
campestris]
 gb|AHX81396.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Licania 
sprucei]
 gb|AHX81399.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Licania 
alba]
Length=306

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  194  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  253

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  254  MFFDTPRTWILYEP  267



>gb|AJM70215.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Nicotiana 
tabacum/Hyoscyamus niger cybrid]
Length=306

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  194  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  253

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  254  MFFDTPRTWILYEP  267



>ref|YP_005090405.1| nad2 gene product (mitochondrion) [Boea hygrometrica]
 gb|AEK53297.1| NADH dehydrogenase subunit 2 (mitochondrion) [Boea hygrometrica]
Length=488

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_009049686.1| NADH dehydrogenase subunit 2 (mitochondrion) [Capsicum annuum]
 gb|AIG89918.1| NADH dehydrogenase subunit 2 (mitochondrion) [Capsicum annuum]
 gb|AIG90044.1| NADH dehydrogenase subunit 2 (mitochondrion) [Capsicum annuum]
Length=488

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_173350.1| NADH dehydrogenase subunit 2 [Nicotiana tabacum]
 gb|AJK91380.1| NADH dehydrogenase subunit 2 (mitochondrion) [Hyoscyamus niger]
Length=488

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>dbj|BAO50900.1| NADH dehydrogenase subunit 2 (mitochondrion) [Hevea brasiliensis]
 dbj|BAO50901.1| NADH dehydrogenase subunit 2 (mitochondrion) [Hevea brasiliensis]
Length=488

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>emb|CAJ70645.1| NADH dehydrogenase subunit 2 [Helianthus annuus]
Length=307

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VG+VTSVIGR+   R  +  
Sbjct  196  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGIVTSVIGRFYYIRLVKRM  255

Query  190  KFGGPK  207
             F  P+
Sbjct  256  FFDTPR  261



>ref|YP_004237258.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ricinus communis]
 gb|ADW96022.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ricinus communis]
Length=488

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_002608182.2| NADH dehydrogenase subunit 2 [Carica papaya]
 gb|ACB20471.2| NADH dehydrogenase subunit 2 (mitochondrion) [Carica papaya]
Length=488

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>gb|AEN56103.1| NADH dehydrogenase subunit 2 [Cucumis melo subsp. melo]
Length=488

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_006666123.1| NADH dehydrogenase subunit 2 (mitochondrion) [Malus domestica]
 emb|CBX33367.1| NADH dehydrogenase subunit 2 (mitochondrion) [Malus domestica]
Length=488

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_009045710.1| NADH dehydrogenase subunit 2 (mitochondrion) [Batis maritima]
 gb|AIC83313.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Batis maritima]
Length=488

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>sp|P93401.2|NU2M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 2; AltName: 
Full=NADH dehydrogenase subunit 2 (mitochondrion) [Oenothera 
berteroana]
Length=488

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_004927565.1| nad2 (mitochondrion) [Brassica carinata]
 ref|YP_006666002.1| NADH dehydrogenase subunit 2 (mitochondrion) [Raphanus sativus]
 gb|AEH43579.1| nad2 [Brassica carinata]
 gb|AEX57671.1| NADH dehydrogenase subunit 2 (mitochondrion) [Raphanus sativus]
 dbj|BAM36216.1| NADH dehydrogenase subunit 2 (mitochondrion) [Raphanus sativus]
 dbj|BAM36245.1| NADH dehydrogenase subunit 2 (mitochondrion) [Raphanus sativus]
 gb|AGC81663.1| NADH dehydrogenase subunit 2 (mitochondrion) [Raphanus sativus]
 gb|AGY62823.1| NADH dehydrogenase subunit 2 (mitochondrion) [Eruca vesicaria 
subsp. sativa]
 gb|AIE42612.1| NADH dehydrogenase subunit 2 (mitochondrion) [Raphanus sativus]
 dbj|BAP15867.1| NADH dehydrogenase subunit2 (mitochondrion) [Raphanus sativus]
Length=488

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLVKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>gb|ABS50624.1| NADH dehydrogenase subunit 2 [Arabidopsis thaliana]
 gb|ABS50625.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Arabidopsis 
thaliana]
Length=463

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  372  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLVKRM  431

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  432  FFDTPRTWILYEP  444



>ref|NP_085584.1| NADH dehydrogenase subunit 2 [Arabidopsis thaliana]
 emb|CAA65381.1| NADH-ubiquinone oxidoreductase [Arabidopsis thaliana]
 emb|CAA69771.3| NADH dehydrogenase subunit 2 [Arabidopsis thaliana]
 gb|AEK01252.1| nad2 [Arabidopsis thaliana]
 gb|AEK01332.1| nad2 [Arabidopsis thaliana]
Length=499

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  388  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLVKRM  447

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  448  FFDTPRTWILYEP  460



>ref|YP_004927490.1| nad2 (mitochondrion) [Brassica oleracea]
 ref|YP_004927818.1| nad2 (mitochondrion) [Brassica rapa subsp. oleifera]
 ref|YP_004927721.1| nad2 (mitochondrion) [Brassica juncea]
 gb|AEH43467.1| nad2 [Brassica rapa subsp. oleifera]
 gb|AEH43518.1| nad2 [Brassica oleracea]
 gb|AEH43691.1| nad2 [Brassica juncea]
 emb|CBX48319.1| nad2 [Brassica napus]
 gb|AIC83247.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Brassica oleracea var. botrytis]
 dbj|BAP82271.1| NADH dehydrogenase subunit 2 (mitochondrion) [Brassica oleracea]
Length=488

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLVKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|NP_064064.2| nad2 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris]
 ref|YP_004222260.1| NADH dehydrogenase subunit 2 [Beta vulgaris subsp. maritima]
 ref|YP_004842067.1| NADH dehydrogenase subunit 2 [Beta macrocarpa]
 gb|ABD36071.1| NADH dehydrogenase subunit 2 [Beta vulgaris subsp. vulgaris]
 dbj|BAA99456.2| NADH dehydrogenase subunit 2 [Beta vulgaris subsp. vulgaris]
 emb|CBJ13993.1| NADH dehydrogenase subunit 2 [Beta vulgaris subsp. maritima]
 emb|CBJ17481.1| NADH dehydrogenase subunit 2 [Beta vulgaris subsp. maritima]
 emb|CBJ20660.1| NADH dehydrogenase subunit 2 [Beta vulgaris subsp. maritima]
 emb|CBX24852.1| NADH dehydrogenase subunit 2 [Beta macrocarpa]
Length=488

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>gb|AEK01280.1| nad2 [Arabidopsis thaliana]
Length=500

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  389  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLVKRM  448

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  449  FFDTPRTWILYEP  461



>ref|YP_006291809.1| nad2 gene product (mitochondrion) [Daucus carota subsp. sativus]
 gb|AEY81209.1| NADH dehydrogenase subunit 2 (mitochondrion) [Daucus carota subsp. 
sativus]
Length=488

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VG+VTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGIVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_003587227.1| NADH dehydrogenase subunit 2 [Citrullus lanatus]
 gb|ACV96633.1| NADH dehydrogenase subunit 2 [Citrullus lanatus]
Length=488

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_008802483.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Asclepias syriaca]
 gb|AGZ63018.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Asclepias syriaca]
Length=488

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>emb|CBX33211.1| NADH dehydrogenase subunit 2 (mitochondrion) [Beta vulgaris subsp. 
maritima]
 emb|CBL54111.1| NADH dehydrogenase subunit 2 (mitochondrion) [Beta vulgaris subsp. 
maritima]
Length=488

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>gb|AEX98100.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Ferrocalamus 
rimosivaginus]
Length=306

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  195  AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  254

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  255  FFDRPRTWILYEP  267



>ref|YP_008999580.1| NADH dehydrogenase subunit 2 (mitochondrion) [Vaccinium macrocarpon]
 gb|AGX28794.1| NADH dehydrogenase subunit 2 (mitochondrion) [Vaccinium macrocarpon]
Length=491

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  380  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLVKRM  439

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  440  FFDTPRTWILYEP  452



>gb|AHC94293.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Amborella 
trichopoda]
Length=483

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITM SYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMLSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCYYYIRLVKR  435

Query  187  SKFGGPKAVL  216
              F  P+ ++
Sbjct  436  MFFDRPRTLI  445



>ref|YP_740397.1| NADH dehydrogenase subunit 2 [Zea mays subsp. parviglumis]
 gb|ABF70857.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea mays subsp. 
parviglumis]
Length=488

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  376  LAMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDRPRTWILYEP  449



>gb|ABE98698.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea mays subsp. 
mays]
Length=488

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  376  LAMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDRPRTWILYEP  449



>ref|YP_588266.1| NADH dehydrogenase subunit 2 [Zea mays subsp. mays]
 ref|YP_588267.1| NADH dehydrogenase subunit 2 [Zea mays subsp. mays]
 ref|YP_740370.1| NADH dehydrogenase subunit 2 [Zea perennis]
 ref|YP_740423.1| NADH dehydrogenase subunit 2 [Zea luxurians]
 ref|YP_762325.1| NADH dehydrogenase subunit 2 [Sorghum bicolor]
 ref|YP_762479.1| NADH dehydrogenase subunit 2 [Tripsacum dactyloides]
 gb|AAR91195.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea mays]
 gb|AAR91204.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea mays]
 gb|ABE98740.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea mays subsp. 
mays]
 gb|ABE98770.1| NADH dehydrogenase subunit 2 [Zea mays subsp. mays]
 gb|ABF70825.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea perennis]
 gb|ABF70939.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea mays subsp. 
mays]
 gb|ABG65648.1| NADH dehydrogenase subunit 2 (mitochondrion) [Zea luxurians]
 gb|ABI60880.1| NADH dehydrogenase subunit 2 (mitochondrion) [Sorghum bicolor]
 gb|ABI74652.1| NADH dehydrogenase subunit 2 (mitochondrion) [Tripsacum dactyloides]
Length=488

