BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP019A07 499 bp,:Filtered

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABG27026.1|  phosophlipid protein                                  87.8    8e-19   Gymnadenia conopsea
gb|ADB12472.1|  lipid transfer protein                                82.0    7e-17   Crocus sativus [saffron crocus]
ref|XP_009396874.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAY83346.1|  non-specific lipid transfer protein precursor         79.0    2e-15   Fragaria x ananassa
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...  79.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CAG28937.1|  lipid transfer protein                               78.6    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065585.1|  Os11g0116000                                     78.2    3e-15   
gb|EAY79716.1|  hypothetical protein OsI_34868                        78.2    3e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001065988.1|  Os12g0115300                                     77.8    4e-15   
ref|XP_011466421.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    6e-15   Fragaria vesca subsp. vesca
gb|AGN56423.1|  non-specific lipid transfer protein 3                 77.0    6e-15   Linum usitatissimum
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    7e-15   Fragaria vesca subsp. vesca
gb|EAY79718.1|  hypothetical protein OsI_34870                        77.0    8e-15   Oryza sativa Indica Group [Indian rice]
gb|ABG54494.1|  putative allergen Rub i 3                             77.0    9e-15   Rubus idaeus [European raspberry]
gb|AAT80663.1|  lipid transfer protein precursor                      76.6    1e-14   Malus domestica [apple tree]
gb|KEH29195.1|  Lipid transfer protein                                77.8    1e-14   Medicago truncatula
ref|XP_003605309.1|  Non-specific lipid-transfer protein              78.2    2e-14   
gb|AAT80652.1|  lipid transfer protein precursor                      76.3    2e-14   Malus domestica [apple tree]
gb|AAT80650.1|  lipid transfer protein precursor                      75.9    2e-14   Malus domestica [apple tree]
ref|NP_001065989.2|  Os12g0115500                                     75.1    3e-14   
ref|NP_001065586.1|  Os11g0116200                                     75.9    3e-14   
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               75.5    3e-14   Phalaenopsis japonica
gb|AAY83345.1|  non-specific lipid transfer protein precursor         75.1    4e-14   Fragaria x ananassa
gb|AAY83343.1|  non-specific lipid transfer protein precursor         74.7    5e-14   Fragaria x ananassa
gb|AAT80665.1|  lipid transfer protein precursor                      74.7    6e-14   Malus domestica [apple tree]
gb|ABK96515.1|  unknown                                               73.6    1e-13   Populus trichocarpa x Populus deltoides
ref|XP_009384323.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK94706.1|  unknown                                               73.6    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   Populus euphratica
emb|CAT99615.1|  lipid transfer protein                               72.4    2e-13   Malus domestica [apple tree]
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    2e-13   Fragaria vesca subsp. vesca
gb|AFM35695.1|  nonspecific lipid transfer protein                    73.2    3e-13   Vitis pseudoreticulata
emb|CDP14199.1|  unnamed protein product                              72.8    3e-13   Coffea canephora [robusta coffee]
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   72.8    3e-13   Malus domestica [apple tree]
ref|XP_002305878.2|  lipid transfer family protein                    72.4    4e-13   Populus trichocarpa [western balsam poplar]
emb|CAC86258.1|  lipid transfer protein                               72.4    4e-13   Fragaria x ananassa
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    4e-13   Eucalyptus grandis [rose gum]
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        72.4    4e-13   Sorghum bicolor [broomcorn]
gb|AAT80649.1|  lipid transfer protein precursor                      72.4    5e-13   Malus domestica [apple tree]
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   71.6    7e-13   Pyrus x bretschneideri [bai li]
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   71.6    8e-13   Eucalyptus grandis [rose gum]
gb|AGN56422.1|  non-specific lipid transfer protein 2                 71.6    8e-13   Linum usitatissimum
gb|ABB96481.1|  non-specific lipid transfer protein precursor         71.6    8e-13   Malus domestica [apple tree]
emb|CAB96874.1|  mal d 3                                              70.9    8e-13   Malus domestica [apple tree]
gb|AGN56421.1|  non-specific lipid transfer protein 1                 71.6    8e-13   Linum usitatissimum
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    71.2    9e-13   Malus domestica [apple tree]
gb|AET05730.1|  lipid transfer protein isoform a                      70.9    1e-12   Pyrus communis
gb|AAR22488.1|  allergen Mal d 3                                      71.2    1e-12   Malus domestica [apple tree]
gb|AET05731.1|  lipid transfer protein isoform b                      70.5    1e-12   Pyrus communis
dbj|BAI94496.1|  lipid transfer protein                               71.2    1e-12   Dianthus caryophyllus [carnation]
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  70.9    2e-12   Pyrus communis
gb|ACI47547.1|  nonspecific lipid transfer protein                    70.9    2e-12   Juglans regia
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    2e-12   Elaeis guineensis
emb|CAA80809.1|  lipid transfer protein                               70.5    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006663744.1|  PREDICTED: probable non-specific lipid-trans...  70.5    2e-12   Oryza brachyantha
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   70.5    2e-12   Pyrus x bretschneideri [bai li]
sp|P80273.2|NLTP3_VITSX  RecName: Full=Non-specific lipid-transfe...  69.7    2e-12   Vitis sp.
ref|XP_003579021.1|  PREDICTED: probable non-specific lipid-trans...  70.5    3e-12   Brachypodium distachyon [annual false brome]
gb|ADV02772.1|  lipid transfer protein 1a                             70.1    3e-12   Ipomoea batatas [batate]
dbj|BAI94497.1|  lipid transfer protein                               70.1    3e-12   Dianthus caryophyllus [carnation]
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  69.3    3e-12   Prunus domestica
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  69.7    4e-12   Hordeum vulgare [barley]
ref|XP_009132019.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    4e-12   Brassica rapa
sp|P85105.1|NLTP5_VITSX  RecName: Full=Non-specific lipid-transfe...  68.9    4e-12   Vitis sp.
dbj|BAK05751.1|  predicted protein                                    69.7    4e-12   Hordeum vulgare subsp. vulgare [barley]
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    4e-12   Populus euphratica
gb|AER92599.1|  putative lipid transfer protein                       69.7    4e-12   Linum usitatissimum
gb|AAY83344.1|  non-specific lipid transfer protein precursor         69.3    6e-12   Fragaria x ananassa
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    6e-12   Oryza brachyantha
gb|AAY83342.1|  non-specific lipid transfer protein precursor         68.9    7e-12   Fragaria x ananassa
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    7e-12   Oryza brachyantha
emb|CDP14198.1|  unnamed protein product                              68.9    7e-12   Coffea canephora [robusta coffee]
