BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP019E06 466 bp,

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075483.1|  PREDICTED: 40S ribosomal protein S9-2              265   6e-87   Sesamum indicum [beniseed]
ref|NP_001275235.1|  uncharacterized protein LOC102577830               263   4e-86   Solanum tuberosum [potatoes]
ref|XP_010256989.1|  PREDICTED: 40S ribosomal protein S9-2-like         262   6e-86   Nelumbo nucifera [Indian lotus]
ref|XP_004135180.1|  PREDICTED: 40S ribosomal protein S9-2-like         262   7e-86   Cucumis sativus [cucumbers]
ref|XP_011098613.1|  PREDICTED: 40S ribosomal protein S9-2              261   8e-86   Sesamum indicum [beniseed]
ref|XP_011085760.1|  PREDICTED: 40S ribosomal protein S9-2-like         261   9e-86   Sesamum indicum [beniseed]
ref|XP_004228395.1|  PREDICTED: 40S ribosomal protein S9-2              261   2e-85   Solanum lycopersicum
gb|KCW87774.1|  hypothetical protein EUGRSUZ_A00153                     259   2e-85   Eucalyptus grandis [rose gum]
gb|KCW56192.1|  hypothetical protein EUGRSUZ_I01938                     259   2e-85   Eucalyptus grandis [rose gum]
ref|XP_004238784.1|  PREDICTED: 40S ribosomal protein S9-2              261   2e-85   Solanum lycopersicum
ref|XP_002517490.1|  40S ribosomal protein S9, putative                 261   2e-85   Ricinus communis
ref|XP_010029297.1|  PREDICTED: 40S ribosomal protein S9-2              260   2e-85   Eucalyptus grandis [rose gum]
ref|XP_010029477.1|  PREDICTED: 40S ribosomal protein S9-2              260   3e-85   Eucalyptus grandis [rose gum]
emb|CDP02222.1|  unnamed protein product                                260   3e-85   Coffea canephora [robusta coffee]
ref|XP_010037164.1|  PREDICTED: 40S ribosomal protein S9-2-like         260   3e-85   Eucalyptus grandis [rose gum]
ref|XP_002283256.1|  PREDICTED: 40S ribosomal protein S9-2              260   3e-85   Vitis vinifera
ref|XP_010091216.1|  40S ribosomal protein S9-2                         260   4e-85   Morus notabilis
gb|KCW56189.1|  hypothetical protein EUGRSUZ_I01938                     259   6e-85   Eucalyptus grandis [rose gum]
gb|EYU34659.1|  hypothetical protein MIMGU_mgv1a014209mg                259   7e-85   Erythranthe guttata [common monkey flower]
gb|KDP31233.1|  hypothetical protein JCGZ_11609                         259   8e-85   Jatropha curcas
gb|KDP41175.1|  hypothetical protein JCGZ_15582                         259   9e-85   Jatropha curcas
ref|XP_009600364.1|  PREDICTED: 40S ribosomal protein S9-2-like         258   1e-84   Nicotiana tomentosiformis
ref|XP_002276284.1|  PREDICTED: 40S ribosomal protein S9-2              258   2e-84   Vitis vinifera
ref|XP_009627396.1|  PREDICTED: 40S ribosomal protein S9-2              258   2e-84   Nicotiana tomentosiformis
gb|EPS73776.1|  hypothetical protein M569_00980                         258   2e-84   Genlisea aurea
gb|EYU22431.1|  hypothetical protein MIMGU_mgv1a014214mg                258   2e-84   Erythranthe guttata [common monkey flower]
ref|NP_001274868.1|  40S ribosomal protein S9-2-like                    258   2e-84   Solanum tuberosum [potatoes]
ref|XP_009604777.1|  PREDICTED: 40S ribosomal protein S9-2-like         258   2e-84   Nicotiana tomentosiformis
ref|XP_002511557.1|  40S ribosomal protein S9, putative                 258   3e-84   Ricinus communis
ref|XP_009778292.1|  PREDICTED: 40S ribosomal protein S9-2              257   4e-84   Nicotiana sylvestris
ref|XP_009598709.1|  PREDICTED: 40S ribosomal protein S9-2-like         257   4e-84   Nicotiana tomentosiformis
ref|XP_006367430.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    257   5e-84   Solanum tuberosum [potatoes]
ref|XP_010242426.1|  PREDICTED: 40S ribosomal protein S9-2              257   6e-84   Nelumbo nucifera [Indian lotus]
ref|XP_009798560.1|  PREDICTED: 40S ribosomal protein S9-2-like         257   7e-84   Nicotiana sylvestris
ref|XP_009779308.1|  PREDICTED: 40S ribosomal protein S9-2-like         256   8e-84   Nicotiana sylvestris
gb|EYU28732.1|  hypothetical protein MIMGU_mgv1a014218mg                256   8e-84   Erythranthe guttata [common monkey flower]
ref|XP_002522398.1|  40S ribosomal protein S9, putative                 256   1e-83   Ricinus communis
gb|ABQ32300.1|  putative 40S ribosomal protein S9                       256   1e-83   Artemisia annua [sweet Annie]
ref|XP_011004198.1|  PREDICTED: 40S ribosomal protein S9-2 isofor...    256   1e-83   Populus euphratica
ref|XP_007209623.1|  hypothetical protein PRUPE_ppa011764mg             256   1e-83   Prunus persica
ref|XP_006367431.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    256   1e-83   Solanum tuberosum [potatoes]
emb|CDP00311.1|  unnamed protein product                                255   3e-83   Coffea canephora [robusta coffee]
ref|XP_007037295.1|  Ribosomal protein S4                               254   5e-83   Theobroma cacao [chocolate]
gb|AFK46709.1|  unknown                                                 254   6e-83   Lotus japonicus
ref|XP_007138197.1|  hypothetical protein PHAVU_009G188600g             254   7e-83   Phaseolus vulgaris [French bean]
ref|XP_004499428.1|  PREDICTED: 40S ribosomal protein S9-2-like         254   7e-83   Cicer arietinum [garbanzo]
ref|XP_010274527.1|  PREDICTED: 40S ribosomal protein S9-2-like         254   1e-82   Nelumbo nucifera [Indian lotus]
emb|CAG47084.1|  40S ribosomal protein S9                               254   1e-82   Catharanthus roseus [chatas]
ref|XP_006380606.1|  hypothetical protein POPTR_0007s09750g             254   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_002317362.1|  hypothetical protein POPTR_0011s09670g             253   1e-82   Populus trichocarpa [western balsam poplar]
gb|ABK21901.1|  unknown                                                 253   1e-82   Picea sitchensis
ref|XP_003577383.1|  PREDICTED: 40S ribosomal protein S9-2-like         253   1e-82   Brachypodium distachyon [annual false brome]
ref|XP_007155321.1|  hypothetical protein PHAVU_003G191200g             253   1e-82   Phaseolus vulgaris [French bean]
ref|NP_001276185.1|  40S ribosomal protein S9-2-like                    253   2e-82   Glycine max [soybeans]
ref|XP_003549666.1|  PREDICTED: 40S ribosomal protein S9-2-like         253   2e-82   Glycine max [soybeans]
ref|XP_011004201.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    253   2e-82   Populus euphratica
ref|XP_002323418.1|  hypothetical protein POPTR_0016s07730g             253   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_011004703.1|  PREDICTED: 40S ribosomal protein S9-2-like         253   2e-82   Populus euphratica
ref|XP_004508755.1|  PREDICTED: 40S ribosomal protein S9-2-like         253   2e-82   Cicer arietinum [garbanzo]
gb|KJB74899.1|  hypothetical protein B456_012G055000                    253   2e-82   Gossypium raimondii
gb|KJB70960.1|  hypothetical protein B456_011G097500                    253   2e-82   Gossypium raimondii
gb|KJB33600.1|  hypothetical protein B456_006G020700                    253   2e-82   Gossypium raimondii
gb|KHG16530.1|  40S ribosomal S9-2 -like protein                        253   2e-82   Gossypium arboreum [tree cotton]
gb|KJB11057.1|  hypothetical protein B456_001G238700                    253   2e-82   Gossypium raimondii
ref|XP_007032505.1|  Ribosomal protein S4                               253   2e-82   Theobroma cacao [chocolate]
gb|ABF94049.1|  40S ribosomal protein S9, putative, expressed           251   3e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004299381.1|  PREDICTED: 40S ribosomal protein S9-2-like         253   3e-82   Fragaria vesca subsp. vesca
ref|XP_010917021.1|  PREDICTED: 40S ribosomal protein S9-2              253   3e-82   Elaeis guineensis
tpg|DAA55417.1|  TPA: hypothetical protein ZEAMMB73_005048              251   3e-82   Zea mays [maize]
gb|ABA94598.1|  40S ribosomal protein S9, putative, expressed           251   3e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002324730.1|  hypothetical protein POPTR_0018s07520g             253   3e-82   Populus trichocarpa [western balsam poplar]
ref|XP_006663032.1|  PREDICTED: 40S ribosomal protein S9-2-like         252   4e-82   Oryza brachyantha
ref|NP_001049004.1|  Os03g0154700                                       252   5e-82   
ref|XP_007215987.1|  hypothetical protein PRUPE_ppa011733mg             252   5e-82   Prunus persica
ref|XP_009383889.1|  PREDICTED: 40S ribosomal protein S9-2-like         252   5e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780681.1|  PREDICTED: 40S ribosomal protein S9-2              252   6e-82   Phoenix dactylifera
gb|ABA94602.1|  40S ribosomal protein S9, putative, expressed           251   6e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010435836.1|  PREDICTED: 40S ribosomal protein S9-2              252   6e-82   Camelina sativa [gold-of-pleasure]
ref|XP_006282728.1|  hypothetical protein CARUB_v10005777mg             251   7e-82   Capsella rubella
ref|XP_009389620.1|  PREDICTED: 40S ribosomal protein S9-2-like         251   9e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003576178.1|  PREDICTED: 40S ribosomal protein S9-2-like         251   1e-81   Brachypodium distachyon [annual false brome]
ref|XP_009414866.1|  PREDICTED: 40S ribosomal protein S9-2              251   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403622.1|  PREDICTED: 40S ribosomal protein S9-2-like         251   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001278530.1|  40S ribosomal protein S9                           251   1e-81   Zea mays [maize]
gb|ACU15321.1|  unknown                                                 252   1e-81   Glycine max [soybeans]
ref|XP_010554004.1|  PREDICTED: 40S ribosomal protein S9-2              251   1e-81   Tarenaya hassleriana [spider flower]
ref|XP_003598026.1|  40S ribosomal protein S9                           251   1e-81   Medicago truncatula
ref|NP_001149705.1|  40S ribosomal protein S9                           250   2e-81   Zea mays [maize]
gb|AFK40975.1|  unknown                                                 250   2e-81   Medicago truncatula
ref|NP_001238740.1|  uncharacterized protein LOC100305663               250   3e-81   Glycine max [soybeans]
ref|NP_001131442.1|  uncharacterized protein LOC100192774               250   3e-81   Zea mays [maize]
tpg|DAA41535.1|  TPA: hypothetical protein ZEAMMB73_424707              251   3e-81   Zea mays [maize]
ref|XP_004304310.1|  PREDICTED: 40S ribosomal protein S9-2              250   3e-81   Fragaria vesca subsp. vesca
ref|XP_003562635.1|  PREDICTED: 40S ribosomal protein S9-2-like         250   4e-81   Brachypodium distachyon [annual false brome]
ref|XP_002870751.1|  40S ribosomal protein S9                           250   4e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_002442158.1|  hypothetical protein SORBIDRAFT_08g015270          249   5e-81   Sorghum bicolor [broomcorn]
gb|ABR17162.1|  unknown                                                 249   6e-81   Picea sitchensis
ref|XP_003557815.1|  PREDICTED: 40S ribosomal protein S9-2              249   6e-81   Brachypodium distachyon [annual false brome]
ref|XP_004962962.1|  PREDICTED: 40S ribosomal protein S9-2-like         249   6e-81   Setaria italica
ref|XP_006664031.1|  PREDICTED: 40S ribosomal protein S9-2-like         249   8e-81   Oryza brachyantha
gb|KFK33188.1|  hypothetical protein AALP_AA6G341500                    249   8e-81   Arabis alpina [alpine rockcress]
gb|ACG33443.1|  40S ribosomal protein S9                                249   8e-81   Zea mays [maize]
ref|XP_002463229.1|  hypothetical protein SORBIDRAFT_02g040120          249   8e-81   Sorghum bicolor [broomcorn]
ref|XP_002463225.1|  hypothetical protein SORBIDRAFT_02g040080          249   8e-81   Sorghum bicolor [broomcorn]
ref|NP_198801.1|  40S ribosomal protein S9-2                            249   9e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405589.1|  hypothetical protein EUTSA_v10027944mg             249   1e-80   Eutrema salsugineum
ref|XP_004958404.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   1e-80   Setaria italica
ref|XP_006438663.1|  hypothetical protein CICLE_v10032800mg             248   1e-80   Citrus clementina
ref|XP_006650139.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   1e-80   Oryza brachyantha
gb|EMS50632.1|  40S ribosomal protein S9-2                              248   1e-80   Triticum urartu
ref|XP_004984207.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   1e-80   Setaria italica
ref|XP_010939529.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   2e-80   Elaeis guineensis
ref|XP_010937076.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   2e-80   Elaeis guineensis
ref|XP_006657990.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   2e-80   Oryza brachyantha
ref|XP_010551858.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   3e-80   Tarenaya hassleriana [spider flower]
ref|XP_010550058.1|  PREDICTED: 40S ribosomal protein S9-2-like         247   5e-80   Tarenaya hassleriana [spider flower]
ref|XP_010545191.1|  PREDICTED: 40S ribosomal protein S9-2-like         247   5e-80   Tarenaya hassleriana [spider flower]
ref|XP_008379343.1|  PREDICTED: 40S ribosomal protein S9-2              247   6e-80   Malus domestica [apple tree]
dbj|BAJ90873.1|  predicted protein                                      246   1e-79   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003623232.1|  40S ribosomal protein S9                           246   1e-79   Medicago truncatula
ref|XP_010524330.1|  PREDICTED: 40S ribosomal protein S9-2-like         246   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_008341561.1|  PREDICTED: 40S ribosomal protein S9-2              246   2e-79   Malus domestica [apple tree]
ref|XP_001754369.1|  predicted protein                                  245   3e-79   Physcomitrella patens
ref|XP_001767226.1|  predicted protein                                  245   3e-79   Physcomitrella patens
ref|XP_001754496.1|  predicted protein                                  244   4e-79   Physcomitrella patens
ref|XP_009124855.1|  PREDICTED: 40S ribosomal protein S9-2              244   5e-79   Brassica rapa
ref|XP_003637511.1|  40S ribosomal protein S9                           245   5e-79   
emb|CDX74423.1|  BnaA04g09660D                                          244   5e-79   Brassica napus [oilseed rape]
ref|XP_001777561.1|  predicted protein                                  244   5e-79   Physcomitrella patens
gb|AAT08735.1|  40S ribosomal protein S9                                244   8e-79   Hyacinthus orientalis [common hyacinth]
ref|XP_001762390.1|  predicted protein                                  243   2e-78   Physcomitrella patens
ref|XP_010695717.1|  PREDICTED: 40S ribosomal protein S9-2-like         242   3e-78   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006400037.1|  hypothetical protein EUTSA_v10014722mg             242   4e-78   Eutrema salsugineum
ref|NP_197024.1|  40S ribosomal protein S9-1                            242   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010092050.1|  40S ribosomal protein S9-2                         244   4e-78   Morus notabilis
ref|XP_006288701.1|  hypothetical protein CARUB_v10002009mg             242   5e-78   Capsella rubella
ref|NP_001119227.1|  40S ribosomal protein S9-1                         240   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420178.1|  PREDICTED: 40S ribosomal protein S9-1              242   5e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010683223.1|  PREDICTED: 40S ribosomal protein S9-2              241   6e-78   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EMS59613.1|  40S ribosomal protein S9-2                              241   6e-78   Triticum urartu
gb|KFK25765.1|  hypothetical protein AALP_AA8G156800                    241   8e-78   Arabis alpina [alpine rockcress]
ref|XP_006431128.1|  hypothetical protein CICLE_v10013599mg             241   8e-78   Citrus clementina
ref|XP_002985335.1|  hypothetical protein SELMODRAFT_157263             241   9e-78   Selaginella moellendorffii
ref|XP_002873713.1|  40S ribosomal protein S9                           241   1e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_002960852.1|  hypothetical protein SELMODRAFT_74302              239   8e-77   Selaginella moellendorffii
ref|XP_009131450.1|  PREDICTED: 40S ribosomal protein S9-1              238   1e-76   Brassica rapa
gb|EAY83173.1|  hypothetical protein OsI_38384                          236   5e-76   Oryza sativa Indica Group [Indian rice]
gb|EAY83171.1|  hypothetical protein OsI_38381                          235   2e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_006827176.1|  hypothetical protein AMTR_s00010p00256040          236   2e-75   
ref|XP_009126038.1|  PREDICTED: 40S ribosomal protein S9-1-like         235   3e-75   Brassica rapa