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  376  LAMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDRPRTWILYEP  449



>ref|YP_008080914.1| NADH dehydrogenase subunit 2 (mitochondrion) [Butomus umbellatus]
 gb|AFY16537.1| NADH dehydrogenase subunit 2 (mitochondrion) [Butomus umbellatus]
Length=488

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  + 
Sbjct  376  LALTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDRPRTWILYEP  449



>gb|AHA47117.1| NADH dehydrogenase subunit 2 (mitochondrion) [Amborella trichopoda]
Length=488

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITM SYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMLSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCYYYIRLVKR  435

Query  187  SKFGGPKAVL  216
              F  P+ ++
Sbjct  436  MFFDRPRTLI  445



>gb|AGI48793.1| NADH dehydrogenase subunit 2 (mitochondrion) [Lolium perenne]
Length=488

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDRPRTWILYEP  449



>gb|ABY55185.1| NADH dehydrogenase subunit 2 [Bambusa oldhamii]
 gb|AEK66756.1| NADH dehydrogenase subunit 2 [Ferrocalamus rimosivaginus]
Length=488

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDRPRTWILYEP  449



>ref|YP_008757352.1| NADH dehydrogenase subunit 2 (mitochondrion) [Aegilops speltoides]
 dbj|BAN94753.1| NADH dehydrogenase subunit 2 (mitochondrion) [Aegilops speltoides]
Length=488

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDRPRTWILYEP  449



>ref|YP_398391.1| nad2 [Triticum aestivum]
 ref|YP_008758133.1| NADH dehydrogenase subunit 2 (mitochondrion) [Triticum timopheevii]
 emb|CAA74778.1| NADH dehydrogenase subunit 2 [Triticum aestivum]
 dbj|BAE47677.1| nad2 [Triticum aestivum]
 gb|ACA62624.1| nad2 (mitochondrion) [Triticum aestivum]
 gb|ADE08090.1| nad2 (mitochondrion) [Triticum aestivum]
 dbj|BAN94722.1| NADH dehydrogenase subunit 2 (mitochondrion) [Triticum timopheevii]
 gb|AHI16391.1| nad2 (mitochondrion) [Triticum turgidum subsp. durum]
 gb|AHI16416.1| nad2 (mitochondrion) [Triticum turgidum subsp. durum]
Length=488

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDRPRTWILYEP  449



>ref|YP_005090477.1| NADH dehydrogenase subunit 2 (mitochondrion) [Lotus japonicus]
 gb|AET62937.1| NADH dehydrogenase subunit 2 (mitochondrion) [Lotus japonicus]
Length=488

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSY GIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYVGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>emb|CAA63783.1| NADH dehydrogenase subunit II [Solanum tuberosum]
Length=306

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFL  VGV+T+VIGR+   R  + 
Sbjct  194  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLTPVGVMTNVIGRFYYIRLAKR  253

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  254  MFFDTPRTWILYEP  267



>ref|YP_005090433.1| NADH dehydrogenase subunit 2 (mitochondrion) [Millettia pinnata]
 gb|AET62893.1| NADH dehydrogenase subunit 2 (mitochondrion) [Millettia pinnata]
Length=488

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSY GIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYVGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|NP_054402.1| NADH dehydrogenase subunit 2 [Marchantia polymorpha]
 sp|P26846.2|NU2M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 2; AltName: 
Full=NADH dehydrogenase subunit 2 (mitochondrion) [Marchantia 
polymorpha]
 gb|AAC09399.1| nad2 [Marchantia polymorpha]
Length=489

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPKA-VLRAP  225
              F  PK  VL  P
Sbjct  437  MYFDTPKTWVLYKP  450



>emb|CAC50353.1| NADH dehydrogenase subunit 2 [Ricciocarpos natans]
Length=417

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  404  MYFDTPKTWILYKP  417



>emb|CAC48197.1| NADH dehydrogenase subunit 2 [Sphaerocarpos donnellii]
 emb|CAC50242.1| NADH dehydrogenase subunit 2 [Bucegia romanica]
 emb|CAC50341.1| NADH dehydrogenase subunit 2 [Lunularia cruciata]
Length=417

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  404  MYFDTPKTWILYKP  417



>gb|AHF22684.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
iinumae]
 gb|AHF22685.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
mandshurica]
 gb|AHF22686.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
vesca subsp. bracteata]
 gb|AHF22687.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
chiloensis]
 gb|AHF22688.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
virginiana]
 gb|AHF22689.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
vesca subsp. vesca]
 gb|AHF22690.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
vesca subsp. bracteata]
 gb|AHF22691.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Fragaria 
vesca subsp. bracteata]
Length=500

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITF+ITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  389  AITFAITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRVAKRM  448

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  449  FFDTPRTWILYEP  461



>emb|CAC20910.1| NADH dehydrogenase subunit 2 [Sphagnum fallax]
Length=417

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  404  MYFDTPKTWILYKP  417



>gb|ACZ34318.1| NADH dehydrogenase subunit 2 [Chamaebryum pottioides]
Length=408

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  335  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  394

Query  187  SKFGGPK  207
              F  PK
Sbjct  395  MYFDTPK  401



>emb|CAC19938.1| NADH dehydrogenase subunit 2 [Ceratodon purpureus]
Length=417

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20859.1| NADH dehydrogenase subunit 2 [Racomitrium lanuginosum]
Length=417

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ABX25853.1| NADH dehydrogenase subunit 2 [Grimmia cribrosa]
Length=417

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC21197.1| NADH dehydrogenase subunit 2 [Timmia megapolitana subsp. bavarica]
Length=417

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ABX25854.1| NADH dehydrogenase subunit 2 [Grimmia donniana]
Length=417

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC50255.1| NADH dehydrogenase subunit 2 [Corsinia coriandra]
Length=417

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  404  MYFDTPKTWILYKP  417



>emb|CAC19874.1| NADH dehydrogenase subunit 2 [Bartramia halleriana]
Length=417

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ACZ34319.1| NADH dehydrogenase subunit 2 [Gigaspermum repens]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20246.1| NADH dehydrogenase subunit 2 [Hedwigia ciliata]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|AAW63668.1| NADH dehydrogenase subunit 2 [Nymphaea sp. Bergthorsson 0401]
Length=122

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVI
Sbjct  74   LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVI  122



>gb|ABX25851.1| NADH dehydrogenase subunit 2 [Physcomitrium pyriforme]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20735.1| NADH dehydrogenase subunit 2 [Orthodontium lineare]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20380.1| NADH dehydrogenase subunit 2 [Hygrohypnum ochraceum]
 emb|CAC21214.1| NADH dehydrogenase subunit 2 [Tomentypnum nitens]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20163.1| NADH dehydrogenase subunit 2 [Fissidens cristatus]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20902.1| NADH dehydrogenase subunit 2 [Rhacocarpus purpurascens]
 gb|ABX25850.1| NADH dehydrogenase subunit 2 [Bryobrittonia longipes]
 gb|ABX25855.1| NADH dehydrogenase subunit 2 [Blindia acuta]
 gb|ACZ34317.1| NADH dehydrogenase subunit 2 [Timmia norvegica]
 gb|ACZ34321.1| NADH dehydrogenase subunit 2 [Catoscopium nigritum]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ACZ34320.1| NADH dehydrogenase subunit 2 [Oedipodiella australis]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ACZ34316.1| NADH dehydrogenase subunit 2 [Timmia austriaca]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ABX25856.1| NADH dehydrogenase subunit 2 [Timmiella sp. VKLBN991028]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC19940.1| NADH dehydrogenase subunit 2 [Cinclidotus riparius]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20597.1| NADH dehydrogenase subunit 2 [Isothecium alopecurum]
 emb|CAC20791.1| NADH dehydrogenase subunit 2 [Pohlia nutans]
 emb|CAC20670.1| NADH dehydrogenase subunit 2 [Mnium hornum]
 emb|CAC20768.1| NADH dehydrogenase subunit 2 [Pterogonium gracile]
 emb|CAC21196.1| NADH dehydrogenase subunit 2 [Thamnobryum alopecurum]
 emb|CAC20644.1| NADH dehydrogenase subunit 2 [Leskea polycarpa]
 emb|CAC21445.1| NADH dehydrogenase subunit 2 [Plagiopus oederi]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ABX25848.1| NADH dehydrogenase subunit 2 [Dawsonia sp. VKL981115]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC21233.1| NADH dehydrogenase subunit 2 [Ulota crispa]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20849.1| NADH dehydrogenase subunit 2 [Pogonatum urnigerum]
Length=421

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  348  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  407

Query  187  SKFGGPK  207
              F  PK
Sbjct  408  MYFDTPK  414



>emb|CAC21201.1| NADH dehydrogenase subunit 2 [Syntrichia latifolia]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20605.1| NADH dehydrogenase subunit 2 [Leucobryum glaucum]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20107.1| NADH dehydrogenase subunit 2 [Dichodontium pellucidum]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC21215.1| NADH dehydrogenase subunit 2 [Tetraphis pellucida]
Length=421

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  348  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  407

Query  187  SKFGGPK  207
              F  PK
Sbjct  408  MYFDTPK  414



>gb|ABX25857.1| NADH dehydrogenase subunit 2 [Splachnum ampullaceum]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ABX25852.1| NADH dehydrogenase subunit 2 [Discelium nudum]
Length=417

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20934.1| NADH dehydrogenase subunit 2 [Schistostega pennata]
Length=417

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC21176.1| NADH dehydrogenase subunit 2 [Herzogiella seligeri]
Length=417