emb|CBI18043.3|  unnamed protein product                              69.3    7e-12   Vitis vinifera
gb|AAL27855.1|  lipid transfer protein precursor                      67.0    8e-12   Davidia involucrata
gb|AAP92127.1|  lipid transfer protein LPT1                           68.9    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    9e-12   Vitis vinifera
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  67.8    1e-11   Prunus armeniaca
ref|XP_009398877.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        68.6    1e-11   Zea mays [maize]
gb|ACJ62320.1|  lipid-transfer protein                                68.6    1e-11   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001065986.1|  Os12g0115000                                     68.2    1e-11   
ref|NP_001176316.1|  Os11g0115466                                     68.6    1e-11   
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  68.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    1e-11   Nicotiana tomentosiformis
dbj|BAC77694.1|  lipid transfer protein                               68.2    1e-11   Atriplex nummularia
gb|ABA34098.1|  phospholipid transfer protein 2                       68.2    1e-11   Zea diploperennis [chapule]
gb|ACJ62323.1|  lipid-transfer protein                                68.2    1e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62315.1|  lipid-transfer protein                                68.2    1e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADR66947.1|  non-specific lipid transfer protein                   68.2    1e-11   Prunus armeniaca
gb|AFK38461.1|  unknown                                               68.2    1e-11   Lotus japonicus
gb|AAA74624.1|  lipid transfer protein precursor                      68.2    1e-11   Oryza sativa [red rice]
gb|ACJ62316.1|  lipid-transfer protein                                68.2    1e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAB70539.1|  lipid transfer protein LPT II                         68.2    2e-11   Oryza sativa Indica Group [Indian rice]
gb|AHB19225.1|  non specific lipid transfer protein 1C                68.2    2e-11   Punica granatum [granado]
gb|ACJ62355.1|  lipid-transfer protein                                67.8    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62319.1|  lipid-transfer protein                                68.2    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62318.1|  lipid-transfer protein                                68.2    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAT99613.1|  lipid transfer protein                               67.4    2e-11   Malus domestica [apple tree]
gb|ACJ62339.1|  lipid-transfer protein                                68.2    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADR66948.1|  non-specific lipid transfer protein                   67.8    2e-11   Prunus armeniaca
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  67.8    2e-11   Leonurus japonicus [Chinese motherwort]
gb|ACJ62326.1|  lipid-transfer protein                                67.8    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACL01093.1|  lipid transfer protein                                67.4    2e-11   Castanea mollissima
ref|NP_001150972.1|  nonspecific lipid-transfer protein 3 precursor   67.4    3e-11   Zea mays [maize]
gb|ADK60918.1|  lipid transfer protein                                67.4    3e-11   Castanea sativa
ref|NP_001142300.1|  uncharacterized protein LOC100274469 precursor   67.4    3e-11   Zea mays [maize]
gb|AET05733.1|  lipid transfer protein isoform d                      66.6    3e-11   Pyrus communis
ref|NP_001105392.1|  phospholipid transfer protein precursor          67.4    3e-11   Zea mays [maize]
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 66.6    3e-11   Nicotiana tabacum [American tobacco]
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        67.4    3e-11   Sorghum bicolor [broomcorn]
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            67.4    4e-11   Cicer arietinum [garbanzo]
dbj|BAO51648.1|  lipid transfer protein                               67.0    4e-11   Suaeda japonica
gb|ACJ62381.1|  lipid-transfer protein                                67.0    4e-11   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    4e-11   Phoenix dactylifera
gb|ACJ62361.1|  lipid-transfer protein                                67.0    4e-11   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    4e-11   Prunus mume [ume]
emb|CAN70512.1|  hypothetical protein VITISV_005630                   66.6    4e-11   Vitis vinifera
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    5e-11   Nicotiana tomentosiformis
ref|XP_006662670.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    5e-11   Oryza brachyantha
gb|ACJ62387.1|  lipid-transfer protein                                66.6    5e-11   Zea mays subsp. parviglumis [Balsas teosinte]
sp|Q43193.1|NLTP1_SORBI  RecName: Full=Non-specific lipid-transfe...  66.6    5e-11   Sorghum bicolor [broomcorn]
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   Prunus mume [ume]
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    5e-11   Prunus mume [ume]
gb|AAT68263.1|  lipid transfer protein                                66.6    5e-11   Nicotiana glauca [glaucous tobacco]
gb|ABA33862.1|  phospholipid transfer protein 1                       66.2    6e-11   Zea diploperennis [chapule]
gb|AFK44274.1|  unknown                                               66.6    6e-11   Medicago truncatula
ref|XP_003605266.1|  Non-specific lipid-transfer protein              66.2    6e-11   Medicago truncatula
gb|AAZ32875.1|  lipid transfer protein precursor                      65.5    6e-11   Medicago sativa [alfalfa]
ref|XP_006346674.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    6e-11   Solanum tuberosum [potatoes]
emb|CCD33109.1|  lipid transfer protein                               66.2    6e-11   Vigna radiata [mung bean]
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    6e-11   
emb|CAT99614.1|  lipid transfer protein                               65.5    6e-11   Malus domestica [apple tree]
gb|ACJ62342.1|  lipid-transfer protein                                66.2    7e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFK36168.1|  unknown                                               65.9    7e-11   Lotus japonicus
ref|NP_001268074.1|  lipid transfer protein precursor                 66.2    7e-11   Vitis vinifera
gb|ABA34089.1|  phospholipid transfer protein 2                       66.2    7e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33857.1|  phospholipid transfer protein 1                       66.2    8e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            65.9    8e-11   Corylus avellana [European hazelnut]
gb|ABA34080.1|  phospholipid transfer protein 2                       66.2    8e-11   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    8e-11   Elaeis guineensis
ref|XP_009410515.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    8e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABQ53932.1|  lipid transfer protein                                65.9    9e-11   Sesamum indicum [beniseed]
gb|ABA33855.1|  phospholipid transfer protein 1                       65.9    1e-10   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33846.1|  phospholipid transfer protein 1                       65.9    1e-10   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33848.1|  phospholipid transfer protein 1                       65.5    1e-10   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CDM80995.1|  unnamed protein product                              65.5    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            65.5    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|ABE11609.1|  lipid-transfer protein precursor                      65.5    1e-10   Solanum chacoense