gb|KHG14244.1|  40S ribosomal S9-2 -like protein                        233   2e-74   Gossypium arboreum [tree cotton]
gb|KHG14681.1|  40S ribosomal S9-2 -like protein                        232   2e-74   Gossypium arboreum [tree cotton]
gb|EEC74543.1|  hypothetical protein OsI_10067                          234   9e-74   Oryza sativa Indica Group [Indian rice]
gb|ADB77797.1|  40S ribosomal protein S9                                229   4e-73   Chlamydomonas reinhardtii
ref|XP_001702303.1|  ribosomal protein S9, component of cytosolic...    229   6e-73   Chlamydomonas reinhardtii
emb|CDY30273.1|  BnaC04g31840D                                          245   1e-72   Brassica napus [oilseed rape]
gb|KHN30826.1|  40S ribosomal protein S9-2                              227   2e-72   Glycine soja [wild soybean]
pdb|3J60|J  Chain J, Localization Of The Small Subunit Ribosomal ...    227   3e-72   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002958222.1|  component of cytosolic 80S ribosome and 40S ...    227   3e-72   Volvox carteri f. nagariensis
gb|KHG06711.1|  40S ribosomal S9-2 -like protein                        229   4e-72   Gossypium arboreum [tree cotton]
gb|KDP41176.1|  hypothetical protein JCGZ_15583                         226   1e-71   Jatropha curcas
gb|ADB77799.1|  40S ribosomal protein S9                                223   2e-71   Klebsormidium flaccidum
ref|XP_008341567.1|  PREDICTED: 40S ribosomal protein S9-2              216   5e-69   Malus domestica [apple tree]
emb|CEF99084.1|  Ribosomal protein S4/S9, eukaryotic/archaeal           218   1e-68   Ostreococcus tauri
ref|XP_002500609.1|  predicted protein                                  217   2e-68   Micromonas commoda
gb|AES91245.2|  40S ribosomal protein S9, putative                      213   8e-68   Medicago truncatula
ref|XP_001419792.1|  Ribosomal protein S9, component of cytosolic...    215   2e-67   Ostreococcus lucimarinus CCE9901
ref|XP_008367548.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    215   2e-67   
ref|XP_005849917.1|  hypothetical protein CHLNCDRAFT_56085              214   3e-67   Chlorella variabilis
ref|XP_005648482.1|  ribosomal protein S9 component of cytosolic ...    214   3e-67   Coccomyxa subellipsoidea C-169
ref|XP_003609048.1|  40S ribosomal protein S9                           214   3e-67   
gb|KIZ06357.1|  40S ribosomal protein S9-2                              214   4e-67   Monoraphidium neglectum
ref|WP_039781875.1|  hypothetical protein                               211   1e-66   
gb|KIZ02547.1|  40S ribosomal protein S9-2                              214   1e-66   Monoraphidium neglectum
ref|XP_002467783.1|  hypothetical protein SORBIDRAFT_01g033980          212   1e-66   Sorghum bicolor [broomcorn]
ref|XP_003056784.1|  predicted protein                                  211   6e-66   Micromonas pusilla CCMP1545
gb|ADB77794.1|  40S ribosomal protein S9                                207   2e-65   Ulvella repens
emb|CCI69515.1|  40S ribosomal protein S9                               199   3e-62   Chlorochytrium lemnae
gb|ADB77800.1|  40S ribosomal protein S9                                199   4e-62   Phyllodictyon orientale
emb|CBN76630.1|  conserved unknown protein                              200   8e-62   Ectocarpus siliculosus
ref|XP_008654154.1|  PREDICTED: 40S ribosomal protein S9-2-like         199   1e-61   Zea mays [maize]
gb|ADB77796.1|  40S ribosomal protein S9                                197   2e-61   Boodlea composita
gb|ADB77795.1|  40S ribosomal protein S9                                197   3e-61   Boergesenia forbesii
gb|ADB77798.1|  40S ribosomal protein S9                                198   4e-61   Cladophora coelothrix
gb|ADB77801.1|  40S ribosomal protein S9                                196   4e-61   Siphonocladus tropicus
dbj|BAA78592.1|  40S ribosomal protein S9                               198   5e-61   Chlamydomonas sp. HS-5
tpg|DAA63719.1|  TPA: hypothetical protein ZEAMMB73_520702              199   9e-61   Zea mays [maize]
ref|XP_006381973.1|  hypothetical protein POPTR_0006s22640g             197   1e-60   Populus trichocarpa [western balsam poplar]
gb|EJK71823.1|  hypothetical protein THAOC_06697                        197   2e-60   Thalassiosira oceanica
ref|XP_002289706.1|  RS9, ribosomal protein 9                           196   4e-60   Thalassiosira pseudonana CCMP1335
ref|XP_006438664.1|  hypothetical protein CICLE_v10033755mg             195   5e-60   Citrus clementina
ref|XP_011399104.1|  40S ribosomal protein S9-1                         196   5e-60   Auxenochlorella protothecoides
tpg|DAA63723.1|  TPA: hypothetical protein ZEAMMB73_488320              198   5e-60   Zea mays [maize]
gb|ABF96251.1|  40S ribosomal protein S9, putative                      193   2e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AGV54486.1|  40S ribosomal protein S9-2-like protein                 191   4e-58   Phaseolus vulgaris [French bean]
ref|XP_005534862.1|  40S ribosomal protein S9                           190   9e-58   Cyanidioschyzon merolae strain 10D
ref|XP_002367195.1|  40S ribosomal protein S9, putative                 190   1e-57   Toxoplasma gondii ME49
gb|EKG11582.1|  Ribosomal protein S4/S9                                 189   2e-57   Macrophomina phaseolina MS6
gb|KEF58004.1|  40S ribosomal protein S9                                189   2e-57   Exophiala aquamarina CBS 119918
gb|EME38681.1|  ribosomal protein S9-like protein                       189   2e-57   Dothistroma septosporum NZE10
gb|KIW73335.1|  40S ribosomal protein S9                                189   2e-57   Capronia semi-immersa
ref|XP_008722253.1|  40S ribosomal protein S9                           189   2e-57   Cladophialophora carrionii CBS 160.54
ref|XP_003886044.1|  hypothetical protein NCLIV_064440                  189   2e-57   Neospora caninum Liverpool
gb|KIV80024.1|  40S ribosomal protein S9                                189   2e-57   Exophiala sideris
gb|KIW15420.1|  40S ribosomal protein S9                                189   2e-57   Exophiala spinifera
ref|XP_007724904.1|  40S ribosomal protein S9                           189   3e-57   Capronia coronata CBS 617.96
ref|XP_009155008.1|  40S ribosomal protein S9                           189   3e-57   Exophiala dermatitidis NIH/UT8656
ref|XP_005708491.1|  40S ribosomal protein S9e                          189   3e-57   Galdieria sulphuraria
ref|XP_009038600.1|  hypothetical protein AURANDRAFT_28757              189   3e-57   Aureococcus anophagefferens
gb|KIW44874.1|  40S ribosomal protein S9                                189   3e-57   Exophiala oligosperma
ref|XP_007731850.1|  40S ribosomal protein S9                           188   4e-57   Capronia epimyces CBS 606.96
gb|KIN07697.1|  hypothetical protein OIDMADRAFT_16275                   188   4e-57   Oidiodendron maius Zn
gb|KIW07901.1|  40S ribosomal protein S9                                188   4e-57   Verruconis gallopava
ref|XP_007922661.1|  hypothetical protein MYCFIDRAFT_60241              188   4e-57   Cercospora fijiensis CIRAD86
ref|XP_007587858.1|  putative 40s ribosomal protein s9 protein          188   4e-57   Neofusicoccum parvum UCRNP2
ref|XP_635999.1|  ribosomal protein 1024                                188   4e-57   Dictyostelium discoideum AX4
ref|XP_007750565.1|  40S ribosomal protein S9                           188   4e-57   Cladophialophora psammophila CBS 110553
gb|KIW24305.1|  40S ribosomal protein S9                                188   4e-57   Cladophialophora immunda
ref|XP_007782986.1|  40S ribosomal protein S9                           188   4e-57   Coniosporium apollinis CBS 100218
gb|KIW50177.1|  40S ribosomal protein S9                                188   5e-57   Exophiala xenobiotica
ref|XP_005780612.1|  hypothetical protein EMIHUDRAFT_460715             187   6e-57   Emiliania huxleyi CCMP1516
ref|XP_004336000.1|  ribosomal protein S4, putative                     187   7e-57   Acanthamoeba castellanii str. Neff
ref|XP_001546443.1|  40S ribosomal protein S9                           187   7e-57   Botrytis cinerea B05.10
dbj|GAM43906.1|  40S ribosomal protein                                  187   8e-57   Talaromyces cellulolyticus
ref|XP_009531030.1|  hypothetical protein PHYSODRAFT_354997             187   8e-57   Phytophthora sojae
ref|XP_002486003.1|  40S ribosomal protein S9                           187   8e-57   Talaromyces stipitatus ATCC 10500
gb|KDD75683.1|  hypothetical protein H632_c551p0                        188   9e-57   Helicosporidium sp. ATCC 50920
ref|XP_002139923.1|  40S ribosomal protein S9                           187   9e-57   Cryptosporidium muris RN66
emb|CDR95115.1|  40S ribosomal subunit protein S9, putative             187   9e-57   Babesia bigemina
ref|XP_005767233.1|  hypothetical protein EMIHUDRAFT_61745              187   1e-56   Emiliania huxleyi CCMP1516
ref|XP_006691696.1|  40S ribosomal protein s9-like protein              187   1e-56   Chaetomium thermophilum var. thermophilum DSM 1495
emb|CCF75909.1|  unnamed protein product                                187   1e-56   Babesia microti strain RI
emb|CDJ32982.1|  40S ribosomal protein S9, putative                     187   1e-56   Eimeria mitis
gb|KEQ66339.1|  40S ribosomal protein S9                                187   1e-56   Aureobasidium melanogenum CBS 110374
emb|CDI78299.1|  40S ribosomal protein S9, putative                     187   1e-56   Eimeria acervulina
gb|KIX06477.1|  40S ribosomal protein S9                                187   2e-56   Rhinocladiella mackenziei CBS 650.93
ref|XP_002152417.1|  40S ribosomal protein S9                           187   2e-56   Talaromyces marneffei ATCC 18224
gb|ADB77802.1|  40S ribosomal protein S9                                186   2e-56   Ulva intestinalis
ref|XP_008808061.1|  PREDICTED: 40S ribosomal protein S9-2-like         186   2e-56   Phoenix dactylifera
gb|KIV89206.1|  40S ribosomal protein S9                                187   2e-56   Exophiala mesophila
ref|XP_007698387.1|  hypothetical protein COCSADRAFT_35730              186   2e-56   Bipolaris sorokiniana ND90Pr
gb|EPE04605.1|  40s ribosomal protein s9                                186   2e-56   Ophiostoma piceae UAMH 11346
ref|XP_662407.1|  RS9_PODAN 40S ribosomal protein S9 (S7)               186   2e-56   Aspergillus nidulans FGSC A4
gb|KEQ72499.1|  40S ribosomal protein S9                                186   2e-56   Aureobasidium namibiae CBS 147.97
ref|XP_001937443.1|  40S ribosomal protein S9                           186   2e-56   Pyrenophora tritici-repentis Pt-1C-BFP
gb|AET50489.1|  hypothetical protein                                    186   2e-56   Eimeria tenella
ref|XP_003286040.1|  rp1024 protein                                     186   3e-56   Dictyostelium purpureum
ref|XP_003838270.1|  similar to 40S ribosomal protein S9                186   3e-56   Leptosphaeria maculans JN3
ref|XP_007674573.1|  hypothetical protein BAUCODRAFT_66115              186   3e-56   Baudoinia panamericana UAMH 10762
ref|XP_005852611.1|  small subunit ribosomal protein S9e                186   3e-56   Nannochloropsis gaditana CCMP526
gb|KEZ42817.1|  hypothetical protein SAPIO_CDS5234                      186   3e-56   Scedosporium apiospermum
gb|ESZ90022.1|  40S ribosomal protein S9                                186   3e-56   Sclerotinia borealis F-4157
gb|EPS26866.1|  hypothetical protein PDE_01806                          186   3e-56   Penicillium oxalicum 114-2
ref|XP_003303583.1|  40S ribosomal protein S9                           188   3e-56   Pyrenophora teres f. teres 0-1
gb|KIX95793.1|  40S ribosomal protein S9                                186   3e-56   Fonsecaea multimorphosa CBS 102226
gb|KCW56188.1|  hypothetical protein EUGRSUZ_I01938                     185   3e-56   Eucalyptus grandis [rose gum]
ref|XP_007913411.1|  putative 40s ribosomal protein s9 protein          186   3e-56   Phaeoacremonium minimum UCRPA7
ref|XP_001246606.1|  40S ribosomal protein S9                           186   4e-56   Coccidioides immitis RS
gb|EMF08137.1|  40S ribosomal protein S9                                186   4e-56   Sphaerulina musiva SO2202
ref|XP_008711137.1|  40S ribosomal protein S9                           186   4e-56   Cyphellophora europaea CBS 101466
ref|XP_007829664.1|  40S ribosomal protein S9                           186   4e-56   Pestalotiopsis fici W106-1
ref|XP_007687378.1|  hypothetical protein COCMIDRAFT_93683              186   5e-56   Bipolaris oryzae ATCC 44560
gb|ESA03224.1|  hypothetical protein GLOINDRAFT_243564                  185   5e-56   Rhizophagus irregularis DAOM 181602
gb|KDN65245.1|  putative ribosomal protein S4                           186   5e-56   Colletotrichum sublineola
gb|EXX79184.1|  ribosomal 40S subunit protein S9A                       185   5e-56   Rhizophagus irregularis DAOM 197198w
dbj|GAM27112.1|  hypothetical protein SAMD00019534_102870               185   5e-56   Acytostelium subglobosum LB1
ref|XP_002903192.1|  40S ribosomal protein S9-1                         185   6e-56   Phytophthora infestans T30-4
ref|XP_006958740.1|  40S ribosomal protein S9                           185   6e-56   Wallemia mellicola CBS 633.66
ref|XP_011115175.1|  hypothetical protein H072_9617                     185   6e-56   Dactylellina haptotyla CBS 200.50
gb|AFK45767.1|  unknown                                                 185   7e-56   Medicago truncatula
ref|XP_001791646.1|  hypothetical protein SNOG_00985                    185   7e-56   Parastagonospora nodorum SN15
ref|XP_002794235.1|  40S ribosomal protein S9                           185   7e-56   
gb|EXX62810.1|  ribosomal 40S subunit protein S9A                       185   7e-56   Rhizophagus irregularis DAOM 197198w
ref|XP_007288535.1|  40S ribosomal protein S9                           185   7e-56   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
emb|CDJ50108.1|  40S ribosomal protein S9, putative                     185   7e-56   Eimeria brunetti
ref|XP_007273485.1|  40s ribosomal protein                              185   8e-56   Colletotrichum gloeosporioides Nara gc5
emb|CCF33735.1|  40S ribosomal protein S9                               185   8e-56   Colletotrichum higginsianum
gb|EFQ29502.1|  ribosomal protein S4                                    185   8e-56   Colletotrichum graminicola M1.001
ref|XP_001594205.1|  40S ribosomal protein S9                           185   8e-56   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_003007794.1|  40S ribosomal protein S9                           185   9e-56   
gb|KHJ32708.1|  putative 40s ribosomal protein s9                       185   9e-56   
ref|XP_009022737.1|  hypothetical protein HELRODRAFT_155894             185   9e-56   
dbj|GAM87141.1|  hypothetical protein ANO11243_051620                   185   1e-55   
ref|XP_001400515.1|  40S ribosomal protein S9                           184   1e-55   
ref|XP_001263755.1|  40S ribosomal protein S9                           184   1e-55   
ref|XP_001217311.1|  40S ribosomal protein S9                           184   1e-55   
ref|XP_007788827.1|  putative 40s ribosomal protein s9 protein          184   1e-55   
ref|XP_001824638.1|  40S ribosomal protein S9                           184   1e-55   
emb|CCI48676.1|  unnamed protein product                                184   1e-55   
gb|ETB62408.1|  40S ribosomal protein S9                                184   1e-55   
gb|KIW78598.1|  40S ribosomal protein S9                                184   1e-55   
ref|XP_008623589.1|  40S ribosomal protein                              184   1e-55   
emb|CDS49582.1|  40S ribosomal protein S9, putative                     184   2e-55   
ref|XP_002179777.1|  predicted protein                                  183   2e-55   
tpe|CAL69096.1|  TPA: putative 40S ribosomal protein S9                 184   2e-55   
gb|EFX05063.1|  40S ribosomal protein s9                                184   2e-55   
gb|EWM23131.1|  40s ribosomal protein s9                                186   2e-55   
gb|ERS98231.1|  40S ribosomal protein S9                                184   2e-55   
ref|XP_003847713.1|  40S ribosomal protein S9                           184   3e-55   
gb|ACO15505.1|  40S ribosomal protein S9                                184   3e-55   
ref|XP_003720755.1|  40S ribosomal protein S9                           184   3e-55   
gb|EPQ66464.1|  Protein component of the small (40S) ribosomal su...    184   3e-55   
ref|XP_001537827.1|  40S ribosomal protein S9                           183   3e-55   
gb|AFK45544.1|  unknown                                                 183   3e-55   
ref|XP_003660223.1|  hypothetical protein MYCTH_2298252                 183   3e-55   