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>ref|YP_009047587.1| NADH dehydrogenase subunit 2 (mitochondrion) [Sphagnum palustre]
 gb|AGN74378.1| NADH dehydrogenase subunit 2 (mitochondrion) [Sphagnum palustre]
 gb|AHI16182.1| NADH dehydrogenase subunit 2 (mitochondrion) [Sphagnum girgensohnii]
 gb|AHI16183.1| NADH dehydrogenase subunit 2 (mitochondrion) [Sphagnum palustre]
Length=489

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  437  MYFDTPKTWILYKP  450



>emb|CAC20025.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Trichodon 
cylindricus]
Length=417

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC21171.1| NADH dehydrogenase subunit 2 [Scorpidium scorpioides]
Length=417

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|AAW63666.1| NADH dehydrogenase subunit 2 [Eschscholzia californica]
Length=128

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVI
Sbjct  81   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVI  128



>emb|CAC20793.1| NADH dehydrogenase subunit 2 [Physcomitrella patens]
Length=417

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|AHI16173.1| NADH dehydrogenase subunit 2 (mitochondrion) [Bryum argenteum]
Length=489

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_009040979.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Tetraphis pellucida]
 gb|AGN74220.1| NADH dehydrogenase subunit 2 (mitochondrion) [Tetraphis pellucida]
 gb|AHI16184.1| NADH dehydrogenase subunit 2 (mitochondrion) [Tetraphis pellucida]
 gb|AIB08444.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Tetraphis pellucida]
Length=489

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_009047507.1| NADH dehydrogenase subunit 2 (mitochondrion) [Bartramia pomiformis]
 gb|AGN74298.1| NADH dehydrogenase subunit 2 (mitochondrion) [Bartramia pomiformis]
 gb|AHI16171.1| NADH dehydrogenase subunit 2 (mitochondrion) [Bartramia pomiformis]
Length=489

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>emb|CAC20216.1| NADH dehydrogenase subunit 2 [Funaria hygrometrica]
Length=417

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|AEB39977.1| NADH dehydrogenase subunit 2 [Funaria hygrometrica]
Length=487

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_009047667.1| NADH dehydrogenase subunit 2 (mitochondrion) [Funaria hygrometrica]
 gb|AGN74458.1| NADH dehydrogenase subunit 2 (mitochondrion) [Funaria hygrometrica]
 gb|AHI16177.1| NADH dehydrogenase subunit 2 (mitochondrion) [Funaria hygrometrica]
Length=489

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_009112126.1| NADH dehydrogenase subunit 2 (mitochondrion) [Codriophorus laevigatus]
 gb|AIY51483.1| NADH dehydrogenase subunit 2 (mitochondrion) [Codriophorus laevigatus]
Length=489

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>emb|CAC20162.1| NADH dehydrogenase subunit 2 [Fontinalis antipyretica]
Length=417

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>ref|YP_539019.1| NADH dehydrogenase subunit 2 [Physcomitrella patens]
 dbj|BAE93090.1| NADH dehydrogenase subunit 2 (mitochondrion) [Physcomitrella 
patens]
Length=489

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_009047388.1| NADH dehydrogenase subunit 2 (mitochondrion) [Hypnum imponens]
 gb|AGN74140.1| NADH dehydrogenase subunit 2 (mitochondrion) [Hypnum imponens]
 gb|AHI16178.1| NADH dehydrogenase subunit 2 (mitochondrion) [Hypnum imponens]
Length=489

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>gb|AHI16185.1| NADH dehydrogenase subunit 2 (mitochondrion) [Tetraplodon fuegianus]
Length=489

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_009047428.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ulota hutchinsiae]
 ref|YP_009047627.1| NADH dehydrogenase subunit 2 (mitochondrion) [Orthotrichum stellatum]
 ref|YP_009115193.1| NADH dehydrogenase subunit 2 (mitochondrion) [Orthotrichum speciosum]
 gb|AGN74180.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ulota hutchinsiae]
 gb|AGN74418.1| NADH dehydrogenase subunit 2 (mitochondrion) [Orthotrichum stellatum]
 gb|AHI16179.1| NADH dehydrogenase subunit 2 (mitochondrion) [Orthotrichum stellatum]
 gb|AHI16186.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ulota hutchinsiae]
 gb|AIZ96999.1| NADH dehydrogenase subunit 2 (mitochondrion) [Orthotrichum speciosum]
 gb|AJD22418.1| NADH dehydrogenase subunit 2 (mitochondrion) [Orthotrichum rogeri]
Length=489

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>gb|AJJ48453.1| NADH dehydrogenase subunit 2 (mitochondrion) [Racomitrium ericoides]
Length=489

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_009047348.1| NADH dehydrogenase subunit 2 (mitochondrion) [Climacium americanum]
 gb|AGN74100.1| NADH dehydrogenase subunit 2 (mitochondrion) [Climacium americanum]
 gb|AHI16175.1| NADH dehydrogenase subunit 2 (mitochondrion) [Climacium americanum]
Length=489

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_003275956.1| NADH dehydrogenase subunit 2 (mitochondrion) [Pleurozia purpurea]
 gb|ACR19340.1| NADH dehydrogenase subunit 2 [Pleurozia purpurea]
Length=489

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  437  MYFDTPKTWILYKP  450



>ref|YP_009047308.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ptychomnion cygnisetum]
 gb|AGN74060.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ptychomnion cygnisetum]
 gb|AHI16180.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ptychomnion cygnisetum]
Length=489

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_004927653.1| NADH dehydrogenase subunit 2 (mitochondrion) [Treubia lacunosa]
 gb|AEH99700.1| NADH dehydrogenase subunit 2 [Treubia lacunosa]
Length=390

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   R  ++
Sbjct  278  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRLVKI  337

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  338  MYFDTPKTWILYKP  351



>ref|YP_004927624.1| NADH dehydrogenase subunit 2 (mitochondrion) [Anomodon rugelii]
 ref|YP_008378690.1| NADH dehydrogenase subunit 2 (mitochondrion) [Anomodon attenuatus]
 gb|AEH99671.1| NADH dehydrogenase subunit 2 [Anomodon rugelii]
 gb|AFQ94014.1| NADH dehydrogenase subunit 2 (mitochondrion) [Anomodon attenuatus]
 gb|AHI16169.1| NADH dehydrogenase subunit 2 (mitochondrion) [Anomodon attenuatus]
Length=489

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_717099.1| NADH dehydrogenase subunit 2 [Brassica napus]
 dbj|BAC98925.1| NADH dehydrogenase subunit 2 [Brassica napus]
Length=488

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>gb|ADG85358.1| NADH dehydrogenase subunit 2 [Silene latifolia]
Length=488

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_003875489.1| NADH dehydrogenase subunit 2 [Silene latifolia]
 gb|ADK73332.1| NADH dehydrogenase subunit 2 [Silene latifolia]
Length=488

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLVKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>dbj|BAD83439.2| NADH dehydrogenase subunit 2 (mitochondrion) [Nicotiana tabacum]
Length=488

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_009041151.1| NADH dehydrogenase subunit 2 (mitochondrion) [Rhazya stricta]
 gb|AIB08805.1| NADH dehydrogenase subunit 2 (mitochondrion) [Rhazya stricta]
Length=488

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>sp|O05000.2|NU2M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 2; AltName: 
Full=NADH dehydrogenase subunit 2 (mitochondrion) [Arabidopsis 
thaliana]
Length=499

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  + 
Sbjct  387  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVIGCFYYIRLVKR  446

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  447  MFFDTPRTWILYEP  460



>dbj|BAD66742.1| NADH dehydrogenase subunit 2 [Beta vulgaris subsp. vulgaris]
Length=488

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLVKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>gb|AFI44275.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene vulgaris]
Length=488

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLVKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>gb|AAW63671.1| NADH dehydrogenase subunit 2 [Piper betle]
Length=188

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVI
Sbjct  140  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVI  188



>ref|YP_004935348.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene vulgaris]
 gb|AEM46194.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene vulgaris]
 gb|AFI44308.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene vulgaris]
 gb|AFI44331.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene vulgaris]
Length=488

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLVKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>emb|CAC19821.1| NADH dehydrogenase subunit 2 [Aulacomnium androgynum]
Length=417

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT S+TMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSVTMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>pir||A42491 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 2 - evening 
primrose mitochondrion (mitochondrion) [Oenothera sp.]
 gb|AAB18755.1| NADH dehydrogenase subunit 2 [Oenothera berteroana]
Length=488

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>gb|AGK25062.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Magnolia 
stellata]
Length=190

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGR  159
            AITFSITMFSYAGIPPLAGF SKFYLFFAALGCGAYFLA VGVVTSVIGR
Sbjct  141  AITFSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYFLAPVGVVTSVIGR  190



>gb|ABX25849.1| NADH dehydrogenase subunit 2 [Oligotrichum hercynicum]
Length=405

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  332  LAITSSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  391

Query  187  SKFGGPK  207
              F  PK
Sbjct  392  MYFDTPK  398



>gb|AAW63665.1| NADH dehydrogenase subunit 2 [Agave attenuata]
Length=120

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVI
Sbjct  73   AMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVI  120



>gb|AHI16181.1| NADH dehydrogenase subunit 2 (mitochondrion) [Scapania nemorea]
Length=489

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  437  MYFDTPETWILYKP  450



>gb|AAW63669.1| NADH dehydrogenase subunit 2 [Lonicera sp. Bergthorsson 0301]
Length=188

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVI
Sbjct  141  AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVI  188



>emb|CAC48183.1| NADH dehydrogenase subunit 2 [Fossombronia pusilla]
Length=417

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SIT FSYAGIPPLAGFCSKFYLFFAA GCGAY LA +GVVTSVI R+   RF ++
Sbjct  344  LAITLSITTFSYAGIPPLAGFCSKFYLFFAASGCGAYLLALIGVVTSVISRFYYIRFVKI  403

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  404  MYFDTPKTWILYKP  417



>emb|CAA74779.1| NADH dehydrogenase subunit 2 [Triticum aestivum]
Length=488

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  + 
Sbjct  376  LAMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDRPRTWILYEP  449