gb|AAB70538.1|  lipid transfer protein                                65.5    1e-10   Oryza sativa Indica Group [Indian rice]
gb|AFX65219.1|  lipid transfer precursor protein                      65.5    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004977380.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-10   Setaria italica
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   65.5    1e-10   
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    65.5    1e-10   Lilium hybrid cultivar
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        65.5    1e-10   Zea mays [maize]
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    1e-10   Malus domestica [apple tree]
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  64.7    1e-10   Zea mays [maize]
gb|AES87466.2|  Lipid transfer protein                                65.9    1e-10   Medicago truncatula
gb|ABA33853.1|  phospholipid transfer protein 1                       65.1    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33847.1|  phospholipid transfer protein 1                       65.5    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    65.5    2e-10   
gb|ABA33860.1|  phospholipid transfer protein 1                       65.1    2e-10   Zea diploperennis [chapule]
gb|AET05732.1|  lipid transfer protein isoform c                      64.7    2e-10   Pyrus communis
gb|ABA33866.1|  phospholipid transfer protein 1                       65.1    2e-10   Zea diploperennis [chapule]
gb|ABA33849.1|  phospholipid transfer protein 1                       65.1    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33850.1|  phospholipid transfer protein 1                       65.1    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   Sesamum indicum [beniseed]
gb|ABA33858.1|  phospholipid transfer protein 1                       65.1    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   Nelumbo nucifera [Indian lotus]
tpg|DAA59277.1|  TPA: hypothetical protein ZEAMMB73_838830            65.9    2e-10   Zea mays [maize]
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   Cucumis melo [Oriental melon]
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   Malus domestica [apple tree]
gb|ABA34092.1|  phospholipid transfer protein 2                       65.1    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  65.1    2e-10   Oryza sativa [red rice]
ref|NP_001268120.1|  lipid transfer protein precursor                 65.1    2e-10   Vitis vinifera
gb|AAL25839.1|  lipid transfer precursor protein                      65.1    2e-10   Hevea brasiliensis [Para rubber tree]
gb|ABA29446.1|  non-specific lipid transfer protein                   65.1    2e-10   Vitis vinifera
sp|E6Y8S8.1|NLTP1_APIGR  RecName: Full=Non-specific lipid-transfe...  65.1    2e-10   Apium graveolens
sp|Q43871.1|NLTP8_HORVU  RecName: Full=Non-specific lipid-transfe...  64.7    2e-10   Hordeum vulgare [barley]
ref|XP_004978532.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    2e-10   Setaria italica
gb|ABA33854.1|  phospholipid transfer protein 1                       65.1    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CCJ09772.1|  putative non-specific lipid transfer protein         63.9    2e-10   Hirudo medicinalis
gb|ADR66946.1|  non-specific lipid transfer protein                   64.7    2e-10   Prunus armeniaca
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  64.7    2e-10   Lens culinaris
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    2e-10   Eucalyptus grandis [rose gum]
gb|ADR66953.1|  non-specific lipid transfer protein                   64.7    2e-10   Prunus dulcis [sweet almond]
gb|ACQ42221.1|  lipid transfer protein                                64.7    2e-10   Chimonanthus praecox [wintersweet]
emb|CAA65680.1|  lipid transfer protein 7a2b                          64.7    2e-10   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ91878.1|  predicted protein                                    64.7    2e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    2e-10   Prunus mume [ume]
gb|ABA33856.1|  phospholipid transfer protein 1                       64.7    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACM78613.1|  lipid transfer protein 1                              64.7    2e-10   Tamarix hispida
gb|ABA34083.1|  phospholipid transfer protein 2                       64.7    2e-10   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003605269.1|  Non-specific lipid-transfer protein              65.5    2e-10   
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    3e-10   Camelina sativa [gold-of-pleasure]
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        64.7    3e-10   Vitis cinerea var. helleri x Vitis vinifera
pir||JH0379  phospholipid transfer protein 6B6 - maize (fragment)     63.9    3e-10
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    3e-10   Camelina sativa [gold-of-pleasure]
gb|AFD32275.1|  stigma/style cysteine-rich adhesin                    64.3    3e-10   Lilium hybrid cultivar
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   Elaeis guineensis
sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  64.3    3e-10   Lens culinaris
ref|XP_007134675.1|  hypothetical protein PHAVU_010G066500g           64.3    3e-10   Phaseolus vulgaris [French bean]
ref|XP_004978531.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   Setaria italica
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    3e-10   Phoenix dactylifera
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  64.3    3e-10   Prunus dulcis [sweet almond]
gb|ADR66949.1|  non-specific lipid transfer protein                   64.3    4e-10   Prunus sargentii
gb|AAT68265.1|  lipid transfer protein precursor                      63.9    4e-10   Nicotiana glauca [glaucous tobacco]
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    4e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006387199.1|  hypothetical protein POPTR_1545s00200g           62.4    4e-10   Populus trichocarpa [western balsam poplar]
gb|AAA03283.1|  CW18=non-specific lipid transfer protein              63.5    4e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            63.9    4e-10   Morus notabilis
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      63.9    4e-10   Nicotiana glauca [glaucous tobacco]
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    5e-10   Prunus mume [ume]
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  63.2    5e-10   Morus nigra
gb|AAQ74628.1|  lipid tranfer protein II                              63.9    5e-10   Vigna radiata [mung bean]
ref|XP_008779709.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    5e-10   Phoenix dactylifera
gb|KJB71535.1|  hypothetical protein B456_011G128300                  63.9    5e-10   Gossypium raimondii
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    6e-10   Pyrus x bretschneideri [bai li]
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    6e-10   Sesamum indicum [beniseed]
ref|NP_568905.1|  non-specific lipid-transfer protein 3               63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ96338.1|  lipid transfer protein                                63.5    6e-10   Vitis aestivalis
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    63.5    6e-10   Lilium hybrid cultivar