gb|ACO11706.1|  40S ribosomal protein S9                                183   3e-55   
gb|EEH07566.1|  40S ribosomal protein S9                                183   3e-55   
gb|ELR03231.1|  40S ribosomal protein S9                                183   3e-55   
gb|ABW90415.1|  putative ribosomal protein S9                           183   4e-55   
gb|ACO10247.1|  40S ribosomal protein S9                                183   4e-55   
ref|XP_004830832.1|  40S ribosomal protein S9, putative                 183   4e-55   
ref|XP_007593688.1|  40S ribosomal protein S9                           183   4e-55   
gb|EDL31198.1|  mCG18481, isoform CRA_b                                 182   4e-55   
sp|P52810.1|RS9_PODAS  RecName: Full=40S ribosomal protein S9; Al...    183   4e-55   
ref|XP_011122298.1|  hypothetical protein AOL_s00079g121                183   4e-55   
gb|EHJ71338.1|  ribosomal protein S9                                    183   5e-55   
gb|ADT80642.1|  ribosomal protein S9                                    183   5e-55   
gb|ADO95157.1|  ribosomal protein S9                                    183   5e-55   
ref|XP_002629546.1|  40S ribosomal protein S9                           183   5e-55   
dbj|BAD26701.1|  ribosomal protein S9                                   183   5e-55   
ref|NP_001037265.1|  ribosomal protein S9                               183   5e-55   
dbj|BAM17690.1|  ribosomal protein S9                                   183   6e-55   
ref|XP_730059.1|  ribosomal protein S4                                  183   6e-55   
gb|AFP65624.1|  40S ribosomal protein S9                                182   6e-55   
emb|CCA22601.1|  40S ribosomal protein S91 putative                     183   6e-55   
ref|XP_003172904.1|  40S ribosomal protein S9                           182   6e-55   
ref|XP_002842953.1|  40S ribosomal protein S9                           182   6e-55   
dbj|BAM19012.1|  ribosomal protein S9                                   182   7e-55   
gb|EGD95527.1|  ribosomal protein S9                                    182   7e-55   
dbj|BAN20249.1|  ribosomal protein S9                                   182   8e-55   
ref|XP_003237660.1|  40S ribosomal protein S9                           182   8e-55   
ref|XP_001270715.1|  40S ribosomal protein S9                           182   8e-55   
gb|AHB33642.1|  40S ribosomal protein S9                                182   8e-55   
ref|XP_001222689.1|  40S ribosomal protein S9                           182   9e-55   
ref|XP_002110068.1|  S9 ribosomal protein                               182   9e-55   
gb|KIM82299.1|  hypothetical protein PILCRDRAFT_475098                  182   1e-54   
gb|ABX26127.1|  ribosomal protein S9                                    182   1e-54   
gb|AGH70193.1|  40S ribosomal protein S9                                182   1e-54   
ref|XP_964233.1|  40S ribosomal protein S9                              182   1e-54   
ref|XP_001351758.1|  40S ribosomal protein S9, putative                 182   1e-54   
ref|XP_002175454.1|  40S ribosomal protein S9                           182   1e-54   
gb|ACO12686.1|  40S ribosomal protein S9                                182   1e-54   
gb|KDQ62955.1|  hypothetical protein JAAARDRAFT_28926                   182   1e-54   
ref|NP_729507.1|  ribosomal protein S9, isoform B                       180   1e-54   
emb|CDO63078.1|  40S ribosomal protein S9, putative                     181   2e-54   
gb|ACY95323.1|  ribosomal protein S9                                    182   2e-54   
ref|XP_001613757.1|  40S ribosomal protein S9                           181   2e-54   
gb|EER45719.1|  40S ribosomal protein S9                                181   2e-54   
gb|AAR10044.1|  similar to Drosophila melanogaster RpS9                 181   2e-54   
ref|XP_007510860.1|  40S ribosomal protein S9                           183   2e-54   
ref|XP_002259613.1|  40S ribosomal subunit protein S9                   181   2e-54   
emb|CCQ18585.1|  40S ribosomal protein S9                               181   2e-54   
ref|XP_008544905.1|  PREDICTED: 40S ribosomal protein S9                181   2e-54   
ref|XP_002171823.1|  40S ribosomal protein S9                           181   2e-54   
ref|XP_008876439.1|  ribosomal protein S4                               181   2e-54   
emb|CDH55798.1|  40s ribosomal protein s9                               181   2e-54   
ref|XP_763944.1|  40S ribosomal protein S9                              181   2e-54   
ref|XP_007860645.1|  ribosomal protein S4                               181   2e-54   
ref|XP_008815169.1|  40S ribosomal protein                              181   3e-54   
ref|XP_004222815.1|  40S ribosomal protein S9                           181   3e-54   
emb|CAH04322.1|  S9e ribosomal protein                                  181   3e-54   
ref|XP_001609790.1|  40S ribosomal subunit protein S9                   181   3e-54   
emb|CDS04034.1|  Putative 40S ribosomal protein S9                      181   3e-54   
gb|ABG01900.1|  S9 ribosomal protein                                    181   3e-54   
ref|XP_001903023.1|  hypothetical protein                               182   3e-54   
ref|XP_003347095.1|  40S ribosomal protein S9                           181   3e-54   
ref|XP_009540632.1|  hypothetical protein HETIRDRAFT_456594             181   3e-54   
gb|KIL71469.1|  hypothetical protein M378DRAFT_155038                   181   3e-54   
ref|XP_006964217.1|  ribosomal protein S9, S4 family                    181   3e-54   
gb|ACY71248.1|  ribosomal protein S9                                    181   3e-54   
ref|XP_009172179.1|  hypothetical protein T265_14496                    181   4e-54   
ref|XP_009265857.1|  40S ribosomal protein S9-B                         181   4e-54   
ref|XP_003026421.1|  40S ribosomal protein S9                           181   4e-54   
gb|AAT76788.1|  40S ribosomal protein S9                                181   4e-54   
gb|KIJ95270.1|  hypothetical protein K443DRAFT_332076                   181   4e-54   
ref|XP_952982.1|  40S ribosomal protein S9                              181   4e-54   
ref|XP_001873538.1|  40S ribosomal protein S9                           181   4e-54   
dbj|BAJ85708.1|  predicted protein                                      181   4e-54   
gb|KIM47402.1|  hypothetical protein M413DRAFT_199385                   181   4e-54   
ref|XP_001873539.1|  40S ribosomal protein S9                           181   5e-54   
ref|XP_001712313.1|  rps9                                               180   5e-54   
ref|XP_011497696.1|  PREDICTED: 40S ribosomal protein S9                181   5e-54   
gb|AAX62465.1|  ribosomal protein S9                                    181   5e-54   
ref|XP_001829481.1|  40S ribosomal protein S9                           180   5e-54   
gb|ELT87958.1|  hypothetical protein CAPTEDRAFT_199319                  179   5e-54   
ref|XP_009220754.1|  40S ribosomal protein S9                           180   6e-54   
ref|XP_004456722.1|  PREDICTED: 40S ribosomal protein S9 isoform 2      179   6e-54   
ref|XP_005090825.1|  PREDICTED: 40S ribosomal protein S9-like iso...    180   6e-54   
gb|EHK22520.1|  hypothetical protein TRIVIDRAFT_216043                  180   6e-54   
ref|XP_003651341.1|  40S ribosomal protein S9                           181   6e-54   
ref|XP_001568760.1|  putative 40S ribosomal protein S9                  180   7e-54   
gb|AAR09821.1|  similar to Drosophila melanogaster RpS9                 180   7e-54   
ref|XP_001956309.1|  GF24655                                            180   7e-54   
gb|AAX48885.1|  S9                                                      180   7e-54   
ref|XP_006540483.1|  PREDICTED: 40S ribosomal protein S9 isoform X1     178   7e-54   
ref|XP_003874470.1|  putative 40S ribosomal protein S9                  180   7e-54   
ref|XP_001562571.1|  putative 40S ribosomal protein S9                  180   7e-54   
ref|XP_004518997.1|  PREDICTED: 40S ribosomal protein S9-like           180   7e-54   
ref|XP_009846369.1|  ribosomal protein S4                               180   8e-54   
ref|XP_011180539.1|  PREDICTED: 40S ribosomal protein S9                180   8e-54   
dbj|GAM21027.1|  hypothetical protein SAMD00019534_042020               180   8e-54   
ref|XP_003872215.1|  putative 40S ribosomal protein S9                  180   8e-54   
ref|XP_002047289.1|  GJ13353                                            180   8e-54   
ref|NP_524004.2|  ribosomal protein S9, isoform A                       180   8e-54   
gb|AAH12491.1|  Rps9 protein                                            178   8e-54   
ref|XP_007391198.1|  hypothetical protein PHACADRAFT_248675             180   8e-54   
ref|XP_003697514.1|  PREDICTED: 40S ribosomal protein S9-like iso...    178   8e-54   
ref|XP_006671722.1|  40S ribosomal protein S9 (S7)                      180   8e-54   
gb|EAW72212.1|  ribosomal protein S9, isoform CRA_c                     178   8e-54   
ref|XP_004671615.1|  PREDICTED: 40S ribosomal protein S9                178   9e-54   
ref|XP_007256932.1|  PREDICTED: 40S ribosomal protein S9-like           180   9e-54   
ref|XP_001352621.1|  GA28351                                            180   9e-54   
ref|XP_001680975.1|  putative 40S ribosomal protein S9                  180   9e-54   
ref|XP_001686697.1|  putative 40S ribosomal protein S9                  180   9e-54   
ref|XP_001984182.1|  GH15146                                            180   9e-54   
gb|EHK42959.1|  hypothetical protein TRIATDRAFT_258286                  180   9e-54   
gb|ACD65142.1|  putative 40S ribosomal protein RPS9                     179   1e-53   
ref|XP_001463283.1|  putative 40S ribosomal protein S9                  179   1e-53   
ref|XP_009098805.1|  PREDICTED: 40S ribosomal protein S9                179   1e-53   
gb|KFH47053.1|  40S ribosomal protein S9-like protein                   179   1e-53   
gb|KIO25495.1|  hypothetical protein M407DRAFT_91820                    179   1e-53   
gb|ABG01896.1|  S9 ribosomal protein                                    179   1e-53   
gb|ACF17617.1|  S-9                                                     178   1e-53   
ref|XP_008032443.1|  40S ribosomal protein S9                           179   1e-53   
ref|XP_008601048.1|  40S ribosomal protein S9                           179   1e-53   
ref|XP_007307288.1|  40S ribosomal protein S9                           179   1e-53   
dbj|BAH13468.1|  unnamed protein product                                178   1e-53   
ref|XP_008486802.1|  PREDICTED: 40S ribosomal protein S9                179   1e-53   
ref|XP_009259609.1|  hypothetical protein FPSE_08216                    179   1e-53   
ref|XP_003052792.1|  40S ribosomal protein S9                           179   1e-53   
ref|XP_005240973.1|  PREDICTED: 40S ribosomal protein S9-like           178   1e-53   
gb|EQL04090.1|  Ribosomal protein S4/S9                                 179   1e-53   
ref|XP_009692519.1|  40S ribosomal protein S9                           179   1e-53   
ref|XP_002841454.1|  40S ribosomal protein S9                           179   1e-53   
ref|XP_007874274.1|  30S ribosomal protein S4                           179   1e-53   
dbj|GAA54965.1|  small subunit ribosomal protein S9e                    182   2e-53   
gb|ACS87829.1|  putative 40S ribosomal protein S9                       179   2e-53   
gb|KJA19242.1|  hypothetical protein HYPSUDRAFT_204799                  179   2e-53   
gb|EGU79448.1|  hypothetical protein FOXB_10033                         179   2e-53   
ref|XP_003400837.1|  PREDICTED: 40S ribosomal protein S9-like           179   2e-53   
ref|XP_005090824.1|  PREDICTED: 40S ribosomal protein S9-like iso...    179   2e-53   
gb|ADK11698.1|  ribosomal protein S9                                    178   2e-53   
gb|ADO28208.1|  40S ribosomal protein s9                                179   2e-53   
ref|NP_001187074.1|  40S ribosomal protein S9                           179   2e-53   
gb|KIP02503.1|  hypothetical protein PHLGIDRAFT_20458                   179   2e-53   
gb|KII94201.1|  hypothetical protein PLICRDRAFT_695235                  179   2e-53   
emb|CDM31877.1|  40S ribosomal protein S9                               179   2e-53   
ref|XP_001894478.1|  40S ribosomal protein S9                           179   2e-53   
gb|AAY66962.1|  40S ribosomal protein S9                                179   2e-53   
ref|XP_003147914.1|  40S ribosomal protein S9                           179   2e-53   
gb|KGO75304.1|  Ribosomal protein S4/S9                                 179   2e-53   
gb|KIK68304.1|  hypothetical protein GYMLUDRAFT_35690                   179   2e-53   
gb|KFH63847.1|  40S ribosomal protein S9                                179   2e-53   
ref|XP_007763855.1|  40S ribosomal protein S9                           179   2e-53   
gb|EAW72214.1|  ribosomal protein S9, isoform CRA_e                     177   2e-53   
dbj|BAA82319.1|  ribosomal protein S9 homolog                           178   3e-53   
emb|CDO74409.1|  hypothetical protein BN946_scf184867.g7                179   3e-53   
gb|KIJ53746.1|  hypothetical protein M422DRAFT_58531                    179   3e-53   
ref|XP_007811695.1|  40S ribosomal protein S9                           178   3e-53   
ref|XP_007853601.1|  40s ribosomal protein s9                           178   3e-53   
ref|XP_007360763.1|  40S ribosomal protein S9                           178   3e-53   
ref|XP_001608270.1|  PREDICTED: 40S ribosomal protein S9                178   3e-53   
ref|XP_003325266.1|  40S ribosomal protein S9                           178   3e-53   
gb|ABZ04261.1|  ribosomal protein rps9                                  178   3e-53   
ref|XP_006897356.1|  PREDICTED: 40S ribosomal protein S9                178   3e-53   
gb|EPZ32298.1|  40S ribosomal protein S9                                178   3e-53   
ref|XP_791000.2|  PREDICTED: 40S ribosomal protein S9-like              178   3e-53   
ref|XP_008618158.1|  30S ribosomal protein S4                           178   3e-53   
ref|XP_006015023.1|  PREDICTED: 40S ribosomal protein S9-like           178   3e-53   
gb|KIY51995.1|  ribosomal protein S4                                    178   3e-53   
emb|CCW65500.1|  unnamed protein product                                178   3e-53   
ref|NP_595840.1|  40S ribosomal protein S9                              178   3e-53   
ref|XP_005367975.1|  PREDICTED: 40S ribosomal protein S9-like           178   4e-53   
gb|KGG50458.1|  putative 40S ribosomal protein S9                       178   4e-53   
ref|XP_005181976.1|  PREDICTED: 40S ribosomal protein S9                178   4e-53   
ref|XP_005534243.1|  PREDICTED: 40S ribosomal protein S9-like           178   4e-53   
ref|XP_005433872.1|  PREDICTED: 40S ribosomal protein S9-like           178   4e-53   
gb|KDQ15631.1|  hypothetical protein BOTBODRAFT_31523                   178   4e-53   
ref|XP_002603611.1|  hypothetical protein BRAFLDRAFT_126921             178   4e-53   
emb|CCW71658.1|  unnamed protein product                                178   4e-53   
gb|AAA85659.1|  ribosomal protein S9                                    178   4e-53   
ref|XP_002007973.1|  GI12083                                            178   4e-53   
gb|KDQ31494.1|  hypothetical protein PLEOSDRAFT_1054562                 178   4e-53   
emb|CAA47013.1|  ribosomal protein S9                                   178   4e-53   
emb|CAJ17220.1|  ribosomal protein S9e                                  178   4e-53   
ref|XP_007265130.1|  40S ribosomal protein S9                           178   4e-53   
ref|XP_007877369.1|  hypothetical protein PFL1_01668                    179   5e-53   
ref|XP_001729842.1|  hypothetical protein MGL_2828                      178   5e-53   
gb|AAX29348.1|  ribosomal protein S9                                    178   5e-53   
emb|CDQ94630.1|  unnamed protein product                                178   5e-53   
ref|XP_007324335.1|  hypothetical protein SERLADRAFT_480346             178   5e-53   
ref|XP_003977663.1|  PREDICTED: 40S ribosomal protein S9-like           178   5e-53   
gb|EIE83578.1|  40S ribosomal protein S9                                177   5e-53   
gb|EKV18981.1|  40S ribosomal protein S9                                177   5e-53   
ref|XP_002471051.1|  ribosomal protein S9                               177   6e-53   
gb|EMD42348.1|  40S ribosomal protein S9                                177   6e-53   
gb|EIE83453.1|  40S ribosomal protein S9                                177   6e-53   
ref|NP_001232711.1|  putative 40S ribosomal protein S9                  177   6e-53   
ref|XP_007538773.1|  PREDICTED: 40S ribosomal protein S9                177   6e-53   
gb|AEA39492.1|  ribosomal protein S9                                    177   6e-53   