>emb|CAC50352.1| NADH dehydrogenase subunit 2 [Pellia epiphylla]
Length=418

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SI MFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  345  LAITLSIAMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  404

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  405  MYFDTPKTWILYKP  418



>emb|CAC19837.1| NADH dehydrogenase subunit 2 [Andreaea nivalis]
Length=417

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AIT SITMFSYAGIPPLAGF SKFYLFFAALGCGAY LA +GV+TSVI R+   RF ++ 
Sbjct  345  AITLSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYLLALIGVITSVISRFYYIRFVKIM  404

Query  190  KFGGPKA-VLRAP  225
             F  PK  +L  P
Sbjct  405  YFDTPKTWILYKP  417



>emb|CAC20737.1| NADH dehydrogenase subunit 2 [Orthodicranum montanum]
Length=417

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVV SVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVISVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|AGL75392.1| NADH dehydrogenase subunit 2 (mitochondrion) [Utricularia gibba]
Length=490

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFS+TMFSY GIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVI R+   R  + 
Sbjct  376  LAITFSMTMFSYIGIPPLAGFCSKFYLFFAALGCGAYFLALVGVVTSVISRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_514681.1| NADH dehydrogenase subunit 2 [Oryza sativa Indica Group]
 ref|YP_002000596.1| NADH dehydrogenase subunit 2 [Oryza sativa Japonica Group]
 dbj|BAC19905.1| NADH dehydrogenase subunit 2 [Oryza sativa Japonica Group]
 gb|AAZ99285.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AAZ99339.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza sativa Japonica 
Group]
 gb|AAZ99392.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza sativa Japonica 
Group]
 gb|AER13006.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AER13071.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AEZ03758.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza sativa Indica 
Group]
 gb|AEZ03786.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza sativa Indica 
Group]
 dbj|BAN67475.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza rufipogon]
 dbj|BAN67498.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza rufipogon]
 dbj|BAN67523.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza rufipogon]
 dbj|BAN67542.1| NADH dehydrogenase subunit 2 (mitochondrion) [Oryza rufipogon]
Length=488

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  + 
Sbjct  376  LAMTFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDRPRTWILYEP  449



>ref|YP_007905691.1| NADH dehydrogenase subunit 2 (mitochondrion) [Liriodendron tulipifera]
 gb|AGJ90400.1| NADH dehydrogenase subunit 2 (mitochondrion) [Liriodendron tulipifera]
Length=488

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSYAGIPPLAGF SKFYLFFAALGCGAYFLA VGVVTSVIGR+   R  +  
Sbjct  377  AITFSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYFLAPVGVVTSVIGRFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>gb|AHI16176.1| NADH dehydrogenase subunit 2 (mitochondrion) [Dicranum scoparium]
Length=489

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVV SVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVISVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|YP_007516850.1| NADH dehydrogenase subunit 2 (mitochondrion) [Glycine max]
 gb|AFR34312.1| NADH dehydrogenase subunit 2 (mitochondrion) [Glycine max]
Length=488

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSY GIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYVGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_004222802.1| NADH dehydrogenase subunit 2 [Vigna radiata]
 ref|YP_007889783.1| NADH dhydrogenase subunit 2 (mitochondrion) [Vigna angularis]
 gb|ADO19881.1| NADH dehydrogenase subunit 2 [Vigna radiata]
 dbj|BAN14994.1| NADH dhydrogenase subunit 2 (mitochondrion) [Vigna angularis]
Length=488

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSY GIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYVGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>ref|YP_008816026.1| NADH dehydrogenase subunit 2 (mitochondrion) [Closterium baillyanum]
 gb|AGZ90241.1| NADH dehydrogenase subunit 2 (mitochondrion) [Closterium baillyanum]
Length=532

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +G++TSVI  +   RF ++
Sbjct  420  LAITISITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGIITSVISCFYYIRFVKI  479

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  480  MYFDTPKTWILYKP  493



>gb|AGC78841.1| NADH dehydrogenase subunit 2 (mitochondrion) [Vicia faba]
Length=488

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFSITMFSY GIPPLAGFCSKFYLFFAALGCGAYFLA VGVVTSVIG +   R  +  
Sbjct  377  AITFSITMFSYVGIPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSVIGCFYYIRLAKRM  436

Query  190  KFGGPKA-VLRAP  225
             F  P+  +L  P
Sbjct  437  FFDTPRTWILYEP  449



>emb|CAC20844.1| NADH dehydrogenase subunit 2 [Pottia truncata]
Length=417

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFY FFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFCSKFYWFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC19870.1| NADH dehydrogenase subunit 2 [Buxbaumia aphylla]
Length=417

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SI MFSYAGIPPLAGFCSKFYLFFAALGCG+Y LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSIIMFSYAGIPPLAGFCSKFYLFFAALGCGSYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC20587.1| NADH dehydrogenase subunit 2 [Homalia trichomanoides]
Length=417

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT S TMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSNTMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>ref|YP_009047468.1| NADH dehydrogenase subunit 2 (mitochondrion) [Buxbaumia aphylla]
 gb|AGN74259.1| NADH dehydrogenase subunit 2 (mitochondrion) [Buxbaumia aphylla]
 gb|AHI16174.1| NADH dehydrogenase subunit 2 (mitochondrion) [Buxbaumia aphylla]
Length=489

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SI MFSYAGIPPLAGFCSKFYLFFAALGCG+Y LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSIIMFSYAGIPPLAGFCSKFYLFFAALGCGSYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>ref|NP_943686.1| NADH dehydrogenase subunit 2 [Chara vulgaris]
 gb|AAP92177.1| NADH dehydrogenase subunit 2 [Chara vulgaris]
Length=486

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFS AGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF +V
Sbjct  374  LAITMSITMFSLAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKV  433

Query  187  SKFGGPKA  210
              F  PK 
Sbjct  434  MYFETPKT  441



>ref|YP_006073022.1| nad2 gene product (mitochondrion) [Nitella hyalina]
 gb|AEH42837.1| NADH dehydrogenase subunit 2 (mitochondrion) [Nitella hyalina]
Length=488

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFS AGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF +V
Sbjct  376  LAITMSITMFSLAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKV  435

Query  187  SKFGGPKA  210
              F  PK 
Sbjct  436  MYFETPKT  443



>gb|AHI16172.1| NADH dehydrogenase subunit 2 (mitochondrion) [Bazzania trilobata]
Length=489

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGFCSKFYLFFAALGCGAY LA + VVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYLLALIRVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  437  MYFDTPETWILYKP  450



>gb|AAW63667.1| NADH dehydrogenase subunit 2 [Platanus occidentalis]
Length=134

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            AITFSITMFSYAGIPPLAGF SKFYLFFAALGCGAYFLA VGVVTSVI
Sbjct  87   AITFSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYFLAPVGVVTSVI  134



>gb|AAW63664.1| NADH dehydrogenase subunit 2 [Liriodendron tulipifera]
Length=135

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/48 (96%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            AITFSITMFSYAGIPPLAGF SKFYLFFAALGCGAYFLA VGVVTSVI
Sbjct  88   AITFSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYFLAPVGVVTSVI  135



>gb|AHI16168.1| NADH dehydrogenase subunit 2 (mitochondrion) [Andreaea rothii]
Length=489

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AIT SITMF YAGIPPLAGF SKFYLFFAALGCGAY LA +GV+TSVI R+   RF ++ 
Sbjct  378  AITLSITMFPYAGIPPLAGFRSKFYLFFAALGCGAYLLALIGVITSVISRFYYIRFVKIM  437

Query  190  KFGGPKA-VLRAP  225
             F  PK  +L  P
Sbjct  438  YFDTPKTWILYKP  450



>emb|CAC20152.1| NADH dehydrogenase subunit 2 [Encalypta streptocarpa]
Length=417

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGF SKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>emb|CAC19868.1| NADH dehydrogenase subunit 2 [Atrichum undulatum]
Length=421

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGF SKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  348  LAITLSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  407

Query  187  SKFGGPK  207
              F  PK
Sbjct  408  MYFDTPK  414



>ref|YP_009047547.1| NADH dehydrogenase subunit 2 (mitochondrion) [Atrichum angustatum]
 gb|AGN74338.1| NADH dehydrogenase subunit 2 (mitochondrion) [Atrichum angustatum]
 gb|AHI16170.1| NADH dehydrogenase subunit 2 (mitochondrion) [Atrichum angustatum]
Length=489

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGF SKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  436

Query  187  SKFGGPK  207
              F  PK
Sbjct  437  MYFDTPK  443



>emb|CAC50351.1| NADH dehydrogenase subunit 2 [Plagiochila asplenioides]
Length=417

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMF YAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITPSITMFPYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  404  MYFDTPETWILYKP  417



>gb|AAW63670.1| NADH dehydrogenase subunit 2 [Amborella trichopoda]
Length=142

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            +AIT SITMF YAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI
Sbjct  94   LAITLSITMFPYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVI  142



>ref|YP_006234244.1| nad2 gene product (mitochondrion) [Phlegmariurus squarrosus]
 gb|AEV55690.1| NADH dehydrogenase subunit 2 (mitochondrion) [Phlegmariurus squarrosus]
Length=489

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAGF SKFYLFFAALGCGAY LA VGVVTSVI  +   R  ++
Sbjct  377  LAITLSITMFSYAGIPPLAGFRSKFYLFFAALGCGAYLLALVGVVTSVISCFYYIRLVKI  436

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  437  MYFDTPKTWILYKP  450



>ref|YP_004935316.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene noctiflora]
 gb|AEM46221.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene noctiflora]
 gb|AJP34448.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene noctiflora]
Length=488

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITF+ITMFSYAGIPPLAGF SKFYLFFAAL CGAYFLASVG++TSVIG +   R  +  
Sbjct  377  AITFAITMFSYAGIPPLAGFGSKFYLFFAALSCGAYFLASVGIITSVIGCFYYIRLVKRI  436