dbj|BAB09777.1|  lipid transfer protein-like                          63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ABA34096.1|  phospholipid transfer protein 2                       63.5    7e-10   Zea diploperennis [chapule]
gb|ABA34094.1|  phospholipid transfer protein 2                       63.2    7e-10   Zea diploperennis [chapule]
ref|XP_006573392.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    7e-10   Glycine max [soybeans]
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  63.2    8e-10   Cicer arietinum [garbanzo]
gb|ABA33859.1|  phospholipid transfer protein 1                       63.2    8e-10   Zea diploperennis [chapule]
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  63.2    8e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        63.2    8e-10   Sorghum bicolor [broomcorn]
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  63.2    9e-10   Sorghum bicolor [broomcorn]
gb|ACN31666.1|  unknown                                               62.4    9e-10   Zea mays [maize]
gb|AAS13435.1|  lipid-transfer protein                                63.2    9e-10   Nicotiana attenuata
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  62.4    9e-10   Prunus persica
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   63.2    9e-10   Glycine max [soybeans]
ref|NP_001275802.1|  lipid-transfer protein precursor                 63.2    9e-10   Citrus sinensis [Valencia orange]
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    9e-10   Oryza brachyantha
emb|CAH03799.1|  lipid transfer protein                               62.4    1e-09   Citrus sinensis [Valencia orange]
pir||EPRZ  phospholipid transfer protein homolog - rice               62.4    1e-09
gb|AEN70936.1|  lipid transfer protein                                63.2    1e-09   Gossypium gossypioides
gb|ACG43351.1|  nonspecific lipid-transfer protein 4 precursor        62.0    1e-09   Zea mays [maize]
gb|ADV02773.1|  lipid transfer protein 1b                             62.4    1e-09   Ipomoea batatas [batate]
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   Cicer arietinum [garbanzo]
gb|ACG36597.1|  nonspecific lipid-transfer protein 2 precursor        62.0    1e-09   Zea mays [maize]
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   Eucalyptus grandis [rose gum]
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  62.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   Eucalyptus grandis [rose gum]
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   62.8    1e-09   Lilium longiflorum [Easter lily]
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    1e-09   Phoenix dactylifera
ref|NP_001065583.1|  Os11g0115400                                     62.8    1e-09   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   62.8    1e-09   Citrus jambhiri [citronelle]
gb|AEV23220.1|  stigma/stylar cysteine-rich adhesin                   62.4    1e-09   Lilium longiflorum [Easter lily]
gb|AEC04836.1|  lipid transfer protein                                62.8    1e-09   Dimocarpus longan [longan]
gb|ADR66945.1|  non-specific lipid transfer protein                   62.8    1e-09   Prunus armeniaca
sp|Q03461.1|NLTP2_TOBAC  RecName: Full=Non-specific lipid-transfe...  62.4    1e-09   Nicotiana tabacum [American tobacco]
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-09   Tarenaya hassleriana [spider flower]
ref|NP_001065987.1|  Os12g0115100                                     62.4    1e-09   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           62.4    1e-09   Citrus clementina
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  62.0    1e-09   Prunus persica
emb|CAB96876.2|  pru p 1                                              62.0    1e-09   Prunus persica
gb|ACG40474.1|  nonspecific lipid-transfer protein 2 precursor        62.4    1e-09   Zea mays [maize]
ref|XP_003605349.1|  Non-specific lipid-transfer protein              62.4    1e-09   Medicago truncatula
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           62.4    1e-09   Phaseolus vulgaris [French bean]
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           62.4    1e-09   Arabidopsis lyrata subsp. lyrata
gb|ADR66950.1|  non-specific lipid transfer protein                   62.4    1e-09   Prunus sargentii
ref|WP_039311159.1|  hypothetical protein                             62.0    2e-09   Paenibacillus sp. IHB B 3415
gb|ACG25358.1|  nonspecific lipid-transfer protein 2 precursor        62.4    2e-09   Zea mays [maize]
ref|NP_001065984.1|  Os12g0114500                                     62.4    2e-09   
gb|ACG43443.1|  nonspecific lipid-transfer protein 4 precursor        62.0    2e-09   Zea mays [maize]
gb|ABA96281.1|  Nonspecific lipid-transfer protein 5 precursor, p...  62.0    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAF23459.1|AF208833_1  non-specific lipid transfer protein pre...  62.4    2e-09   Capsicum annuum
emb|CAA69949.1|  lipid transfer protein                               62.4    2e-09   Oryza sativa [red rice]
gb|ABX56711.1|  LTP isoallergen 1 precursor                           62.4    2e-09   Arachis hypogaea [goober]
gb|AEN70918.1|  lipid transfer protein                                60.8    2e-09   Gossypium turneri
gb|AGH32497.1|  non-specific lipid transfer protein                   62.0    2e-09   Papaver somniferum
ref|XP_004978536.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-09   Setaria italica
gb|AFD32277.1|  stigma/style cysteine-rich adhesin                    62.0    2e-09   Lilium hybrid cultivar
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-09   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              62.0    2e-09   
gb|AGH27866.1|  lipid transfer protein precursor                      62.0    2e-09   
ref|NP_001148362.1|  LOC100281973 precursor                           62.4    2e-09   
ref|XP_009757912.1|  PREDICTED: uncharacterized protein LOC104210662  63.9    2e-09   
gb|AAQ74627.1|  lipid transfer protein I                              62.0    2e-09   
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            62.0    2e-09   
ref|XP_004977378.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-09   
gb|AFR43276.1|  lipid transfer protein precursor                      62.0    2e-09   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  62.0    2e-09   
gb|AFR43295.1|  lipid transfer protein precursor                      62.0    2e-09   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  62.0    2e-09   
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-09   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    62.0    2e-09   
gb|AFR43294.1|  lipid transfer protein precursor                      62.0    2e-09   
ref|XP_010035998.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-09   
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  62.0    2e-09   
ref|XP_003605345.1|  Non-specific lipid-transfer protein              62.0    2e-09   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           62.0    2e-09   
gb|ADB12473.1|  lipid transfer protein                                61.2    2e-09   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            62.0    2e-09   
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   62.0    2e-09   
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       61.6    2e-09   
ref|XP_008778766.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    2e-09   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           62.0    2e-09   
gb|AEN70915.1|  lipid transfer protein                                61.2    2e-09   