>ref|XP_011075483.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
 ref|XP_011075484.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=197

 Score =   265 bits (676),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/131 (98%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001275235.1| uncharacterized protein LOC102577830 [Solanum tuberosum]
 ref|XP_006367429.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|ABA46767.1| unknown [Solanum tuberosum]
Length=197

 Score =   263 bits (671),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/131 (98%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010256989.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
 ref|XP_010269850.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=197

 Score =   262 bits (669),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/131 (97%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004135180.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004141548.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004172155.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004173021.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_008446334.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 ref|XP_008459594.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 gb|KGN51904.1| hypothetical protein Csa_5G604980 [Cucumis sativus]
 gb|KGN52667.1| hypothetical protein Csa_5G649850 [Cucumis sativus]
Length=197

 Score =   262 bits (669),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/131 (97%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_011098613.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=196

 Score =   261 bits (668),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/131 (98%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_011085760.1| PREDICTED: 40S ribosomal protein S9-2-like [Sesamum indicum]
Length=196

 Score =   261 bits (668),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/131 (98%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004228395.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 ref|XP_004228398.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum lycopersicum]
 ref|XP_010319448.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 gb|AAU93594.1| 40S ribosomal protein S9 , putative [Solanum demissum]
Length=197

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/131 (97%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KCW87774.1| hypothetical protein EUGRSUZ_A00153 [Eucalyptus grandis]
Length=140

 Score =   259 bits (661),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KCW56192.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=147

 Score =   259 bits (661),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004238784.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
Length=197

 Score =   261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/131 (97%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002517490.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF45032.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/131 (97%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010029297.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW56190.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=197

 Score =   260 bits (665),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010029477.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW83573.1| hypothetical protein EUGRSUZ_B00467 [Eucalyptus grandis]
Length=197

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>emb|CDP02222.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010037164.1| PREDICTED: 40S ribosomal protein S9-2-like [Eucalyptus grandis]
 gb|KCW48831.1| hypothetical protein EUGRSUZ_K02467 [Eucalyptus grandis]
Length=197

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002283256.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 ref|XP_002275166.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI22191.3| unnamed protein product [Vitis vinifera]
 emb|CBI15244.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   260 bits (664),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010091216.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB43471.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=199

 Score =   260 bits (664),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=176

 Score =   259 bits (661),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|EYU34659.1| hypothetical protein MIMGU_mgv1a014209mg [Erythranthe guttata]
Length=197

 Score =   259 bits (662),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+ALLRRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KDP31233.1| hypothetical protein JCGZ_11609 [Jatropha curcas]
Length=197

 Score =   259 bits (662),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KDP41175.1| hypothetical protein JCGZ_15582 [Jatropha curcas]
Length=197

 Score =   259 bits (661),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009600364.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
 ref|XP_009782105.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   258 bits (660),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002276284.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI31983.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009627396.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana tomentosiformis]
Length=197

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|EPS73776.1| hypothetical protein M569_00980 [Genlisea aurea]
Length=197

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|EYU22431.1| hypothetical protein MIMGU_mgv1a014214mg [Erythranthe guttata]
Length=197

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCVYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001274868.1| 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|AFW90596.1| putative 40S ribosomal protein S9 [Solanum tuberosum]
Length=197

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKD RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDSRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009604777.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002511557.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF52159.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=197

 Score =   258 bits (658),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009778292.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana sylvestris]
Length=197

 Score =   257 bits (657),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009598709.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   257 bits (657),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006367430.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Solanum 
tuberosum]
Length=197

 Score =   257 bits (656),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010242426.1| PREDICTED: 40S ribosomal protein S9-2 [Nelumbo nucifera]
Length=197

 Score =   257 bits (656),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009798560.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   257 bits (656),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009779308.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   256 bits (655),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|EYU28732.1| hypothetical protein MIMGU_mgv1a014218mg [Erythranthe guttata]
Length=197

 Score =   256 bits (655),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+AL+RRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002522398.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF39890.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ABQ32300.1| putative 40S ribosomal protein S9 [Artemisia annua]
Length=197

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVPFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTL+EKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLEEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_011004198.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004199.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004200.1| PREDICTED: 40S ribosomal protein S9-2 isoform X2 [Populus euphratica]
Length=197

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_007209623.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
 ref|XP_008239810.1| PREDICTED: 40S ribosomal protein S9-2-like [Prunus mume]
 gb|EMJ10822.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
Length=197

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTIVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006367431.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Solanum 
tuberosum]
Length=197

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>emb|CDP00311.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   255 bits (652),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRR+FEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKDPRRVFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_007037295.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY21796.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   254 bits (650),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|AFK46709.1| unknown [Lotus japonicus]
Length=197

 Score =   254 bits (650),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_007138197.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
 gb|ESW10191.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
Length=197

 Score =   254 bits (649),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004499428.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   254 bits (649),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010274527.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=223

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLA+TVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLAVTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>emb|CAG47084.1| 40S ribosomal protein S9 [Catharanthus roseus]
Length=197

 Score =   254 bits (648),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006380606.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
 gb|ERP58403.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
Length=197

 Score =   254 bits (648),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002317362.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
 gb|ABK93285.1| unknown [Populus trichocarpa]
 gb|EEE97974.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
Length=197

 Score =   253 bits (647),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVE+FLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVESFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ABK21901.1| unknown [Picea sitchensis]
 gb|ACN40156.1| unknown [Picea sitchensis]
Length=197

 Score =   253 bits (647),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   253 bits (647),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_007155321.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
 gb|ESW27315.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
Length=197

 Score =   253 bits (647),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001276185.1| 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_003523030.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_007137996.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
 gb|ACU20562.1| unknown [Glycine max]
 gb|ESW09990.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
Length=197