Query  190  KFGGPKA-VLRAP  225
             F  PK  +L  P
Sbjct  437  FFDTPKTWILYQP  449



>ref|YP_006460152.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Erythranthe guttata]
 gb|AEK26540.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Erythranthe guttata]
Length=488

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSY GIPPLAGF SKFYLFFAAL CGAY LA VGVVTSVIGR+   R  + 
Sbjct  376  LAITFSITMFSYIGIPPLAGFFSKFYLFFAALACGAYLLALVGVVTSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>emb|CAC20113.1| NADH dehydrogenase subunit 2 [Diphyscium sessile]
Length=417

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMF YAGIPPLAGF SKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  344  LAITLSITMFPYAGIPPLAGFRSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  403

Query  187  SKFGGPK  207
              F  PK
Sbjct  404  MYFDTPK  410



>gb|ADT62143.1| NADH dehydrogenase subunit 2 (mitochondrion) [Isoetes engelmannii]
Length=487

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            + +T SITMFSYAGIPPLAGFCSKFYLFFAALGCGA+ LA +GVVTSVI  +   R  ++
Sbjct  375  LTLTLSITMFSYAGIPPLAGFCSKFYLFFAALGCGAHSLALIGVVTSVISCFYYIRLVKI  434

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  435  MYFDTPKIWILYEP  448



>ref|YP_008964105.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Ajuga reptans]
 gb|AHA84978.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ajuga reptans]
Length=488

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSY GIPPLAGF SKFYLFFAALGCGA FLA VGVV+SVIGR+   R  + 
Sbjct  376  LAITFSITMFSYVGIPPLAGFYSKFYLFFAALGCGATFLALVGVVSSVIGRFYYIRLAKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDTPRTWILYEP  449



>ref|YP_004935280.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene conica]
 gb|AEO21067.1| NADH dehydrogenase subunit 2 (mitochondrion) [Silene conica]
Length=488

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITFSITMFSYAGIPPLAGFCSKF LFFAALG GAY LASVG+VTSVIG +   R  + 
Sbjct  376  LAITFSITMFSYAGIPPLAGFCSKFSLFFAALGSGAYLLASVGIVTSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  P+  +L  P
Sbjct  436  MFFDKPRTWILYEP  449



>gb|ADG85359.1| NADH dehydrogenase subunit 2 [Silene noctiflora]
Length=488

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AITF+ITMFSYAGIPPLAGF SKFYLFFAAL CGAYFLA VG++TSVIG +   R  + 
Sbjct  376  LAITFAITMFSYAGIPPLAGFGSKFYLFFAALSCGAYFLALVGIITSVIGCFYYIRLVKR  435

Query  187  SKFGGPKA-VLRAP  225
              F  PK  +L  P
Sbjct  436  IFFDTPKTWILYQP  449



>ref|YP_008816105.1| NADH dehydrogenase subunit 2 (mitochondrion) [Microspora stagnorum]
 gb|AGZ90326.1| NADH dehydrogenase subunit 2 (mitochondrion) [Microspora stagnorum]
Length=483

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+T S+TMFS AGIPPLAGFCSKFYLFFAALGCGA  LA VGV+TSVI  +   RF +V
Sbjct  371  LALTLSMTMFSMAGIPPLAGFCSKFYLFFAALGCGAVLLALVGVLTSVISCFYYIRFVKV  430

Query  187  SKFGGPK  207
              F  PK
Sbjct  431  MYFETPK  437



>ref|YP_009120841.1| NADH dehydrogenase subunit 2 (mitochondrion) [Klebsormidium flaccidum]
 gb|AJF36698.1| NADH dehydrogenase subunit 2 (mitochondrion) [Klebsormidium flaccidum]
Length=483

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+T S+TMFS AGIPPLAGFCSKFYLFFAALGCGA  LA VGV+TSVI  +   RF +V
Sbjct  371  LALTLSMTMFSMAGIPPLAGFCSKFYLFFAALGCGAVLLALVGVLTSVISCFYYIRFVKV  430

Query  187  SKFGGPK  207
              F  PK
Sbjct  431  MYFETPK  437



>ref|XP_002534064.1| NADH dehydrogenase, putative [Ricinus communis]
 gb|EEF28319.1| NADH dehydrogenase, putative [Ricinus communis]
Length=83

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  49   IPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSKF  195
            IPPLAGFCSKFYLFFAALGCGAYFLA VGVVTS+IG W A R PR   +
Sbjct  31   IPPLAGFCSKFYLFFAALGCGAYFLAPVGVVTSIIGHWTARRLPRCDDW  79



>ref|YP_002860279.1| NADH dehydrogenase subunit 2 [Megaceros aenigmaticus]
 gb|ACC86802.1| NADH dehydrogenase subunit 2 [Nothoceros aenigmaticus]
Length=487

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    RRVAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            R +AIT  ITMFSYAGIPPLAGFCSKFYLF AA GCGAY LA VG+VTSVI  +   RF 
Sbjct  373  RILAITLPITMFSYAGIPPLAGFCSKFYLFSAAPGCGAYSLAFVGIVTSVISCFHYIRFV  432

Query  181  RVSKFGGPKA  210
            ++  F  P+ 
Sbjct  433  KIMYFDTPET  442



>emb|CAC21203.1| NADH dehydrogenase subunit 2 [Takakia lepidozioides]
Length=417

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AIT SITMF YAGIPPLAGF SKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++ 
Sbjct  345  AITPSITMFPYAGIPPLAGFRSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKIM  404

Query  190  KFGGPKA  210
             F  PK 
Sbjct  405  YFDTPKT  411



>emb|CAC48190.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Lycopodium 
annotinum]
Length=417

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMFSYAGIPPLAG  SKFYLFFAALGCGAY LASVGVVTSVI  +   R  ++
Sbjct  344  LAITLSITMFSYAGIPPLAGSRSKFYLFFAALGCGAYLLASVGVVTSVISCFYYIRLVKI  403

Query  187  SKFGGPKA-VLRAP  225
                 PK  +L  P
Sbjct  404  MYSDTPKTWILYKP  417



>gb|ABC67258.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Huperzia 
selago]
Length=63

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  13   ITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSK  192
            IT SITMFSYAGIPPLAG  SKFYLFFAALGCGAY LA VGVVTSVI  +   R  ++  
Sbjct  1    ITLSITMFSYAGIPPLAGSRSKFYLFFAALGCGAYLLALVGVVTSVISCFYYIRLVKIMY  60

Query  193  FG  198
            F 
Sbjct  61   FD  62



>emb|CAC50074.1| NADH dehydrogenase subunit 2 [Haplomitrium mnioides]
Length=414

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT  IT F YAGIPPLAGFCSKFYLFFAALGCGAY LA +GVVTSVI  +   RF ++
Sbjct  341  LAITPPITTFPYAGIPPLAGFCSKFYLFFAALGCGAYLLALIGVVTSVISCFYYIRFVKI  400

Query  187  SKFGGPK  207
                 PK
Sbjct  401  MYSDTPK  407



>ref|YP_003412119.1| NADH dehydrogenase subunit 2 (mitochondrion) [Phaeoceros laevis]
 gb|ACT75327.1| NADH dehydrogenase subunit 2 [Phaeoceros laevis]
Length=487

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    RRVAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            R +AIT SITM  YAGI  LAGFCSKFYLFFAALGCGAY LA VG+VTSV  R+   RF 
Sbjct  373  RILAITLSITMSPYAGILLLAGFCSKFYLFFAALGCGAYSLAFVGIVTSVTSRFYYIRFV  432

Query  181  RVSKFGGPKA  210
            ++  F  P+ 
Sbjct  433  KIMYFDTPET  442



>emb|CAC50078.1| NADH dehydrogenase subunit 2 [Phaeoceros laevis]
Length=423

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  1    RRVAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            R +AIT SITM  YAGI  LAGFCSKFYLFFAALGCGAY LA VG+VTSV  R+   RF 
Sbjct  340  RILAITLSITMSPYAGILLLAGFCSKFYLFFAALGCGAYSLAFVGIVTSVTSRFYYIRFV  399

Query  181  RVSKFGGPKA  210
            ++  F  P+ 
Sbjct  400  KIMYFDTPET  409



>gb|ADG85361.1| NADH dehydrogenase subunit 2 [Silene paradoxa]
 gb|ADG85362.1| NADH dehydrogenase subunit 2 [Silene vulgaris]
Length=154

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA  126
            +AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA
Sbjct  114  LAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA  153



>ref|YP_008816070.1| NADH dehydrogenase subunit 2 (mitochondrion) [Entransia fimbriata]
 gb|AGZ90291.1| NADH dehydrogenase subunit 2 (mitochondrion) [Entransia fimbriata]
Length=573

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+T SI MFS AGIPPLAGF SKFYLFFAALGCGAY LA VG++TSVI  +   RF + 
Sbjct  408  LAVTLSINMFSLAGIPPLAGFFSKFYLFFAALGCGAYLLALVGIITSVISCFYYIRFIKT  467

Query  187  SKFGGPKAVLRAPDT*LTKSVATRMGMH  270
              F  P+   R  D  L  +  ++  +H
Sbjct  468  IYFTYPQ---RGCDAHLVINQTSQAMLH  492



>ref|XP_006380080.1| hypothetical protein POPTR_0008s21700g, partial [Populus trichocarpa]
 gb|ERP57877.1| hypothetical protein POPTR_0008s21700g, partial [Populus trichocarpa]
Length=95

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/39 (97%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA  126
            AITFSITMFSYAGIPPL GFCSKFYLFFAALGCGAYFLA
Sbjct  57   AITFSITMFSYAGIPPLFGFCSKFYLFFAALGCGAYFLA  95