gb|AAA86694.1|  phospholipid transfer protein precursor               61.6    3e-09   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           62.0    3e-09   
gb|ADR66942.1|  non-specific lipid transfer protein                   61.6    3e-09   
gb|AFD32276.1|  stigma/style cysteine-rich adhesin                    61.6    3e-09   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  61.6    3e-09   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  61.6    3e-09   
gb|KHL91133.1|  hypothetical protein QW71_36410                       61.6    3e-09   
sp|P83434.1|NLTP1_VIGRR  RecName: Full=Non-specific lipid-transfe...  61.2    3e-09   
ref|XP_006664278.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|XP_004137680.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|XP_002442773.1|  hypothetical protein SORBIDRAFT_08g002660        61.6    3e-09   
gb|ABX75045.1|  LTP isoallergen 2                                     61.2    3e-09   
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   
ref|XP_002864627.1|  predicted protein                                61.6    3e-09   
gb|AGV40202.1|  nonspecific lipid-transfer protein 1                  61.6    3e-09   
gb|KHG30577.1|  Non-specific lipid-transfer                           61.2    3e-09   
gb|ABB90546.1|  lipid transfer protein                                61.2    3e-09   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  60.8    3e-09   
gb|ADR66943.1|  non-specific lipid transfer protein                   61.2    3e-09   
gb|AFD32278.1|  stigma/style cysteine-rich adhesin                    61.2    3e-09   
gb|ADY68820.1|  lipid transfer protein 3                              61.2    3e-09   
gb|KHG21711.1|  Non-specific lipid-transfer                           61.6    3e-09   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  61.2    3e-09   
sp|Q9SW93.1|SCA_LILLO  RecName: Full=Stigma/stylar cysteine-rich ...  61.2    4e-09   
gb|ABA33867.1|  phospholipid transfer protein 1                       61.2    4e-09   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    4e-09   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  61.2    4e-09   
gb|AFK47623.1|  unknown                                               60.8    4e-09   
gb|AFD32272.1|  stigma/style cysteine-rich adhesin                    61.2    4e-09   
gb|AAY43801.1|  FSLTP3                                                60.8    4e-09   
emb|CBW38501.1|  lipid transfer protein                               60.8    4e-09   
gb|AGH13363.1|  lipid transfer protein                                60.8    4e-09   
gb|AGC08426.1|  lipid transfer protein                                61.2    4e-09   
gb|ACP30545.1|  lipid transfer protein precursor                      61.2    4e-09   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  61.2    4e-09   
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    4e-09   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    4e-09   
gb|AGV40203.1|  nonspecific lipid-transfer protein 2                  61.2    4e-09   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    60.8    4e-09   
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  61.2    4e-09   
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    4e-09   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    5e-09   
dbj|BAI94498.1|  lipid transfer protein                               60.8    5e-09   
emb|CBW38502.1|  lipid transfer protein                               60.5    5e-09   
emb|CBW38498.1|  lipid transfer protein                               60.5    5e-09   
gb|AEN70933.1|  lipid transfer protein                                60.8    6e-09   
ref|NP_001274465.1|  non-specific lipid-transfer protein 3-like p...  60.8    6e-09   
gb|AGW21344.1|  lipid transfer protein                                60.8    6e-09   
gb|ACZ06858.1|  lipid transfer protein                                60.8    6e-09   
gb|AEN70919.1|  lipid transfer protein                                60.8    6e-09   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  60.8    6e-09   
gb|AHG99490.1|  lipid-transfer protein                                60.5    6e-09   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            60.5    6e-09   
gb|AFK46170.1|  unknown                                               60.5    7e-09   
gb|ABU49730.1|  putative non-specific lipid transfer protein b1       60.5    7e-09   
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  60.5    7e-09   
gb|AAY43800.1|  FSLTP2                                                60.1    7e-09   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  60.5    7e-09   
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             60.5    7e-09   
pir||S33460  lipid transfer protein - sorghum (fragment)              60.1    7e-09
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    7e-09   
gb|AEG79730.2|  lipid transfer protein precursor                      60.5    7e-09   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            60.5    7e-09   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        60.5    7e-09   
gb|AGH27863.1|  lipid transfer protein precursor                      60.5    8e-09   
gb|KJB38056.1|  hypothetical protein B456_006G235000                  60.5    8e-09   
ref|XP_006403901.1|  hypothetical protein EUTSA_v10010826mg           60.5    8e-09   
ref|XP_003562719.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    8e-09   
gb|AEN70916.1|  lipid transfer protein                                60.5    8e-09   
gb|ACB05670.1|  putative non-specific lipid transfer protein          60.5    8e-09   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  60.5    8e-09   
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    8e-09   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  60.1    8e-09   
gb|AEN70917.1|  lipid transfer protein                                60.5    8e-09   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  60.5    8e-09   
gb|KHN44832.1|  Non-specific lipid-transfer protein 1                 60.8    9e-09   
gb|AGC08428.1|  lipid transfer protein                                60.5    9e-09   
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              60.1    9e-09   
gb|EAY79712.1|  hypothetical protein OsI_34860                        60.1    9e-09   
gb|AEI70830.1|  non-specific lipid-transfer protein                   60.1    9e-09   
gb|ACG24840.1|  nonspecific lipid-transfer protein 4 precursor        60.5    9e-09   
gb|ABO28527.1|  lipid transfer protein                                60.1    9e-09   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               60.1    9e-09   
ref|NP_001065580.1|  Os11g0114900                                     60.1    1e-08   
gb|AGW21333.1|  lipid transfer protein                                60.1    1e-08   
ref|XP_011091603.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
gb|AGH27864.1|  lipid transfer protein precursor                      60.1    1e-08   
gb|AEI70828.1|  non-specific lipid-transfer protein                   60.1    1e-08   
gb|AFX66972.1|  non-specific lipid transfer protein 2                 60.1    1e-08   
gb|ABY54820.1|  lipid transfer protein                                60.1    1e-08   
gb|AHB19226.1|  non specific lipid transfer protein 1B                60.1    1e-08   
gb|AAM22768.1|  lipid transfer protein                                59.3    1e-08   
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-08   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  60.1    1e-08   