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003549666.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 gb|KHN18541.1| 40S ribosomal protein S9-2 [Glycine soja]
 gb|KHN48678.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=197

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_011004201.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Populus 
euphratica]
 ref|XP_011004202.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002323418.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 ref|XP_002322813.2| 40S ribosomal protein S9 [Populus trichocarpa]
 gb|ABK93151.1| unknown [Populus trichocarpa]
 gb|ABK96412.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05179.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 gb|EEF04574.2| 40S ribosomal protein S9 [Populus trichocarpa]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_011004703.1| PREDICTED: 40S ribosomal protein S9-2-like [Populus euphratica]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004508755.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
 ref|XP_004508756.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KJB74899.1| hypothetical protein B456_012G055000 [Gossypium raimondii]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KJB70960.1| hypothetical protein B456_011G097500 [Gossypium raimondii]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KJB33600.1| hypothetical protein B456_006G020700 [Gossypium raimondii]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KHG16530.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
 gb|KJB39897.1| hypothetical protein B456_007G036500 [Gossypium raimondii]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KJB11057.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
 gb|KJB11058.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
Length=197

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_007032505.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY03431.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ABF94049.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   251 bits (642),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004299381.1| PREDICTED: 40S ribosomal protein S9-2-like [Fragaria vesca subsp. 
vesca]
Length=198

 Score =   253 bits (645),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VFK G+
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTVVFKKGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010917021.1| PREDICTED: 40S ribosomal protein S9-2 [Elaeis guineensis]
Length=197

 Score =   253 bits (645),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYSLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>tpg|DAA55417.1| TPA: hypothetical protein ZEAMMB73_005048 [Zea mays]
Length=169

 Score =   251 bits (642),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ABA94598.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   251 bits (641),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002324730.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 ref|XP_006381972.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
 gb|ABK93418.1| unknown [Populus trichocarpa]
 gb|ABK95800.1| unknown [Populus trichocarpa]
 gb|ABK96647.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF03295.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 gb|ERP59769.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
Length=197

 Score =   253 bits (645),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006663032.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   252 bits (644),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001049004.1| Os03g0154700 [Oryza sativa Japonica Group]
 ref|NP_001068233.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|ABA94599.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94601.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94048.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22548.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10918.1| Os03g0154700 [Oryza sativa Japonica Group]
 dbj|BAF28596.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|EAY81477.1| hypothetical protein OsI_36650 [Oryza sativa Indica Group]
 gb|EAZ18880.1| hypothetical protein OsJ_34422 [Oryza sativa Japonica Group]
 gb|ABR25448.1| 40S ribosomal protein S9 [Oryza sativa Indica Group]
 dbj|BAG96424.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87870.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96556.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96871.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96935.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68442.1| hypothetical protein OsI_36651 [Oryza sativa Indica Group]
 gb|EEE52362.1| hypothetical protein OsJ_34424 [Oryza sativa Japonica Group]
 gb|EEE58343.1| hypothetical protein OsJ_09456 [Oryza sativa Japonica Group]
Length=195

 Score =   252 bits (643),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_007215987.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
 ref|XP_008230756.1| PREDICTED: 40S ribosomal protein S9-2 [Prunus mume]
 gb|EMJ17186.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
Length=198

 Score =   252 bits (643),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLEETQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009383889.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   252 bits (643),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_008780681.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780688.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780693.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
Length=197

 Score =   252 bits (643),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ+ALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQFALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDEMQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ABA94602.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=192

 Score =   251 bits (642),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010435836.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010441098.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010450759.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
Length=197

 Score =   252 bits (643),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006282728.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
 gb|EOA15626.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
Length=198

 Score =   251 bits (642),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009389620.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411686.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   251 bits (642),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003576178.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009414866.1| PREDICTED: 40S ribosomal protein S9-2 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009403622.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001278530.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG32995.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG34689.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACL52933.1| unknown [Zea mays]
 tpg|DAA55418.1| TPA: 40S ribosomal protein S9 isoform 1 [Zea mays]
 tpg|DAA55419.1| TPA: 40S ribosomal protein S9 isoform 2 [Zea mays]
Length=194

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ACU15321.1| unknown [Glycine max]
Length=222

 Score =   252 bits (643),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKT KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010554004.1| PREDICTED: 40S ribosomal protein S9-2 [Tarenaya hassleriana]
Length=197

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003598026.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003598028.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003604908.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|ACJ85917.1| unknown [Medicago truncatula]
 gb|AES68277.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES68279.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES87105.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AFK39708.1| unknown [Medicago truncatula]
 gb|AFK43821.1| unknown [Medicago truncatula]
Length=197

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001149705.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG36447.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFR11274.1| ribosomal protein S9 [Zea mays]
 tpg|DAA41536.1| TPA: 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|AFK40975.1| unknown [Medicago truncatula]
Length=197

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001238740.1| uncharacterized protein LOC100305663 [Glycine max]
 gb|ACU13464.1| unknown [Glycine max]
Length=197

 Score =   250 bits (638),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNY KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYEKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_001131442.1| uncharacterized protein LOC100192774 [Zea mays]
 gb|ACG30355.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFW87984.1| 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   250 bits (638),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>tpg|DAA41535.1| TPA: hypothetical protein ZEAMMB73_424707 [Zea mays]
Length=243

 Score =   251 bits (642),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004304310.1| PREDICTED: 40S ribosomal protein S9-2 [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   250 bits (638),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003562635.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002870751.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47010.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002442158.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
 gb|EES15996.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
Length=195

 Score =   249 bits (636),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ABR17162.1| unknown [Picea sitchensis]
 gb|ACN39805.1| unknown [Picea sitchensis]
 gb|ACN39957.1| unknown [Picea sitchensis]
 gb|ACN40724.1| unknown [Picea sitchensis]
 gb|ADE77363.1| unknown [Picea sitchensis]
Length=197

 Score =   249 bits (636),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003557815.1| PREDICTED: 40S ribosomal protein S9-2 [Brachypodium distachyon]
Length=195

 Score =   249 bits (636),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004962962.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=195

 Score =   249 bits (636),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006664031.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   249 bits (635),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KFK33188.1| hypothetical protein AALP_AA6G341500 [Arabis alpina]
Length=197

 Score =   249 bits (635),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALT+ENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTIENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|ACG33443.1| 40S ribosomal protein S9 [Zea mays]
Length=194

 Score =   249 bits (635),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPHRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002463229.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
 gb|EER99750.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
Length=194

 Score =   249 bits (635),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002463225.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
 gb|EER99746.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
Length=194

 Score =   249 bits (635),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|NP_198801.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
 sp|Q9FLF0.1|RS92_ARATH RecName: Full=40S ribosomal protein S9-2 [Arabidopsis thaliana]
 dbj|BAB10209.1| 40S ribosomal protein S9 [Arabidopsis thaliana]
 gb|AAM65655.1| 40S ribosomal protein S9-like [Arabidopsis thaliana]
 gb|ABD94071.1| At5g39850 [Arabidopsis thaliana]
 gb|AED94483.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
Length=197

 Score =   249 bits (635),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006405589.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
 gb|ESQ47042.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
Length=198

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNR GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRSGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004958404.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006438663.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
 ref|XP_006483187.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 ref|XP_006483188.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR51903.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
Length=197

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM+RYG L+ESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGFLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006650139.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|EMS50632.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT06699.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E Q+KLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLAEGQDKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004984207.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010939529.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+QNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRFGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010937076.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT VFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006657990.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=194

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHAR+LI
Sbjct  121  AKSIHHARILI  131



>ref|XP_010551858.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+VN+YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVNYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010550058.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   247 bits (630),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010545191.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   247 bits (630),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_008379343.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   247 bits (630),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>dbj|BAJ90873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=195

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKSPRRIFEGAALLRRMNRYGLLSEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003623232.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|AES79450.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=197

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLV EYGLRCKRELWRVQYALSRIRNN+R 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVREYGLRCKRELWRVQYALSRIRNNSRT  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010524330.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_008341561.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKXGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_001754369.1| predicted protein [Physcomitrella patens]
 ref|XP_001761244.1| predicted protein [Physcomitrella patens]
 gb|EDQ73966.1| predicted protein [Physcomitrella patens]
 gb|EDQ80819.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_001767226.1| predicted protein [Physcomitrella patens]
 gb|EDQ67907.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_001754496.1| predicted protein [Physcomitrella patens]
 gb|EDQ80466.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   244 bits (624),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_009124855.1| PREDICTED: 40S ribosomal protein S9-2 [Brassica rapa]
Length=197

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_003637511.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|KEH42383.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=224

 Score =   245 bits (626),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  28   MVKVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  87

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTL FK+GM
Sbjct  88   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLAFKSGM  147

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  148  AKSIHHARVLI  158



>emb|CDX74423.1| BnaA04g09660D [Brassica napus]
Length=198

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_001777561.1| predicted protein [Physcomitrella patens]
 gb|EDQ57604.1| predicted protein [Physcomitrella patens]
Length=197

 Score =   244 bits (623),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|AAT08735.1| 40S ribosomal protein S9 [Hyacinthus orientalis]
Length=197

 Score =   244 bits (622),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYVLSRIRNAARQ  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDE+DPRR+FEG+ALLRRM++YGLLDE QNKLDYVLALTVENFLERRLQT VFK GM
Sbjct  61   LLTLDERDPRRVFEGEALLRRMHKYGLLDEEQNKLDYVLALTVENFLERRLQTQVFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_001762390.1| predicted protein [Physcomitrella patens]
 gb|EDQ72857.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNNARM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_010695717.1| PREDICTED: 40S ribosomal protein S9-2-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score =   242 bits (618),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM+R+GLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006400037.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
 gb|ESQ41490.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
Length=198

 Score =   242 bits (618),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>ref|NP_197024.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 sp|Q9LXG1.1|RS91_ARATH RecName: Full=40S ribosomal protein S9-1 [Arabidopsis thaliana]
 emb|CAB89330.1| 40S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAR24214.1| At5g15200 [Arabidopsis thaliana]
 gb|AAR92351.1| At5g15200 [Arabidopsis thaliana]
 dbj|BAF00367.1| 40S ribosomal protein - like [Arabidopsis thaliana]
 gb|AED92128.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=198

 Score =   242 bits (618),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>ref|XP_010092050.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB49964.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=271

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  283
            GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK+PR
Sbjct  85   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKNPR  144

Query  284  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  463
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAKSIHHARVL
Sbjct  145  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIHHARVL  204

Query  464  I  466
            I
Sbjct  205  I  205



>ref|XP_006288701.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
 ref|XP_010453649.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 ref|XP_010492346.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 gb|EOA21599.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
Length=197

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>ref|NP_001119227.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 gb|AED92129.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=156

 Score =   240 bits (613),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>ref|XP_010420178.1| PREDICTED: 40S ribosomal protein S9-1 [Camelina sativa]
Length=198

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>ref|XP_010683223.1| PREDICTED: 40S ribosomal protein S9-2 [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   241 bits (616),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMN++GLLDE QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|EMS59613.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT26225.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   241 bits (616),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KREL+RVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELYRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTV+NFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLTEEQNKLDYVLALTVDNFLQRRLQTIVFKNGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KFK25765.1| hypothetical protein AALP_AA8G156800 [Arabis alpina]
Length=197

 Score =   241 bits (616),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>ref|XP_006431128.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 ref|XP_006482573.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR44368.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 gb|KDO72548.1| hypothetical protein CISIN_1g046291mg [Citrus sinensis]
Length=197

 Score =   241 bits (615),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVG +GLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGSFGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRRIFEG ALLRRM RYGLL+ +QNKLDYVLALTVE+FLERRLQT+VFKAG+
Sbjct  61   LLTLDEKDPRRIFEGQALLRRMFRYGLLEATQNKLDYVLALTVESFLERRLQTVVFKAGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002985335.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
 ref|XP_002987182.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ11758.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ13465.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
Length=198

 Score =   241 bits (615),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV+V+FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWR+QY LSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRLQYVLSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEGDALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGDALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVL+
Sbjct  121  AKSIHHARVLV  131



>ref|XP_002873713.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49972.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=198

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKSPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>ref|XP_002960852.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
 ref|XP_002967162.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ31761.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ38391.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
Length=198

 Score =   239 bits (609),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  YRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRN +R 
Sbjct  1    MVHVCVYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNASRH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVL+
Sbjct  121  AKSIHHARVLV  131



>ref|XP_009131450.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 ref|XP_009121599.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 emb|CDX91003.1| BnaC02g05940D [Brassica napus]
 emb|CDX85559.1| BnaA02g02540D [Brassica napus]
 emb|CDX85058.1| BnaC05g19970D [Brassica napus]
 emb|CDX78618.1| BnaA03g05300D [Brassica napus]
 emb|CDX70599.1| BnaC03g06830D [Brassica napus]
 emb|CDX69542.1| BnaA10g18910D [Brassica napus]
Length=197

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIHH+RVLI
Sbjct  121  AKSIHHSRVLI  131



>gb|EAY83173.1| hypothetical protein OsI_38384 [Oryza sativa Indica Group]
Length=173

 Score =   236 bits (602),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M+HV+FYRNYGKTFKK RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MMHVSFYRNYGKTFKKQRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPCRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHA  LI
Sbjct  121  AKSIHHACFLI  131



>gb|EAY83171.1| hypothetical protein OsI_38381 [Oryza sativa Indica Group]
Length=192

 Score =   235 bits (600),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKP+RPYEKERLDAELKLVGEYGLRCKRELWRVQYAL+RIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPKRPYEKERLDAELKLVGEYGLRCKRELWRVQYALNRIRNAARH  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRMN Y LL E QNKLD VLALT ENFL RRLQTLVFKAGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNHYRLLAEGQNKLDCVLALTAENFLARRLQTLVFKAGM  120

Query  434  AKSIHHARVL  463
            AKSIHHARVL
Sbjct  121  AKSIHHARVL  130



>ref|XP_006827176.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
 gb|ERM94413.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
Length=227

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  268
            F   +GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLD
Sbjct  36   FIEVHGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLD  95

Query  269  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIH  448
            EK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAKSIH
Sbjct  96   EKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIH  155

Query  449  HARVLI  466
            HARVLI
Sbjct  156  HARVLI  161



>ref|XP_009126038.1| PREDICTED: 40S ribosomal protein S9-1-like [Brassica rapa]
Length=197