>gb|AEA11188.1| NADH dehydrogenase subunit 2 (mitochondrion) [Selaginella moellendorffii]
 gb|AEA29868.1| NADH dehydrogenase subunit 2 (mitochondrion) [Selaginella moellendorffii]
Length=501

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AITFS+TMFSYAGIPPLAGFCSKFYLFF A+ CGA  LA +GVVTSVI  +   R  ++ 
Sbjct  379  AITFSLTMFSYAGIPPLAGFCSKFYLFFGAIRCGADVLAGLGVVTSVISCFYYLRLVKLM  438

Query  190  KFGGPKAVLRAP  225
             F  P   +  P
Sbjct  439  YFDLPGEYMIPP  450



>ref|NP_689374.1| NADH dehydrogenase subunit 2 [Chaetosphaeridium globosum]
 gb|AAM96605.1|AF494279_10 NADH dehydrogenase subunit 2 [Chaetosphaeridium globosum]
Length=477

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT +ITMFSYAGIPPLAGFCSKFYLFFAALG G   LA +GVVTSVI  +   RF ++
Sbjct  367  LAITLAITMFSYAGIPPLAGFCSKFYLFFAALGSGLGLLAFIGVVTSVISCFYYIRFVKI  426

Query  187  SKFGGPKAVLRAPD  228
              F     +    D
Sbjct  427  MYFDTAWILFEPMD  440



>ref|YP_008816165.1| NADH dehydrogenase subunit 2 (mitochondrion) [Roya obtusa]
 gb|AGZ90373.1| NADH dehydrogenase subunit 2 (mitochondrion) [Roya obtusa]
Length=542

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+T S+TMFSYAGIPPLAGFCSKFYLFFAALG G Y LA +G++TSVI  +   R  ++
Sbjct  426  LALTLSLTMFSYAGIPPLAGFCSKFYLFFAALGSGIYLLAFIGIITSVISCFYYIRIVKI  485

Query  187  SKFGGPK  207
              F  PK
Sbjct  486  MYFDIPK  492



>gb|AAW63672.1| NADH dehydrogenase subunit 2 [Zamia integrifolia]
Length=90

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVI  153
            AIT SITMF YAGIPPLAGF SKFYLF AALGCGAY  A +GVVTSVI
Sbjct  43   AITSSITMFPYAGIPPLAGFRSKFYLFSAALGCGAYLPALMGVVTSVI  90



>gb|ABC67256.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Asplenium 
scolopendrium]
Length=49

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  13   ITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGR  159
            IT S+TM  YAGIPPLAGF SKF+LFFAA  CGAY LA +G+VTSVI R
Sbjct  1    ITLSVTMSLYAGIPPLAGFRSKFHLFFAAPSCGAYSLALIGIVTSVISR  49



>gb|ADG85360.1| NADH dehydrogenase subunit 2 [Silene conica]
Length=154

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLA  126
            +AITFSITMFSYAGIPPLAGFCSKF LFFAALG GAY LA
Sbjct  114  LAITFSITMFSYAGIPPLAGFCSKFSLFFAALGSGAYLLA  153



>ref|YP_001661394.1| NADH dehydrogenase subunit 2 [Cycas taitungensis]
 dbj|BAF98431.1| NADH dehydrogenase subunit 2 [Cycas taitungensis]
Length=490

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            AI  SITMF YAGIPPLAG  SKFYLF AA GCGAY  A +GVVTSVIGR+   R  ++ 
Sbjct  379  AIISSITMFPYAGIPPLAGLRSKFYLFSAASGCGAYLPALMGVVTSVIGRFYYIRSAKIM  438

Query  190  KFGGP  204
                P
Sbjct  439  YLDTP  443



>gb|AGZ19396.1| NADH dehydrogenase subunit 2 (mitochondrion) (mitochondrion) 
[Chlorella sp. ArM0029B]
Length=519

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TF+ITMFS AGIPPLAGF SK YLFFAA+    Y LA +GV+ SV+  +   R  +V
Sbjct  407  LALTFTITMFSMAGIPPLAGFYSKAYLFFAAMSSNLYVLAVIGVLCSVLSCFYYIRLVKV  466

Query  187  SKFGGPK  207
              F GPK
Sbjct  467  MYFEGPK  473



>emb|CAC50070.1| NADH dehydrogenase subunit 2 [Anthoceros agrestis]
Length=414

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT SITMF YAGI  LAGF SKFYLFFAALGC AY LA +G+VTSV   +   RF ++
Sbjct  342  LAITPSITMFLYAGILLLAGFRSKFYLFFAALGCEAYSLAFIGIVTSVTSCFYYIRFVKI  401

Query  187  SKFGGPK  207
              F  P+
Sbjct  402  MYFDTPE  408



>ref|YP_002860127.1| NADH dehydrogenase subunit 2 (mitochondrion) [Micromonas sp. 
RCC299]
 gb|ACO55591.1| NADH dehydrogenase subunit 2 (mitochondrion) [Micromonas sp. 
RCC299]
Length=500

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TFS T+FS AGIPPLAGFCSKFYLFFAA+G   Y LA  GV++SV+  +   R  ++
Sbjct  388  LALTFSCTLFSMAGIPPLAGFCSKFYLFFAAMGSSLYGLALFGVLSSVVSCFYYIRLIKI  447

Query  187  SKFGGPKAV  213
              F  P  +
Sbjct  448  MYFEQPSQL  456



>ref|WP_028836600.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-L05]
Length=494

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A TFS T+FS AGIPPLAGFCSKFYLFFAA+G   Y LA  GV++SV+  +   R  ++
Sbjct  382  LAFTFSCTLFSMAGIPPLAGFCSKFYLFFAAMGSSLYGLALFGVLSSVVSCFYYIRLIKI  441

Query  187  SKFGGPKAVLR  219
              F  P  ++ 
Sbjct  442  MYFEQPSQLIT  452



>ref|YP_009094924.1| NADH dehydrogenase subunit 2 (mitochondrion) [Chlorella variabilis]
 gb|AIU38967.1| NADH dehydrogenase subunit 2 (mitochondrion) [Chlorella variabilis]
 gb|AJP09426.1| NADH dehydrogenase subunit 2 (mitochondrion) [Chlorella variabilis]
Length=519

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TF+IT+FS AGIPPLAGF SK YLFFAA+    Y LA +GV+ SV+  +   R  ++
Sbjct  407  LALTFTITLFSMAGIPPLAGFYSKAYLFFAAMSSNLYVLAVIGVLCSVLSCFYYIRLVKI  466

Query  187  SKFGGPK  207
              F GPK
Sbjct  467  MYFEGPK  473



>gb|ABC67255.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Isoetes 
velata]
Length=63

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  13   ITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGR  159
            +T SITMF YAGIP LAGF SK +   AALGCGA+ LA +GVVTSVI R
Sbjct  1    LTLSITMFPYAGIPLLAGFRSKSHSSLAALGCGAHSLALIGVVTSVISR  49



>ref|YP_009112909.1| NADH dehydrogenasesubunit 2 (mitochondrion) [Auxenochlorella 
protothecoides]
 gb|AGN72420.1| NADH dehydrogenasesubunit 2 (mitochondrion) [Auxenochlorella 
protothecoides]
Length=518

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A TFSI MFS AGIPPLAGF SK Y+FFAALG     LA VGV TSV+  +   R  R+
Sbjct  406  LAFTFSIAMFSMAGIPPLAGFYSKAYIFFAALGSNLGVLAVVGVCTSVVSCFYYLRLIRI  465

Query  187  SKFGGPK---AVLRAPDT  231
              F  PK   +  R P T
Sbjct  466  MYFSTPKTWCSTARVPRT  483



>ref|YP_009049990.1| NADH dehydrogenase subunit 2 (mitochondrion) [Chlorella sorokiniana]
 gb|AII02124.1| NADH dehydrogenase subunit 2 (mitochondrion) [Chlorella sorokiniana]
Length=519

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TF++T+FS AGIPPLAGF SK YLFFAAL    Y +A +GV+ SV+  +   R  ++
Sbjct  407  LALTFTVTLFSMAGIPPLAGFYSKAYLFFAALSSNLYLVAVIGVLCSVLSCFYYIRLVKI  466

Query  187  SKFGGPK  207
              F  PK
Sbjct  467  MYFEAPK  473



>gb|AIM56874.1| NADH dehydrogenase subunit 2 (mitochondrion) [Chlorella sorokiniana]
Length=377

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+TF++T+FS AGIPPLAGF SK YLFFAAL    Y +A +GV+ SV+  +   R  ++
Sbjct  265  LALTFTVTLFSMAGIPPLAGFYSKAYLFFAALSSNLYLVAVIGVLCSVLSCFYYIRLVKI  324

Query  187  SKFGGPK  207
              F  PK
Sbjct  325  MYFEAPK  331



>ref|YP_008994797.2| NADH dehydrogenase subunit 2 (mitochondrion) [Bathycoccus prasinos]
Length=499

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A + ++TMFS AGIPPLAGFCSKFYLFFAAL    YFLA  G+++S++  +   R  + 
Sbjct  387  LAFSLTLTMFSMAGIPPLAGFCSKFYLFFAALSSSLYFLAVFGILSSMLSCFYYLRVIKT  446

Query  187  SKFGGPKA  210
              F   K 
Sbjct  447  MYFDQSKQ  454



>emb|CCO13931.1| NADH dehydrogenase subunit 2 (Partial), partial [Bathycoccus 
prasinos]
Length=493

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A + ++TMFS AGIPPLAGFCSKFYLFFAAL    YFLA  G+++S++  +   R  + 
Sbjct  387  LAFSLTLTMFSMAGIPPLAGFCSKFYLFFAALSSSLYFLAVFGILSSMLSCFYYLRVIKT  446