emb|CAH04983.1|  type 1 non-specific lipid transfer protein precu...  60.1    1e-08   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  60.1    1e-08   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           60.1    1e-08   
gb|ABP01769.1|  lipid transfer protein 2                              59.7    1e-08   
gb|AAB70541.1|  lipid transfer protein LPT IV                         59.7    1e-08   
ref|XP_006355281.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    1e-08   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             59.7    1e-08   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    1e-08   
emb|CAH69194.1|  type 1 non specific lipid transfer protein precu...  59.7    1e-08   
gb|AAK01293.1|AF331710_1  lipid transfer protein                      58.9    1e-08   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               59.7    1e-08   
emb|CAQ86909.1|  lipid transfer protein                               59.7    1e-08   
ref|NP_001067782.1|  Os11g0427800                                     59.7    1e-08   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           58.5    1e-08   
emb|CDM80997.1|  unnamed protein product                              59.7    1e-08   
gb|KFK34403.1|  hypothetical protein AALP_AA5G140600                  59.7    1e-08   
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           59.7    1e-08   
gb|AEV23221.1|  stigma/stylar cysteine-rich adhesin                   59.7    1e-08   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       59.7    1e-08   
gb|AAX20049.1|  putative non-specific lipid transfer protein          59.7    1e-08   
ref|XP_009626829.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    1e-08   
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    1e-08   
gb|AHB19227.1|  non specific lipid transfer protein 1A                59.7    1e-08   
ref|NP_001233953.1|  non-specific lipid-transfer protein 2 precursor  59.3    2e-08   
gb|ACQ42222.1|  lipid transfer protein 1                              59.3    2e-08   
ref|XP_006292059.1|  hypothetical protein CARUB_v10018254mg           59.7    2e-08   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  59.3    2e-08   
ref|XP_006355280.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
gb|KFK26696.1|  hypothetical protein AALP_AA8G281300                  59.3    2e-08   
emb|CDM80963.1|  unnamed protein product                              59.3    2e-08   
gb|KJB71510.1|  hypothetical protein B456_011G128200                  59.3    2e-08   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  59.3    2e-08   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               58.5    2e-08   
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg              59.3    2e-08   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           60.1    2e-08   
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
ref|XP_004137679.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    2e-08   
gb|KJB71509.1|  hypothetical protein B456_011G128200                  59.3    2e-08   
gb|AFR43288.1|  lipid transfer protein precursor                      59.3    2e-08   
ref|XP_003577848.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-08   
ref|XP_007033548.1|  Non-specific lipid-transfer protein, putative    60.1    2e-08   
gb|AFR43289.1|  lipid transfer protein precursor                      59.3    2e-08   
ref|XP_006355279.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    2e-08   
gb|KJB71508.1|  hypothetical protein B456_011G128100                  59.3    2e-08   
emb|CBW38503.1|  lipid transfer protein                               58.9    2e-08   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    2e-08   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    2e-08   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    2e-08   
gb|ADK36632.1|  lipid transfer-like protein                           58.5    2e-08   
emb|CAH04987.1|  type 1 non-specific lipid transfer protein precu...  58.9    2e-08   
gb|ABH03042.1|  non-specific lipid transfer protein                   58.9    2e-08   
gb|AAB32996.1|  basic protein 1B, WBP1B=lipid transfer protein ho...  58.5    3e-08   
emb|CBW38504.1|  lipid transfer protein                               58.5    3e-08   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  58.9    3e-08   
emb|CBW38499.1|  lipid transfer protein                               58.5    3e-08   
emb|CBW38497.1|  lipid transfer protein                               58.5    3e-08   
gb|AAB32995.1|  basic protein 1A, WBP1A=lipid transfer protein ho...  58.5    3e-08   
ref|XP_006362358.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    3e-08   
ref|XP_004249042.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    3e-08   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           58.9    3e-08   
prf||2115353B  lipid transfer protein                                 58.5    3e-08
gb|ACN11576.1|  lipid transfer protein 3 precursor                    58.9    3e-08   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       58.5    3e-08   
gb|ADK98521.1|  phospholipid transfer protein 1                       58.9    3e-08   
sp|O24418.1|NLTP6_GOSHI  RecName: Full=Non-specific lipid-transfe...  58.5    3e-08   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           58.5    3e-08   
dbj|BAB09776.1|  lipid transfer protein-like                          57.8    3e-08   
ref|XP_004249048.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    3e-08   
gb|AFV30232.1|  lipid transfer protein                                58.5    3e-08   
ref|XP_002877812.1|  hypothetical protein ARALYDRAFT_485511           58.5    3e-08   
gb|AAX08122.1|  lipid transfer protein III                            58.5    3e-08   
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    4e-08   
ref|XP_010515586.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    4e-08   
gb|AEN70935.1|  lipid transfer protein                                58.5    4e-08   
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    4e-08   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    58.5    4e-08   
gb|KFK27462.1|  hypothetical protein AALP_AA8G386200                  55.5    4e-08   
gb|AGC08425.1|  lipid transfer protein                                58.5    4e-08   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           57.8    4e-08   
gb|EMT31304.1|  Non-specific lipid-transfer protein 3                 58.2    4e-08   
gb|ACP43542.1|  lipid transfer protein                                58.2    4e-08   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  57.4    4e-08   
ref|XP_010503854.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    4e-08   
prf||2115353A  lipid transfer protein                                 58.2    4e-08
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  58.2    4e-08   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
ref|XP_004506486.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
ref|XP_004514554.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
gb|AEI70826.1|  non-specific lipid-transfer protein                   58.2    5e-08   
gb|EMS50623.1|  Non-specific lipid-transfer protein                   58.2    5e-08   
emb|CDY60751.1|  BnaA05g34760D                                        58.2    5e-08   
gb|AAA70046.1|  lipid transfer protein precursor                      57.8    5e-08   
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
ref|XP_003516421.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    5e-08   