 Score =   235 bits (599),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  434  AKSIHHARVLI  466
            AKSIH +RVLI
Sbjct  121  AKSIHPSRVLI  131



>gb|KHG14244.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=191

 Score =   233 bits (593),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  283
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  5    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  64

Query  284  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  463
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  65   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  124

Query  464  I  466
            I
Sbjct  125  I  125



>gb|KHG14681.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=189

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  283
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  3    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  62

Query  284  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  463
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  63   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  122

Query  464  I  466
            I
Sbjct  123  I  123



>gb|EEC74543.1| hypothetical protein OsI_10067 [Oryza sativa Indica Group]
Length=292

 Score =   234 bits (597),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  101  YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  280
            YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLDEK+P
Sbjct  107  YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNP  166

Query  281  RRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARV  460
            RRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGMAKSIHHARV
Sbjct  167  RRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIHHARV  226

Query  461  LI  466
            LI
Sbjct  227  LI  228



>gb|ADB77797.1| 40S ribosomal protein S9 [Chlamydomonas reinhardtii]
Length=178

 Score =   229 bits (583),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_001702303.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO97033.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
Length=190

 Score =   229 bits (583),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>emb|CDY30273.1| BnaC04g31840D [Brassica napus]
Length=965

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  769  MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  828

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VFK+GM
Sbjct  829  LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  888

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  889  AKSIHHARVLI  899



>gb|KHN30826.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=188

 Score =   227 bits (578),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 120/131 (92%), Gaps = 9/131 (7%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGE         WRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGE---------WRVQYALSRIRNNARN  51

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  52   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  111

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  112  AKSIHHARVLI  122



>pdb|3J60|J Chain J, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=195

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 2/126 (2%)
 Frame = +2

Query  95   RNYGKTF--KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  268
            R Y KT+  KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLD
Sbjct  6    RTYSKTYSTKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLD  65

Query  269  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIH  448
            EK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVFKAGMAKSIH
Sbjct  66   EKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIH  125

Query  449  HARVLI  466
            HARVLI
Sbjct  126  HARVLI  131



>ref|XP_002958222.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ40676.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=190

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTL+EKDP+RIFEG+AL+RRMNRYGLL ESQ+KLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLEEKDPKRIFEGNALMRRMNRYGLLSESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KHG06711.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=250

 Score =   229 bits (583),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  283
              TFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  64   ATTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  123

Query  284  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  463
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK GMAKSIHHARVL
Sbjct  124  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  183

Query  464  I  466
            I
Sbjct  184  I  184



>gb|KDP41176.1| hypothetical protein JCGZ_15583 [Jatropha curcas]
Length=201

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 2/129 (2%)
 Frame = +2

Query  80   HVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLL  259
            H++F  +    F   RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARMLL
Sbjct  9    HIDF--SLTSPFGGGRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARMLL  66

Query  260  TLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAK  439
            TLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFK+GMAK
Sbjct  67   TLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAK  126

Query  440  SIHHARVLI  466
            SIHHARVLI
Sbjct  127  SIHHARVLI  135



>gb|ADB77799.1| 40S ribosomal protein S9 [Klebsormidium flaccidum]
Length=129

 Score =   223 bits (567),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + +YRNYGKTFKKPRRP+ KERLDAELKLVGEYGLR KRELWRVQ+ALS+IRNNAR 
Sbjct  1    MPKIAYYRNYGKTFKKPRRPFVKERLDAELKLVGEYGLRNKRELWRVQHALSKIRNNART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ RRIFEG+ALLRR+ RYGLLDE+QNKLDYVLALTVENFLERRLQT VFKAG+
Sbjct  61   LLTLDEKNTRRIFEGEALLRRIFRYGLLDETQNKLDYVLALTVENFLERRLQTQVFKAGL  120

Query  434  AKSIHHARV  460
            AKSIHHARV
Sbjct  121  AKSIHHARV  129



>ref|XP_008341567.1| PREDICTED: 40S ribosomal protein S9-2, partial [Malus domestica]
Length=116

 Score =   216 bits (550),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF  421
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF  116



>emb|CEF99084.1| Ribosomal protein S4/S9, eukaryotic/archaeal [Ostreococcus tauri]
Length=192

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M    FYRNYGKTFKKPRRP+EK+RLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRNYGKTFKKPRRPFEKDRLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLALT E FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIIRRMRAYGLLDETQDKLDYVLALTPETFLERRLQTLVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKS+HHARVLI
Sbjct  121  AKSVHHARVLI  131



>ref|XP_002500609.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61867.1| predicted protein [Micromonas sp. RCC299]
Length=194

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M    FYR+Y KTFKKPRRP+EKERLD+ELK+VGEYGLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSTTFYRSYSKTFKKPRRPFEKERLDSELKIVGEYGLRNKRELWRVQFALNKLRNAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+A++RRM RYGLLDESQ+KLDYVLALT E FLERRLQT+VFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDESQDKLDYVLALTPEIFLERRLQTIVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKS+HHARVLI
Sbjct  121  AKSVHHARVLI  131



>gb|AES91245.2| 40S ribosomal protein S9, putative [Medicago truncatula]
Length=116

 Score =   213 bits (542),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLV  418
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLE RLQTL 
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLECRLQTLC  115



>ref|XP_001419792.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO98085.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M    +YRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTYYRNYGKTFKKPRRPFEKERLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLAL  E FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMRNYGLLDETQDKLDYVLALGPEQFLERRLQTLVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKS+HHARVLI
Sbjct  121  AKSVHHARVLI  131



>ref|XP_008367548.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S9-2-like 
[Malus domestica]
Length=197

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M HV+FYRNYGKT KKPRRPYEKERLDAELKLVGE+GLR  RELWRV  + SRIRNNAR 
Sbjct  1    MFHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEFGLRXPRELWRVSASQSRIRNNARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRI  G+ALLRRMNRY LLDE  NKL YVLAL VENFLERRL T+ FK GM
Sbjct  61   LLTLDEKNPRRIIXGEALLRRMNRYKLLDEGXNKLXYVLALNVENFLERRLXTIXFKTGM  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_005849917.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
 gb|EFN57815.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
Length=192

 Score =   214 bits (545),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + FYRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ  LS++R  AR 
Sbjct  1    MPSIGFYRNYGKTFKKPRRPFEKERLDAELKVVGEFGLRNKRELWRVQMVLSKLRARARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+R+FEG+ALLRRM RYG LDESQNKLDYVLALT  + LERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRLFEGEALLRRMYRYGFLDESQNKLDYVLALTPADVLERRLQTLVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_005648482.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23938.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   214 bits (544),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M H+++YRNYGKTFKKPRRP+EKERLD+ELKLVGE+GLR KRELWRVQ ALS+IR  AR 
Sbjct  1    MPHISYYRNYGKTFKKPRRPFEKERLDSELKLVGEFGLRNKRELWRVQMALSKIRQAART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLD+K+ +R+FEG+ALLRRM +YGLL+E+QNKLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDDKETKRLFEGEALLRRMYKYGLLEEAQNKLDYVLALTPQDFLERRLQTLVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKS+HHARVLI
Sbjct  121  AKSMHHARVLI  131



>ref|XP_003609048.1| 40S ribosomal protein S9 [Medicago truncatula]
Length=200

 Score =   214 bits (546),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLV  418
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLE RLQTL 
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLECRLQTLC  115



>gb|KIZ06357.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=191

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVFK G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|WP_039781875.1| hypothetical protein, partial [Nocardia cerradoensis]
Length=150

 Score =   211 bits (537),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M H+ +YRNYGKTFKKPRRP+E+ERLD+ELKLVGE+GLR KRELWRVQ ALS+IR  AR 
Sbjct  1    MPHIAYYRNYGKTFKKPRRPFEEERLDSELKLVGEFGLRNKRELWRVQMALSKIRQAART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLD+K+ +R+FEG+ALLRRM +YGLL+E+QNKLDYVLALT ++FLERRLQTLVFK G+
Sbjct  61   LLTLDDKETKRLFEGEALLRRMYKYGLLEETQNKLDYVLALTPQDFLERRLQTLVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKS+HHARVLI
Sbjct  121  AKSMHHARVLI  131



>gb|KIZ02547.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=227

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVFK G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002467783.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
 gb|EER94781.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
Length=177

 Score =   212 bits (539),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 112/131 (85%), Gaps = 16/131 (12%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+                NKLDYVLALTVENFL+RRLQT+VFK GM
Sbjct  61   LLTLDEKNPRRIFEGE----------------NKLDYVLALTVENFLQRRLQTIVFKNGM  104

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  105  AKSIHHARVLI  115



>ref|XP_003056784.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58429.1| predicted protein [Micromonas pusilla CCMP1545]
Length=196

 Score =   211 bits (537),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M    FYR+Y KTFKKPRRP+EKERLD ELK VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRSYSKTFKKPRRPFEKERLDNELKTVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDP+RIFEG+A++RRM RYGLLDE+Q+KLDYVLAL+ + FLERRLQTLVFK G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDETQDKLDYVLALSADAFLERRLQTLVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKS+HHARVLI
Sbjct  121  AKSVHHARVLI  131



>gb|ADB77794.1| 40S ribosomal protein S9 [Ulvella repens]
Length=129

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +2

Query  68   PKMVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNA  247
            PK+ H   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN A
Sbjct  2    PKIAH---YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMQLSKIRNAA  58

Query  248  RMLLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKA  427
            R LLTL+E+D RRIF+G+ALLRRM RYGLLDESQ  LDYVLAL   +FLERRLQTLVFK 
Sbjct  59   RTLLTLEERDSRRIFQGNALLRRMYRYGLLDESQKGLDYVLALQPSDFLERRLQTLVFKL  118

Query  428  GMAKSIHHARV  460
            G AKSIHHARV
Sbjct  119  GHAKSIHHARV  129



>emb|CCI69515.1| 40S ribosomal protein S9, partial [Chlorochytrium lemnae]
Length=119

 Score =   199 bits (506),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR LLTL+E
Sbjct  1    YRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARTLLTLEE  60

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIH  448
            KDP+RIFEG AL+RRM +YGLL+E+Q+KLDYVLALT ++FLERRLQTLVFK G+AKSIH
Sbjct  61   KDPKRIFEGQALMRRMYKYGLLNETQDKLDYVLALTPQDFLERRLQTLVFKQGLAKSIH  119



>gb|ADB77800.1| 40S ribosomal protein S9 [Phyllodictyon orientale]
Length=130

 Score =   199 bits (506),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + +YR+YGKTF+ PRRP+EKERLDAELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERLDAELKLVGEYGLRNKRELWRVQLALSKLRGAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFKAG  430
            LLTLDE DP+RIF+G++LLRRM RYGLLD E QNKLDY+LALT  +FLERRLQT VFK G
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQEKQNKLDYILALTPADFLERRLQTQVFKLG  120

Query  431  MAKSIHHARV  460
            +AKSIHHARV
Sbjct  121  LAKSIHHARV  130



>emb|CBN76630.1| conserved unknown protein [Ectocarpus siliculosus]
Length=194

 Score =   200 bits (509),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  V  +RNY KTFK PRRPYEKERLD+ELKL GEYGLRCKRE+WRVQ+AL++IR  AR 
Sbjct  1    MPKVGIHRNYRKTFKTPRRPYEKERLDSELKLCGEYGLRCKREIWRVQFALAKIRKAARQ  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLD KDP+R+FEG ALLRRM+R+GLL E + +LD+VL LT E  LERRLQT VFK G+
Sbjct  61   LLTLDTKDPKRLFEGPALLRRMSRFGLLGEDEKELDFVLQLTTEKMLERRLQTKVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_008654154.1| PREDICTED: 40S ribosomal protein S9-2-like [Zea mays]
Length=173

 Score =   199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  143  ERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMN  322
            +RLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMN
Sbjct  65   KRLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMN  124

Query  323  RYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLI  466
            RYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GMAKSIHHARVLI
Sbjct  125  RYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGMAKSIHHARVLI  172



>gb|ADB77796.1| 40S ribosomal protein S9 [Boodlea composita]
Length=130

 Score =   197 bits (500),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + +YR+YGKTF+ PRRP+EKERLD+ELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIGYYRSYGKTFRGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQLALSKLRGAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFKAG  430
            LLTLDE DP+RIF+G++LLRRM RYGLLD E Q+KLDY+LALT  +FLERRLQT VFK G
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQEKQSKLDYILALTPADFLERRLQTQVFKLG  120

Query  431  MAKSIHHARV  460
            +AKSIHHARV
Sbjct  121  LAKSIHHARV  130



>gb|ADB77795.1| 40S ribosomal protein S9 [Boergesenia forbesii]
Length=130

 Score =   197 bits (500),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  +  YR+YGKTF+ PRRP+EKERLD+ELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIGHYRSYGKTFRGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQLALSKLRGAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFKAG  430
            LLTLDE DP+RIF+G++LLRRM RYGLLD E QNKLDY+LALT  +FLERRLQT VFK G
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQEKQNKLDYILALTPADFLERRLQTQVFKLG  120

Query  431  MAKSIHHARV  460
            +AKSIHHARV
Sbjct  121  LAKSIHHARV  130



>gb|ADB77798.1| 40S ribosomal protein S9 [Cladophora coelothrix]
Length=179

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + +YR+YGKTF+ PRRP+EKER D+ELKLVGE+GLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERPDSELKLVGEFGLRNKRELWRVQLALSKLRGAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFKAG  430
            LLTLDE DP+RIF+G++LLRRM RYGLLD E QNKLDY+LALT  +FLERRLQT VFK G
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQEKQNKLDYILALTPADFLERRLQTQVFKLG  120

Query  431  MAKSIHHARVLI  466
            +AKSIHHARV+I
Sbjct  121  LAKSIHHARVII  132



>gb|ADB77801.1| 40S ribosomal protein S9 [Siphonocladus tropicus]
Length=130

 Score =   196 bits (499),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + +YR+YGKTF+ PRRP+EKERLD+ELKLVGEYGLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERLDSELKLVGEYGLRSKRELWRVQLALSKLRGAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFKAG  430
            LLTLDE D +RIF+G++LLRRM RYGLLD E QNKLDY+LALT  +FLERRLQT VFK G
Sbjct  61   LLTLDEDDSKRIFQGNSLLRRMYRYGLLDQEKQNKLDYILALTPADFLERRLQTQVFKLG  120