Query  187  SKFGGPKA  210
              F   K 
Sbjct  447  MYFDQSKQ  454



>ref|WP_038367685.1| NADH:ubiquinone oxidoreductase subunit N [Bosea sp. UNC402CLCol]
Length=475

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A   S+ MFS AGIPPLAGF +KFY+F AA+    Y LA VGV+TSV+G +   R  +V
Sbjct  366  MAFALSMMMFSLAGIPPLAGFWAKFYVFLAAIDAKLYTLAVVGVLTSVVGAYYYLRLVKV  425

Query  187  SKFGGPKAVLRAPD  228
              F  PK      D
Sbjct  426  MYFDDPKPAFERSD  439



>gb|ABX82544.1| NADH dehydrogenase subunit 2 [Trebouxia aggregata]
Length=522

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A T +++MFS AGIPPLAGF SK +LFFAAL    Y LA +GV+TSV+  +   R  ++
Sbjct  410  LAFTLTVSMFSIAGIPPLAGFYSKAFLFFAALSSNLYLLAVIGVLTSVVSCFYYIRVVKI  469

Query  187  SKFGGPK  207
              F  PK
Sbjct  470  MYFENPK  476



>emb|CAC50076.1| NADH dehydrogenase subunit 2, partial (mitochondrion) [Isoetes 
durieui]
Length=415

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  13   ITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSK  192
            +T SITMF YAGIP LAGF SK +   AALGCGA+ LA +GVVTSVI R    R  ++  
Sbjct  344  LTLSITMFPYAGIPLLAGFRSKSHSSLAALGCGAHSLALIGVVTSVISRSHYIRSVKIMY  403

Query  193  FGGPK  207
               PK
Sbjct  404  PDTPK  408



>gb|ACI02101.1| NADH dehydrogenase subunit 2 (mitochondrion) [Isoetes engelmannii]
Length=487

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  13   ITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSK  192
            +T SITMF YAGIP LAGF SK +   AALGCGA+ LA +GVVTSVI R    R  ++  
Sbjct  377  LTLSITMFPYAGIPLLAGFRSKSHSSLAALGCGAHSLALIGVVTSVISRSHYIRSVKIMY  436

Query  193  FGGPK  207
               PK
Sbjct  437  PDTPK  441



>ref|XP_003616255.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula]
 gb|AES99213.1| transmembrane protein, putative [Medicago truncatula]
Length=93

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  115  YFLASVGVVTSVIGRWAAGRFPRVSKFGGPKAVLRAPDT  231
            +F   + ++ SVIG WAAGR PRVS+FGGPKAVLRAPDT
Sbjct  55   FFFVCIYIIISVIGCWAAGRLPRVSQFGGPKAVLRAPDT  93



>gb|ACI95887.1| NADH dehydrogenase subunit 2 (mitochondrion) [Isoetes engelmannii]
Length=487

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  13   ITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSK  192
            +T SITMF YAGIP LAGF SK +   AALGCGA+ LA +GVVTSVI R    R  ++  
Sbjct  377  LTLSITMFPYAGIPLLAGFRSKSHSSLAALGCGAHSLALIGVVTSVISRSHYIRSVKIMY  436

Query  193  FGGPK  207
               PK
Sbjct  437  PDTPK  441



>ref|WP_028837851.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-D06]
Length=498

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT ++ MFS AG+PPLAGFC+K Y+FF+A+    Y LA+VGV+TS +G +   R  ++
Sbjct  386  MAITIALGMFSMAGVPPLAGFCAKMYIFFSAMEASMYTLATVGVLTSCVGSYYYIRLIKI  445

Query  187  SKF  195
              F
Sbjct  446  MFF  448



>ref|YP_006280965.1| nad2 gene product (mitochondrion) [Helicosporidium sp. ex Simulium 
jonesi]
 gb|ACT36191.1| NADH dehydrogenase subunit 2 (mitochondrion) [Helicosporidium 
sp. ex Simulium jonesi]
Length=543

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +AIT +IT+FS AGIPPLAGF SK YLFFAAL      LA +GV+TSV   +   R  R+
Sbjct  431  LAITLAITLFSMAGIPPLAGFYSKAYLFFAALSNDLGLLAIIGVLTSVCSCFYYIRLIRI  490

Query  187  SKFGGPK  207
              F  PK
Sbjct  491  MYFTTPK  497



>ref|YP_665650.1| NADH dehydrogenase subunit 2 (mitochondrion) [Nephroselmis olivacea]
 gb|AAF03177.1|AF110138_9 NADH dehydrogenase subunit 2 (mitochondrion) [Nephroselmis olivacea]
Length=496

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+T S+ +FS AGIPPLAGF +K+Y+F AA+  G Y+LA++GV+TSVI  +   R  ++
Sbjct  384  IAVTMSMILFSMAGIPPLAGFFAKYYIFLAAIESGWYWLATIGVLTSVISCFYYIRIMKI  443

Query  187  SKFGGPKAVLRAPDT*LTKSVATRM  261
              F   K  +        KSV   M
Sbjct  444  MYFEKRKGWIYTQGVDREKSVILAM  468



>ref|WP_026987514.1| NADH-quinone oxidoreductase subunit N [Fodinicurvata fenggangensis]
Length=483

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+  +I MFS AGIPPLAGF  K Y+F AA+  G Y LA +GV+TSVI  +   R  +V
Sbjct  369  IALALAIFMFSMAGIPPLAGFFGKLYVFLAAVESGLYILAVIGVLTSVISAFYYLRIIKV  428

Query  187  SKFGGPKAVLRAP  225
              F  P      P
Sbjct  429  MYFDEPSEAFDQP  441



>ref|WP_022728999.1| NADH:ubiquinone oxidoreductase subunit N [Fodinicurvata sediminis]
Length=483

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+  +I MFS AGIPPLAGF  K Y+F AA+  G Y LA +GV+TSVI  +   R  +V
Sbjct  369  IALALAIFMFSMAGIPPLAGFFGKLYVFLAAVESGLYILAVIGVLTSVISAFYYLRIIKV  428

Query  187  SKFGGPKAVLRAP  225
              F  P      P
Sbjct  429  MYFDEPSEAFDQP  441



>ref|NP_042274.1| NADH dehydrogenase (ubiquinone), subunit 2 [Prototheca wickerhamii]
 gb|AAD12662.1| NADH dehydrogenase (ubiquinone), subunit 2 [Prototheca wickerhamii]
Length=510

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A TFSIT+FS AGIPPLAGF SK Y+FFAALG      A VGV  SV+  +   R  R+
Sbjct  399  LAFTFSITLFSMAGIPPLAGFYSKAYIFFAALGSNLGVCAVVGVCASVVSCFYYLRLIRI  458

Query  187  SKFGGPK---AVLRAPDT  231
              F  PK   +  R P T
Sbjct  459  MYFSTPKTWCSTARVPRT  476



>ref|WP_018391209.1| NADH:ubiquinone oxidoreductase subunit N [Ancylobacter sp. FA202]
Length=475

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  10   AITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVS  189
            A   ++ MFS AGIPPLAGF +K+Y+F AA+  G Y LA +GV+TSV+G +   R  ++ 
Sbjct  367  AFMLAVLMFSLAGIPPLAGFLAKYYVFLAAIESGLYALAVIGVLTSVVGAFYYLRIVKIM  426

Query  190  KFGGPKA  210
             F  P A
Sbjct  427  YFDEPAA  433



>emb|CBK23821.2| unnamed protein product [Blastocystis hominis]
Length=494

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +1

Query  1    RRVAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFP  180
            + + ++F ITMFS AG+PP+AGF +KFY FF  +    Y LA++GV+ S+I  +   RF 
Sbjct  379  KTLGMSFIITMFSMAGVPPMAGFLAKFYSFFVCIENNFYLLATIGVLLSIICTFYYIRFL  438

Query  181  RVSKFGGPKAVLRAPDT*LTKSVA  252
            ++  F   K  +   +  L+K+VA
Sbjct  439  KIIYFENTKKYITL-NINLSKNVA  461



>ref|WP_043831494.1| NADH-quinone oxidoreductase subunit N [Roseomonas aerilata]
Length=473

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+  +I MFS AGIPPLAGF SK Y+F AA+  G + LA+VGV+TSV+G +   R  ++
Sbjct  363  MALAMAIFMFSMAGIPPLAGFFSKLYVFLAAVQEGYWVLATVGVLTSVVGAYYYLRIIKI  422

Query  187  SKFGGPKAVLR  219
              F   +A L 
Sbjct  423  MYFDTAEAALD  433



>ref|WP_027841396.1| NADH:ubiquinone oxidoreductase subunit N [Mastigocoleus testarum]
Length=472

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A   ++ MFS AGIPPLAGF +K+Y+F AA+  G Y LA +GV+ SV+G +   R  +V
Sbjct  362  LAFVMAMLMFSLAGIPPLAGFFAKYYVFLAAIEAGLYALAIIGVLASVVGAYYYLRIVKV  421

Query  187  SKFGGPKAVLRAP  225
              F  P A    P
Sbjct  422  MYFDEPAAPFEQP  434



>ref|WP_012974700.1| NADH:ubiquinone oxidoreductase subunit N [Azospirillum lipoferum]
 dbj|BAI72773.1| NADH dehydrogenase I chain N [Azospirillum sp. B510]
Length=482

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A T +I MFS AGIPP+AGF  K Y+F AA+    Y LA VGV+TSV+G +   R  ++
Sbjct  370  LAATMAIFMFSMAGIPPMAGFFGKLYVFLAAIAAQEYTLAVVGVLTSVVGAFYYLRIIKI  429

Query  187  SKFGGPKAVLRAPD  228
              F  P  V+   D
Sbjct  430  MYFDEPALVVDKVD  443



>ref|WP_020178860.1| hypothetical protein [Methylopila sp. M107]
Length=478

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A   ++ +FS AGIPPLAGF +KFY+FFAA+  G Y LA +G V SV+G +   R  ++
Sbjct  369  MAFVLAMILFSLAGIPPLAGFFAKFYVFFAAVNAGLYPLAVIGFVLSVVGAFYYLRIVKI  428