>gb|ABG27026.1| phosophlipid protein [Gymnadenia conopsea]
Length=121

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F YI G  PL   CC GV+ L AAA+TT DRQTAC CLK+L+G++SG NP LAAG PG+C
Sbjct  44   FSYITGKGPLPQQCCNGVQGLNAAARTTPDRQTACTCLKTLSGRISGLNPNLAAGLPGRC  103

Query  234  GVNVGYPISTSTDCPKIH  287
            GV++ YPIST+TDC ++H
Sbjct  104  GVSIPYPISTTTDCSRVH  121



>gb|ADB12472.1| lipid transfer protein, partial [Crocus sativus]
Length=91

 Score = 82.0 bits (201),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G   LT ACC GVK LAAAA TT DR+TAC+CLKS+AGK+SG NP LA G PGKCG 
Sbjct  16   YVRGQGALTGACCSGVKGLAAAAATTPDRRTACSCLKSMAGKISGLNPSLAKGLPGKCGA  75

Query  240  NVGYPISTSTDCPKI  284
            +V Y ISTSTDC K+
Sbjct  76   SVPYVISTSTDCTKV  90



>ref|XP_009396874.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y  G  PL+ ACC GVK L +AAKTTADR+TAC C+KS   +LSG   G  AG 
Sbjct  36   LSSCISYATGKGPLSTACCSGVKSLNSAAKTTADRKTACTCIKSTVSRLSGAQAGAIAGI  95

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV++GYPIS STDC K+
Sbjct  96   PGKCGVSIGYPISASTDCSKV  116



>gb|AAY83346.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y+K    + AACCKGV +L + AKTTADRQ  CNCLKS AG + G N  LAAG PGKC
Sbjct  40   FNYVKSGGAVPAACCKGVSNLNSMAKTTADRQQTCNCLKSAAGSIKGLNANLAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  100  GVNVPYKISTSTNCNNV  116