Query  431  MAKSIHHARV  460
            +AKSIHHARV
Sbjct  121  LAKSIHHARV  130



>dbj|BAA78592.1| 40S ribosomal protein S9 [Chlamydomonas sp. HS-5]
Length=192

 Score =   198 bits (504),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  +  YRNYGKTFKKPRRP+EKERLD ELKLVGEYGLR KRELWRVQ  LS+IRN AR 
Sbjct  1    MPKIGQYRNYGKTFKKPRRPFEKERLDGELKLVGEYGLRNKRELWRVQMILSKIRNAARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LL  DE D +R+FEG AL+RRM +YGLL+E+Q+KLDYVLAL   +FLERRLQT+VFK G+
Sbjct  61   LLQHDEDDTKRLFEGQALMRRMYKYGLLNETQDKLDYVLALQPNDFLERRLQTVVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>tpg|DAA63719.1| TPA: hypothetical protein ZEAMMB73_520702 [Zea mays]
Length=219

 Score =   199 bits (505),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  143  ERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMN  322
            +RLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMN
Sbjct  67   KRLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMN  126

Query  323  RYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLI  466
            RYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GMAKSIHHARVLI
Sbjct  127  RYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGMAKSIHHARVLI  174



>ref|XP_006381973.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
 gb|ERP59770.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
Length=178

 Score =   197 bits (500),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 105/131 (80%), Gaps = 19/131 (15%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGK FKKPRRPYEKE LDAELKLVGEYGLR KRELWRVQYA SRIRN A M
Sbjct  1    MVHVSFYRNYGKNFKKPRRPYEKECLDAELKLVGEYGLRAKRELWRVQYAFSRIRNAATM  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+ R                   +SQNKLDYVLALTVENFLERRLQTLVFKAGM
Sbjct  61   LLTLDEKNQR-------------------QSQNKLDYVLALTVENFLERRLQTLVFKAGM  101

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  102  AKSIHHARVLI  112



>gb|EJK71823.1| hypothetical protein THAOC_06697 [Thalassiosira oceanica]
Length=190

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            +RNY KT+K PRRPYEKERLDAELKLVGEYGLRCKRE+WRVQYAL+++R  AR+LLTLD 
Sbjct  7    HRNYRKTYKTPRRPYEKERLDAELKLVGEYGLRCKREIWRVQYALAKLRKAARVLLTLDP  66

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDP+RIFEG ALLRRM+RYGLL + + +LD+VL LT +  LERRLQT VFK G+AKSIHH
Sbjct  67   KDPKRIFEGAALLRRMSRYGLLADDELELDFVLQLTTQKLLERRLQTKVFKQGLAKSIHH  126

Query  452  ARVLI  466
            ARVLI
Sbjct  127  ARVLI  131



>ref|XP_002289706.1| RS9, ribosomal protein 9 [Thalassiosira pseudonana CCMP1335]
 gb|EED93243.1| RS9, ribosomal protein 9 [Thalassiosira pseudonana CCMP1335]
Length=190

 Score =   196 bits (498),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            +RNY KT+K PRRPYEKERLDAELKLVGEYGLRCKRE+WR QYAL+++R  AR LLTLD 
Sbjct  7    HRNYRKTYKTPRRPYEKERLDAELKLVGEYGLRCKREIWRCQYALAKLRKAARTLLTLDP  66

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDP+RIFEG ALLRRM+RYGLL E + +LD+VL LT +  LERRLQT VFK G+AKSIHH
Sbjct  67   KDPKRIFEGTALLRRMSRYGLLAEDELELDFVLQLTTQKLLERRLQTKVFKQGLAKSIHH  126

Query  452  ARVLI  466
            ARVLI
Sbjct  127  ARVLI  131



>ref|XP_006438664.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
 gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
Length=178

 Score =   195 bits (496),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 106/131 (81%), Gaps = 19/131 (15%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            L+ L EK  R+                   SQNKLDYVLALTVENFLERRLQTLVFK+GM
Sbjct  61   LVNLGEKKTRK-------------------SQNKLDYVLALTVENFLERRLQTLVFKSGM  101

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  102  AKSIHHARVLI  112



>ref|XP_011399104.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
 gb|KFM26208.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
Length=192

 Score =   196 bits (497),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  ++ YRNYGKTFKKPRRP+EKERLDAELK VGE+GLR KRELWRVQ  LS+ R+ AR 
Sbjct  1    MPSISCYRNYGKTFKKPRRPFEKERLDAELKTVGEFGLRNKRELWRVQLVLSKFRSRARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTL+EKDP+R+FEG+AL+RRM RYG L+  ++KLDYVL+LT +  LERRLQT VFK G+
Sbjct  61   LLTLEEKDPKRLFEGEALMRRMYRYGFLETHEDKLDYVLSLTPDRVLERRLQTQVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>tpg|DAA63723.1| TPA: hypothetical protein ZEAMMB73_488320 [Zea mays]
Length=259

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  143  ERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMN  322
            +RLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMN
Sbjct  67   KRLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMN  126

Query  323  RYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLI  466
            RYGLL E QNKLDYVLALTVENFL+RRLQT+VFK GMAKSIHHARVLI
Sbjct  127  RYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGMAKSIHHARVLI  174



>gb|ABF96251.1| 40S ribosomal protein S9, putative [Oryza sativa Japonica Group]
Length=157

 Score =   193 bits (490),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 105/131 (80%), Gaps = 11/131 (8%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MV V+FYRNYGKTFKKPRRPYEKER DAELKL GEYGLR K ELWRVQ            
Sbjct  1    MVRVSFYRNYGKTFKKPRRPYEKERPDAELKLYGEYGLRSKCELWRVQ-----------E  49

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEK+PRRIFEG+ALLR MNRYGLL E QNKLDYVLALTVENFL+ RLQT+VFK G 
Sbjct  50   LLTLDEKNPRRIFEGEALLRHMNRYGLLGEGQNKLDYVLALTVENFLQCRLQTIVFKNGT  109

Query  434  AKSIHHARVLI  466
             KSIHH  VLI
Sbjct  110  VKSIHHDHVLI  120



>gb|AGV54486.1| 40S ribosomal protein S9-2-like protein [Phaseolus vulgaris]
Length=197

 Score =   191 bits (485),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 110/136 (81%), Gaps = 10/136 (7%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLL--DESQNKL---DYVLALTVENFLERRLQTLV  418
            LLTLDEK+PRRIFEG+ALLRRM RYGL   D  Q +L    +   L   +  + RLQ+  
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLPRRDPEQTRLRPRTHCRELPRASPPDPRLQS--  118

Query  419  FKAGMAKSIHHARVLI  466
               GMAKSIHHARVLI
Sbjct  119  ---GMAKSIHHARVLI  131



>ref|XP_005534862.1| 40S ribosomal protein S9 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80255.1| 40S ribosomal protein S9 [Cyanidioschyzon merolae strain 10D]
Length=193

 Score =   190 bits (482),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YRN+ K +K PRRP+EKERLDAELKL GEYGLR KRE+WRVQYALS+IR  AR LLT DE
Sbjct  5    YRNFSKVYKIPRRPFEKERLDAELKLCGEYGLRNKREVWRVQYALSKIRAAARELLTKDE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KD RRI EG ALLRR+ RYGLLD++Q  L+YVL+L V++FLERRLQT VFK G+AKSIHH
Sbjct  65   KDERRIVEGAALLRRLTRYGLLDQTQQDLNYVLSLKVQDFLERRLQTQVFKLGLAKSIHH  124

Query  452  ARVLI  466
            ARVLI
Sbjct  125  ARVLI  129



>ref|XP_002367195.1| 40S ribosomal protein S9, putative [Toxoplasma gondii ME49]
 ref|XP_008883863.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|EPR63525.1| ribosomal protein RPS9 [Toxoplasma gondii GT1]
 gb|EPT25014.1| ribosomal protein RPS9 [Toxoplasma gondii ME49]
 gb|ESS34279.1| ribosomal protein RPS9 [Toxoplasma gondii VEG]
 gb|KEP65652.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|KFG46575.1| ribosomal protein RPS9 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG48357.1| ribosomal protein RPS9 [Toxoplasma gondii p89]
 gb|KFG54080.1| ribosomal protein RPS9 [Toxoplasma gondii FOU]
 gb|KFG64413.1| ribosomal protein RPS9 [Toxoplasma gondii RUB]
 gb|KFH12211.1| ribosomal protein RPS9 [Toxoplasma gondii VAND]
 gb|KFH16022.1| ribosomal protein RPS9 [Toxoplasma gondii MAS]
Length=188

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDPRR+F+G ALLRRM R GLL ES+ KLDYVL LTV  FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRVFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLERRLQTKVFKLGLAKSIHH  124

Query  452  ARVLI  466
            ARVLI
Sbjct  125  ARVLI  129



>gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina MS6]
Length=191

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|KEF58004.1| 40S ribosomal protein S9 [Exophiala aquamarina CBS 119918]
Length=193

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALNVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma septosporum NZE10]
Length=193

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa]
Length=193

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54]
 gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54]
Length=193

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_003886044.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
 emb|CBZ56018.1| hypothetical protein NCLIV_064440 [Neospora caninum Liverpool]
Length=188

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDPRR+F+G ALLRRM R GLL ES+ KLDYVL LTV  FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRLFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLERRLQTKVFKLGLAKSIHH  124

Query  452  ARVLI  466
            ARVLI
Sbjct  125  ARVLI  129



>gb|KIV80024.1| 40S ribosomal protein S9 [Exophiala sideris]
Length=193

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|KIW15420.1| 40S ribosomal protein S9 [Exophiala spinifera]
Length=193

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96]
 gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96]
Length=193

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_009155008.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656]
Length=193

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_005708491.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
 gb|EME31971.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
Length=193

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YR   KT++ PRRP+EKERLDAELKLVGEYGLR KRELWRV++ALS+IR  AR LLTL+E
Sbjct  5    YRTCSKTYRTPRRPFEKERLDAELKLVGEYGLRNKRELWRVEFALSKIRAAARDLLTLEE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDPRRIFEG+ALLRR+ R+GLLDE++  LD+VL+L V++ LERRLQT V K G+AKSIHH
Sbjct  65   KDPRRIFEGNALLRRLTRFGLLDETRQSLDHVLSLKVQDLLERRLQTQVLKLGLAKSIHH  124

Query  452  ARVLI  466
            ARVLI
Sbjct  125  ARVLI  129



>ref|XP_009038600.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
 gb|EGB06855.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
Length=196

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M   +F RNY KT K PRRP+EKER+D ELKLVGEYGLRCKRELWR Q AL+++R  AR 
Sbjct  1    MPKTSFLRNYRKTSKTPRRPFEKERIDGELKLVGEYGLRCKRELWRTQLALAKLRKAART  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLD KDP R+FE  ALLRR+ RYGLLDE++ +LD VL +T +  LERRLQT VFK G+
Sbjct  61   LLTLDTKDPARMFEAPALLRRLQRYGLLDETELELDAVLQMTTQRLLERRLQTKVFKQGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>gb|KIW44874.1| 40S ribosomal protein S9 [Exophiala oligosperma]
Length=193

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_007731850.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96]
 gb|EXJ86571.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96]
Length=193

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK++GEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIIGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALNVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|KIN07697.1| hypothetical protein OIDMADRAFT_16275 [Oidiodendron maius Zn]
Length=192

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|KIW07901.1| 40S ribosomal protein S9 [Verruconis gallopava]
Length=191

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_007922661.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis 
CIRAD86]
Length=193

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFEAARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD44674.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum 
UCRNP2]
Length=191

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_635999.1| ribosomal protein 1024 [Dictyostelium discoideum AX4]
 sp|P14132.1|RS9_DICDI RecName: Full=40S ribosomal protein S9; AltName: Full=40S ribosomal 
protein 1024; AltName: Full=Vegetative-specific protein 
V12 [Dictyostelium discoideum]
 emb|CAA29844.1| rp1024 protein [Dictyostelium discoideum]
 gb|EAL62451.1| ribosomal protein 1024 [Dictyostelium discoideum AX4]
Length=185

 Score =   188 bits (477),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  98   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  277
            NY KT   PRRP+EKER+DAELK+VGE+GL+ K E+WRVQYAL++IR  AR LL LDEKD
Sbjct  4    NYSKTSHTPRRPFEKERIDAELKVVGEFGLKNKNEVWRVQYALAKIRKAARELLVLDEKD  63

Query  278  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHAR  457
            P+RIFEG ALLRR+++ G+++ES+NKLDY+L L V++F+ERRLQTLVFK G+AKSIHHAR
Sbjct  64   PKRIFEGSALLRRLHKLGVMEESKNKLDYILNLKVQDFMERRLQTLVFKNGLAKSIHHAR  123

Query  458  VLI  466
            VLI
Sbjct  124  VLI  126



>ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553]
 gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553]
 gb|KIW95815.1| 40S ribosomal protein S9 [Cladophialophora bantiana CBS 173.52]
Length=192

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda]
Length=193

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_007782986.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218]
 gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218]
Length=191

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|KIW50177.1| 40S ribosomal protein S9 [Exophiala xenobiotica]
Length=193

 Score =   188 bits (478),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_005780612.1| hypothetical protein EMIHUDRAFT_460715 [Emiliania huxleyi CCMP1516]
 gb|EOD28183.1| hypothetical protein EMIHUDRAFT_460715 [Emiliania huxleyi CCMP1516]
Length=164

 Score =   187 bits (474),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M H +F RN+GKT + PRRP+EK+RLD E+KL+GE+GL+ KRE+WR Q  L+RIR  AR+
Sbjct  1    MPHASFLRNHGKTARTPRRPFEKQRLDIEMKLIGEFGLKNKREVWRTQLTLARIRKAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTL++KDP+R+FEG+ALLRR+ R G+LDES+ +LDYVLAL   +F+ERRLQT VFK G+
Sbjct  61   LLTLEDKDPKRLFEGNALLRRLVRLGVLDESKAQLDYVLALKPADFMERRLQTQVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_004336000.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13987.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
Length=188

 Score =   187 bits (476),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  283
            GKT K PRRP+EKERLD ELKL+GE+GL+ KRE+WRV YALS++R NAR LLTL EK P+
Sbjct  1    GKTVKTPRRPFEKERLDHELKLIGEFGLKNKREVWRVHYALSKVRKNARKLLTLPEKHPK  60