Query  187  SKFGGPKAVLRAPDT*LTKSVATRMG  264
              F  P  V  AP T   K V T  G
Sbjct  429  IYFDEPT-VEFAPMTGAAKLVLTVAG  453



>ref|XP_003637898.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula]
 gb|KEH17051.1| hypothetical protein MTR_0049s0100 [Medicago truncatula]
Length=61

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  209  QFSVHRTRSLPNQLRHGWECMLRKIGL  289
            QFSVHRTRSLPNQLRH WECMLRKIG+
Sbjct  35   QFSVHRTRSLPNQLRHRWECMLRKIGV  61



>ref|WP_038279122.1| NADH:ubiquinone oxidoreductase subunit N, partial [alpha proteobacterium 
Mf 1.05b.01]
Length=480

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A  F++ MFS AGIPPLAGF +KFY+F AA+  G Y LA +GV+ SV+G +   R  ++
Sbjct  371  LAAVFAMLMFSLAGIPPLAGFFAKFYVFLAAINAGLYALAIIGVLASVVGAFYYLRVVKI  430

Query  187  SKFGGPKAVLRAP  225
              F  P      P
Sbjct  431  IYFDDPAPAFAGP  443



>ref|YP_717298.1| nad2 (mitochondrion) [Ostreococcus tauri]
 emb|CAL36420.1| unnamed protein product (mitochondrion) [Ostreococcus tauri]
Length=497

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            VA  F +  FS AGIPPLAGFC+KFY+FFAALG   YF  +V + +S++  +   RF + 
Sbjct  384  VACAFVLNFFSMAGIPPLAGFCAKFYVFFAALGASLYFFVAVALFSSIVSCFYYLRFIKF  443

Query  187  SKFGGPKAV  213
              F    +V
Sbjct  444  MYFHKETSV  452



>gb|AGR42885.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR43057.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR43143.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR43229.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
Length=497

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            VA  F +  FS AGIPPLAGFC+KFY+FFAALG   YF  +V + +S++  +   RF + 
Sbjct  384  VACAFVLNFFSMAGIPPLAGFCAKFYVFFAALGASLYFFVAVALFSSIVSCFYYLRFIKF  443

Query  187  SKFGGPKAV  213
              F    +V
Sbjct  444  MYFHKETSV  452



>gb|AGR42713.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR42756.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR42799.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR42842.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR42928.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR42971.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR43014.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR43100.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
 gb|AGR43186.1| NADH dehydrogenase subunit 2 (mitochondrion) [Ostreococcus tauri]
Length=497

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            VA  F +  FS AGIPPLAGFC+KFY+FFAALG   YF  +V + +S++  +   RF + 
Sbjct  384  VACAFVLNFFSMAGIPPLAGFCAKFYVFFAALGASLYFFVAVALFSSIVSCFYYLRFIKF  443

Query  187  SKFGGPKAV  213
              F    +V
Sbjct  444  MYFHKETSV  452



>ref|YP_665693.1| NADH dehydrogenase subunit 2 [Mesostigma viride]
 gb|AAL36732.1|AF353999_12 NADH dehydrogenase subunit 2 [Mesostigma viride]
Length=497

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            VA++ ++ +FS AGIPPLAGF SKFYLF  AL      LA +GV+TSVI  +   R  R+
Sbjct  384  VALSLALILFSMAGIPPLAGFLSKFYLFRIALASQFTSLAILGVITSVITSYYYIRLVRI  443

Query  187  SKFGGP  204
              FG P
Sbjct  444  MYFGKP  449



>ref|WP_037263396.1| hypothetical protein [Rhodospirillales bacterium URHD0088]
Length=482

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A    I MFS AGIPPLAGF SK Y+F AA+  G Y LA +GVVTSV+G +   R  ++
Sbjct  370  LAAALCIFMFSMAGIPPLAGFLSKLYVFMAAIDAGLYPLAVIGVVTSVVGAFYYLRIVKL  429

Query  187  SKFGGPKAVLRAP  225
              F     V   P
Sbjct  430  MYFDEATGVFDQP  442



>dbj|GAK44556.1| proton-translocating NADH-quinone oxidoreductase subunit N [alpha 
proteobacterium MA2]
Length=484

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A  FS+ MFS AG+PPLAGF +K+++F +A+  G Y LA +GV++SV+G +   R  +V
Sbjct  373  LAFLFSMLMFSLAGVPPLAGFFAKYFVFLSAIEAGLYTLAVIGVLSSVVGAFYYLRVVKV  432

Query  187  SKFGGPKAVLRAP  225
              F  P     AP
Sbjct  433  IYFDEPAQPFEAP  445



>dbj|GAN48061.1| proton-translocating NADH-quinone oxidoreductase subunit N [Methylobacterium 
sp. ME121]
Length=481

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  31   MFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSKFGGPK  207
            MFS AGIPPLAGF +KFY+F AA+  G   LA +GVVTSVIG +   R  R+  F  PK
Sbjct  380  MFSLAGIPPLAGFFAKFYVFAAAIKAGLVTLAVIGVVTSVIGAYYYLRVVRIMYFDEPK  438



>ref|WP_018038576.1| hypothetical protein [alpha proteobacterium SCGC AB-629-G21]
Length=470

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            VA++F I +FS AGIPP+AGF +KFY+F A +    Y LA +G+VT+V+  +   R  ++
Sbjct  362  VALSFLIILFSLAGIPPMAGFFAKFYVFMAVIEVKMYALAIIGLVTTVVSAFYYLRIIKI  421

Query  187  SKFGGPK  207
              F  PK
Sbjct  422  IYFDKPK  428



>ref|WP_024575301.1| MULTISPECIES: NADH:ubiquinone oxidoreductase subunit N [Afipia]
Length=475

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  19   FSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSKFG  198
            F++ +FS AGIPPLAGF +KFY+F AA+  G + LA +GVVTSV+G +      +V  F 
Sbjct  370  FAMLLFSLAGIPPLAGFFAKFYVFLAAIKAGLFTLAVIGVVTSVVGAFYYLTIVKVMYFD  429

Query  199  GPK  207
             PK
Sbjct  430  EPK  432



>ref|YP_001315136.1| NADH dehydrogenase subunit 2 [Chlorokybus atmophyticus]
 gb|ABO15102.1| NADH dehydrogenase subunit 2 [Chlorokybus atmophyticus]
Length=509

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRV  186
            +A+T +  +FS AGIPPLAGF  KFYLFF AL    Y LA +GVVTSVI  +   R  ++
Sbjct  397  LALTLTAVLFSIAGIPPLAGFFGKFYLFFTALSASLYLLAVIGVVTSVISCFYYIRLVKI  456

Query  187  SKF  195
              F
Sbjct  457  MYF  459



>ref|WP_013166657.1| NADH:ubiquinone oxidoreductase subunit N [Starkeya novella]
 gb|ADH89153.1| proton-translocating NADH-quinone oxidoreductase, chain N [Starkeya 
novella DSM 506]
Length=475

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  31   MFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSKFGGP  204
            MFS AGIPPLAGF +K+Y+F AA+  G Y LA +GV+TSV+G +   R  +V  F  P
Sbjct  374  MFSLAGIPPLAGFLAKYYIFLAAIEAGLYTLAVIGVLTSVVGAFYYLRIVKVMYFDEP  431



>gb|KCW68351.1| hypothetical protein EUGRSUZ_F02010 [Eucalyptus grandis]
Length=132

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  7    VAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGV  138
            +AITFSITMFSYA IPPL G+CSKFY+FF A+    +    V +
Sbjct  55   LAITFSITMFSYARIPPLVGYCSKFYVFFIAIPMNNFLFFPVDI  98



>ref|WP_011158486.1| NADH:ubiquinone oxidoreductase subunit N [Rhodopseudomonas palustris]
 emb|CAE28378.1| NADH-ubiquinone dehydrogenase chain N [Rhodopseudomonas palustris 
CGA009]
Length=479

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  19   FSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSKFG  198
            F++ +FS+AGIPPLAGF +KFY+F AA+  G + LA +GVVTSV+G +      +V  F 
Sbjct  374  FAMLLFSFAGIPPLAGFFAKFYVFMAAIKAGMFVLAVIGVVTSVVGAYYYLAIVKVMYFD  433

Query  199  GP  204
             P
Sbjct  434  EP  435



>ref|WP_011472866.1| NADH:ubiquinone oxidoreductase subunit N [Rhodopseudomonas palustris]
 gb|ABD87969.1| Proton-translocating NADH-quinone oxidoreductase, chain N [Rhodopseudomonas 
palustris BisB18]
Length=478

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  4    RVAITFSITMFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPR  183
            ++A  F++ +FS AGIPPLAGF +KFY+F AA+  G + LA +GVV SVIG +      +
Sbjct  368  QLAFFFAVLLFSLAGIPPLAGFFAKFYVFVAAIKAGLFTLAIIGVVASVIGAYYYLSIVK  427

Query  184  VSKFGGPK  207
            V  F  PK
Sbjct  428  VMYFDEPK  435



>ref|WP_024830240.1| NADH:ubiquinone oxidoreductase subunit N [Methylobacterium sp. 
EUR3 AL-11]
Length=481

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  31   MFSYAGIPPLAGFCSKFYLFFAALGCGAYFLASVGVVTSVIGRWAAGRFPRVSKFGGPK  207
            MFS AGIPPLAGF +KFY+F AA+  G   LA +GVVTSV+G +   R  R+  F  PK
Sbjct  380  MFSLAGIPPLAGFFAKFYVFAAAIKAGLVTLAVIGVVTSVVGAYYYLRVVRIMYFDEPK  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800