Query  284  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  463
            RIFEG A+LRR++R G+++ES+NKLDYVLAL + +FLERRLQT VFK G+AKSIHHARVL
Sbjct  61   RIFEGSAMLRRLHRMGVMEESKNKLDYVLALKINDFLERRLQTQVFKIGLAKSIHHARVL  120

Query  464  I  466
            I
Sbjct  121  I  121



>ref|XP_001546443.1| 40S ribosomal protein S9 [Botrytis cinerea B05.10]
 emb|CCD54749.1| similar to 40S ribosomal protein S9 [Botrytis cinerea T4]
 gb|EMR81651.1| putative 40s ribosomal protein s9 protein [Botrytis cinerea BcDW1]
Length=191

 Score =   187 bits (476),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+F+ERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFMERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>dbj|GAM43906.1| 40S ribosomal protein [Talaromyces cellulolyticus]
Length=192

 Score =   187 bits (476),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRPYE  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RSYSKTYKVPRRPYESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  455  RVLI  466
            RVLI
Sbjct  126  RVLI  129



>ref|XP_009531030.1| hypothetical protein PHYSODRAFT_354997 [Phytophthora sojae]
 gb|EGZ13601.1| hypothetical protein PHYSODRAFT_354997 [Phytophthora sojae]
Length=192

 Score =   187 bits (476),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  ++ +RNY KT++ P R +EKERLD ELKL+GEYGLRCKRE+WRVQYALS++R  AR 
Sbjct  1    MPKISRHRNYRKTYRTPSRAFEKERLDQELKLLGEYGLRCKREIWRVQYALSKLRKAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLD KDP+RIFEG ALLRR+ RYG+L E +N+LD+VL L V+  LERRLQT VFK  +
Sbjct  61   LLTLDPKDPKRIFEGSALLRRLKRYGMLSEDENELDFVLRLNVQKLLERRLQTKVFKQNL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_002486003.1| 40S ribosomal protein S9 [Talaromyces stipitatus ATCC 10500]
 gb|EED13765.1| 40S ribosomal protein S9 [Talaromyces stipitatus ATCC 10500]
Length=192

 Score =   187 bits (476),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRPYE  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RSYSKTYKVPRRPYESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  455  RVLI  466
            RVLI
Sbjct  126  RVLI  129



>gb|KDD75683.1| hypothetical protein H632_c551p0 [Helicosporidium sp. ATCC 50920]
Length=203

 Score =   188 bits (477),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  104  GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  283
            GK FK PRRP+EKERLDAELK VGEYGLRCKRELWRVQ  LS+ R+ AR LLTL E D R
Sbjct  22   GKVFKVPRRPFEKERLDAELKTVGEYGLRCKRELWRVQLVLSKFRSRARELLTLPENDAR  81

Query  284  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVL  463
            R+FEG+AL+RRM RYG LD SQ+KLDYVL+LT  + LERRLQTLVFK G+AKSIHHARVL
Sbjct  82   RVFEGEALMRRMYRYGFLDASQDKLDYVLSLTPADVLERRLQTLVFKLGLAKSIHHARVL  141

Query  464  I  466
            I
Sbjct  142  I  142



>ref|XP_002139923.1| 40S ribosomal protein S9 [Cryptosporidium muris RN66]
 gb|EEA05574.1| 40S ribosomal protein S9, putative [Cryptosporidium muris RN66]
Length=189

 Score =   187 bits (475),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  262
            V  Y N+ KT ++P+RP+EKERLDAE+KL+GEYGL+ KRE+WRVQY L++IR  AR LLT
Sbjct  2    VKSYTNHSKTSRQPKRPFEKERLDAEMKLIGEYGLKNKREVWRVQYTLAKIRAAARHLLT  61

Query  263  LDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKS  442
            LD+KDP R+F+G+ALLRRM R GLL E++ KLDYVL LTV  FLERRLQT VFK G+AKS
Sbjct  62   LDDKDPIRVFQGEALLRRMERLGLLSENERKLDYVLGLTVNKFLERRLQTRVFKLGLAKS  121

Query  443  IHHARVLI  466
            IHHARVLI
Sbjct  122  IHHARVLI  129



>emb|CDR95115.1| 40S ribosomal subunit protein S9, putative [Babesia bigemina]
Length=184

 Score =   187 bits (475),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  83   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  262
            V  YRNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  263  LDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKS  442
            LDEKD +R F+GDALLRRM RYGL+ E++ KLD+VL LT+   +ERRLQT VFK G+AKS
Sbjct  62   LDEKDTKRQFQGDALLRRMVRYGLMGENEQKLDFVLGLTLNKMMERRLQTKVFKLGLAKS  121

Query  443  IHHARVLI  466
            IHHAR +I
Sbjct  122  IHHARCMI  129



>ref|XP_005767233.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
 gb|EOD14804.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
Length=194

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M H +F RN+GKT + PRRP+EK+RLD E+KL+GE+GL+ KRE+WR Q  L+RIR  AR+
Sbjct  1    MPHASFLRNHGKTARTPRRPFEKQRLDIEMKLIGEFGLKNKREVWRTQLTLARIRKAARV  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTL++KDP+R+FEG+ALLRR+ R G+LDES+ +LDYVLAL   +F+ERRLQT VFK G+
Sbjct  61   LLTLEDKDPKRLFEGNALLRRLVRLGVLDESKAQLDYVLALKPADFMERRLQTQVFKLGL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



>ref|XP_006691696.1| 40S ribosomal protein s9-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS22704.1| 40S ribosomal protein s9-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=190

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R Y KT+K PRRPYE  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR+LLTLDEK
Sbjct  4    RKYSKTYKVPRRPYEAARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARILLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL  E+FLERRLQTLV+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALKAEDFLERRLQTLVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>emb|CCF75909.1| unnamed protein product [Babesia microti strain RI]
Length=189

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YRN  KT +KP+RPY KERLD+ELKL+GEYGL+ KRE+WRVQY L++IR+ AR LLTLDE
Sbjct  5    YRNSSKTSRKPKRPYGKERLDSELKLIGEYGLKNKREVWRVQYVLAKIRSAARHLLTLDE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDP+R+F+GDALLRRM RYGLL E + KLDY+L LT    +ERRLQT VFK G+AKSIHH
Sbjct  65   KDPKRLFQGDALLRRMVRYGLLGEGEQKLDYILGLTTAKLMERRLQTKVFKLGLAKSIHH  124

Query  452  ARVLI  466
            AR +I
Sbjct  125  ARCMI  129



>emb|CDJ32982.1| 40S ribosomal protein S9, putative [Eimeria mitis]
Length=188

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  452  ARVLI  466
            AR LI
Sbjct  125  ARCLI  129



>gb|KEQ66339.1| 40S ribosomal protein S9 [Aureobasidium melanogenum CBS 110374]
Length=191

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLT+DEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKSVGEYGLRNKREIWRVQLTLSKIRRAARQLLTMDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>emb|CDI78299.1| 40S ribosomal protein S9, putative [Eimeria acervulina]
 emb|CDI87489.1| 40S ribosomal protein S9, putative [Eimeria praecox]
 emb|CDJ56695.1| 40S ribosomal protein S9, putative [Eimeria maxima]
Length=188

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YRN+ KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNHSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  452  ARVLI  466
            AR LI
Sbjct  125  ARCLI  129



>gb|KIX06477.1| 40S ribosomal protein S9 [Rhinocladiella mackenziei CBS 650.93]
Length=193

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLILSKIRRAARELLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_002152417.1| 40S ribosomal protein S9 [Talaromyces marneffei ATCC 18224]
 gb|EEA19480.1| 40S ribosomal protein S9 [Talaromyces marneffei ATCC 18224]
 gb|KFX49628.1| 40S ribosomal protein S9 [Talaromyces marneffei PM1]
Length=191

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRPYE  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RSYSKTYKVPRRPYESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  455  RVLI  466
            RVLI
Sbjct  126  RVLI  129



>gb|ADB77802.1| 40S ribosomal protein S9 [Ulva intestinalis]
Length=175

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR L+TL+E
Sbjct  5    YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMQLSKIRNAARTLITLEE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            +DPRRIF+G+ALL+RM RYGLLDESQ   D VLA    +FLERRL T VFK G AK IHH
Sbjct  65   RDPRRIFQGNALLKRMYRYGLLDESQKGXDXVLAXQPSDFLERRLXTXVFKLGHAKFIHH  124

Query  452  ARVL  463
               L
Sbjct  125  XXXL  128



>ref|XP_008808061.1| PREDICTED: 40S ribosomal protein S9-2-like, partial [Phoenix 
dactylifera]
Length=165

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  170  VGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMNRYGLLDESQ  349
            VGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+Q
Sbjct  1    VGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMNRFGLLDENQ  60

Query  350  NKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLI  466
            NKLDYVLALTVENFLERRLQT VFK+GMAKSIHHARVLI
Sbjct  61   NKLDYVLALTVENFLERRLQTQVFKSGMAKSIHHARVLI  99



>gb|KIV89206.1| 40S ribosomal protein S9 [Exophiala mesophila]
Length=193

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+  PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_007698387.1| hypothetical protein COCSADRAFT_35730 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_008031057.1| hypothetical protein SETTUDRAFT_98745 [Setosphaeria turcica Et28A]
 gb|EMD65693.1| hypothetical protein COCSADRAFT_35730 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD89741.1| hypothetical protein COCHEDRAFT_1225361 [Bipolaris maydis C5]
 gb|ENI10046.1| hypothetical protein COCC4DRAFT_185738 [Bipolaris maydis ATCC 
48331]
 gb|EOA81657.1| hypothetical protein SETTUDRAFT_98745 [Setosphaeria turcica Et28A]
Length=192

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>gb|EPE04605.1| 40s ribosomal protein s9 [Ophiostoma piceae UAMH 11346]
Length=190

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +2

Query  98   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  277
            +Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  278  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHAR  457
            P+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL VE+FLERRLQTLV+K G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDDSRMKLDYVLALKVEDFLERRLQTLVYKLGLAKSIHHAR  124

Query  458  VLI  466
            VLI
Sbjct  125  VLI  127



>ref|XP_662407.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 gb|EAA60373.1| RS9_PODAN 40S ribosomal protein S9 (S7) [Aspergillus nidulans 
FGSC A4]
 tpe|CBF76749.1| TPA: hypothetical protein similar to 40S ribosomal protein S9 
(Broad) [Aspergillus nidulans FGSC A4]
Length=193

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ+ LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQFTLSKIRRAARELLTLDEK  65

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  455  RVLI  466
            RVLI
Sbjct  126  RVLI  129



>gb|KEQ72499.1| 40S ribosomal protein S9 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ89117.1| 40S ribosomal protein S9 [Aureobasidium pullulans EXF-150]
Length=192

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+K PRRP+E  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLT+DEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKSVGEYGLRNKREIWRVQLTLSKIRRAARQLLTMDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_001937443.1| 40S ribosomal protein S9 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU50030.1| 40S ribosomal protein S9 [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=193

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  5    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  64

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  65   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  124

Query  455  RVLI  466
            RVLI
Sbjct  125  RVLI  128



>gb|AET50489.1| hypothetical protein [Eimeria tenella]
 emb|CDJ43151.1| 40S ribosomal protein S9, putative [Eimeria tenella]
Length=188

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  92   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  271
            YRN  KT + P+RP+EKERLD EL+L+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRNQSKTARNPKRPFEKERLDQELRLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  272  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHH  451
            KDPRRIF+G ALLRRM R GLL E + KLDYVL LTV+ FLERRLQT VFK G+AKSIHH
Sbjct  65   KDPRRIFQGTALLRRMVRLGLLSEGEQKLDYVLGLTVQKFLERRLQTRVFKLGLAKSIHH  124

Query  452  ARVLI  466
            AR LI
Sbjct  125  ARCLI  129



>ref|XP_003286040.1| rp1024 protein [Dictyostelium purpureum]
 gb|EGC37476.1| rp1024 protein [Dictyostelium purpureum]
Length=186

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            RN+ KT   P RP+EKER+DAELK+VGEYGL+ K E+WRVQ+AL++IR  AR LL LDEK
Sbjct  4    RNFSKTSNTPVRPFEKERIDAELKVVGEYGLKNKNEVWRVQFALAKIRKAARELLVLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG ALLRR+++ G++DES+NKLDYVL L V++F+ERRLQTLVFK G+AKSIHHA
Sbjct  64   DPKRLFEGAALLRRLHKLGVMDESKNKLDYVLNLKVQDFMERRLQTLVFKNGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_003838270.1| similar to 40S ribosomal protein S9 [Leptosphaeria maculans JN3]
 emb|CBX94791.1| similar to 40S ribosomal protein S9 [Leptosphaeria maculans JN3]
Length=192

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_007674573.1| hypothetical protein BAUCODRAFT_66115, partial [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC98135.1| hypothetical protein BAUCODRAFT_66115, partial [Baudoinia compniacensis 
UAMH 10762]
Length=194

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  95   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  274
            R Y KT+K PRRP+E  RLD+ELK+VGEYGL+ KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RKYSKTYKVPRRPFESARLDSELKIVGEYGLKNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  275  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHA  454
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+K G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  455  RVLI  466
            RVLI
Sbjct  124  RVLI  127



>ref|XP_005852611.1| small subunit ribosomal protein S9e [Nannochloropsis gaditana 
CCMP526]
 gb|EKU23223.1| small subunit ribosomal protein S9e [Nannochloropsis gaditana 
CCMP526]
Length=200

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +2

Query  74   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  253
            M  + F RNY KT K PRRP+EKERLD ELKL GEYGLRCK E+WRVQ+AL++IR  AR 
Sbjct  1    MPSIAFRRNYRKTDKTPRRPFEKERLDQELKLCGEYGLRCKAEIWRVQFALAKIRKAARE  60

Query  254  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  433
            LLTLDEKDPRR+FEG ALLRR  R GLL++ + +LD+VL LT +  LERRLQT VFK  +
Sbjct  61   LLTLDEKDPRRVFEGPALLRRCVRAGLLEQDKAELDFVLQLTTQKLLERRLQTKVFKQSL  120

Query  434  AKSIHHARVLI  466
            AKSIHHARVLI
Sbjct  121  AKSIHHARVLI  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750