>gb|ABA96286.1| Nonspecific lipid-transfer protein 3 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY82041.1| hypothetical protein OsI_37228 [Oryza sativa Indica Group]
 gb|EAZ19437.1| hypothetical protein OsJ_34998 [Oryza sativa Japonica Group]
Length=118

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +   N G  AG PGKC
Sbjct  41   ISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNVG+PIS STDC K+ 
Sbjct  101  GVNVGFPISLSTDCNKVS  118



>emb|CAG28937.1| lipid transfer protein [Oryza sativa Japonica Group]
 gb|ABA91227.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ17211.1| hypothetical protein OsJ_32723 [Oryza sativa Japonica Group]
 dbj|BAG89260.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +   N G  AG PGKC
Sbjct  41   ISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNVG+PIS STDC K+ 
Sbjct  101  GVNVGFPISLSTDCNKVS  118



>ref|NP_001065585.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|ABA91223.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27430.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|EAZ17209.1| hypothetical protein OsJ_32721 [Oryza sativa Japonica Group]
 dbj|BAG87779.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93418.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87082.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+LAG +   N G AAG PGKC
Sbjct  41   ISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNVG+PIS STDC K+ 
Sbjct  101  GVNVGFPISLSTDCSKVS  118



>gb|EAY79716.1| hypothetical protein OsI_34868 [Oryza sativa Indica Group]
Length=118

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+LAG +   N G AAG PGKC
Sbjct  41   ISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNVG+PIS STDC K+ 
Sbjct  101  GVNVGFPISLSTDCSKVS  118



>ref|NP_001065988.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|ABA96285.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29007.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|EAY82036.1| hypothetical protein OsI_37222 [Oryza sativa Indica Group]
 gb|EAZ19436.1| hypothetical protein OsJ_34997 [Oryza sativa Japonica Group]
 dbj|BAG88412.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+LAG +   N G AAG PGKC
Sbjct  41   ISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLAGTIKSLNLGAAAGIPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNVG+PIS STDC K+ 
Sbjct  101  GVNVGFPISLSTDCSKVS  118



>ref|XP_011466421.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=116

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y+K    + AACC G++ L +AAKTTADR+  CNCLKS AG + G N  LAAG PGKC
Sbjct  39   FNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGSIKGLNANLAAGLPGKC  98

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNV Y ISTST+C  + 
Sbjct  99   GVNVPYKISTSTNCAAVK  116



>gb|AGN56423.1| non-specific lipid transfer protein 3 [Linum usitatissimum]
Length=103

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            YI+G  PLT ACC G+K L AAA +T DRQ AC CLKS A  + G N GLA G PGKCGV
Sbjct  30   YIRGMAPLTPACCGGIKSLNAAASSTVDRQAACRCLKSAASGVRGINYGLAGGLPGKCGV  89

Query  240  NVGYPISTSTDC  275
            NVG+PIS S +C
Sbjct  90   NVGFPISQSVNC  101



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=116

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y+K    + AACC G++ L +AAKTTADR+  CNCLKS AG + G N  LAAG PGKC
Sbjct  39   FNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGSIKGLNANLAAGLPGKC  98

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNV Y ISTST+C  + 
Sbjct  99   GVNVPYKISTSTNCNNVK  116



>gb|EAY79718.1| hypothetical protein OsI_34870 [Oryza sativa Indica Group]
Length=121

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +   N G  AG PGKC
Sbjct  41   ISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKC  100

Query  234  GVNVGYPISTSTDCPK  281
            GVNVG+PIS STDC K
Sbjct  101  GVNVGFPISLSTDCNK  116



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y+K    + AACC GV++L + AKTTADRQ  CNCLK+ AG + G NP LAAG PGKC
Sbjct  40   FNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y ISTST+C  + 
Sbjct  100  GVSVPYKISTSTNCATVK  117



>gb|AAT80663.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80664.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +SG NPG A   PGKC
Sbjct  38   FDYVRSDGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNAESLPGKC  97

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  98   GVNVPYKISTSTNCATV  114



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG    +AACC GVK L +AA TT DRQ ACNCLKS AG +SG NP +AAG PGKCGV
Sbjct  97   YLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKSAAGAISGLNPNIAAGLPGKCGV  156

Query  240  NVGYPISTSTDCPKI  284
            N+ Y ISTST+C  I
Sbjct  157  NIPYKISTSTNCATI  171



>ref|XP_003605309.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=545

 Score = 78.2 bits (191),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG    +AACC GVK L +AA TT DRQ ACNCLKS AG +SG NP +AAG PGKCGV
Sbjct  469  YLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKSAAGAISGLNPNIAAGLPGKCGV  528

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  I 
Sbjct  529  NIPYKISTSTNCATIR  544


 Score = 26.9 bits (58),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = +1

Query  4    AESAITCGTVASSLVSCF  57
            AE+AITCGTV  SL  C 
Sbjct  450  AEAAITCGTVTGSLAPCI  467


 Score = 65.9 bits (159),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +SG N   A+  PGKCGV
Sbjct  40   YLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGV  99

Query  240  NVGYPISTSTDCPKIH*NRLW  302
            N+ Y ISTST+C +     +W
Sbjct  100  NIPYKISTSTNCHQGMKMMMW  120


 Score = 23.9 bits (50),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +1

Query  4   AESAITCGTVASSLVSCF  57
           A++AI+CGTV S+L  C 
Sbjct  21  ADAAISCGTVTSALGPCI  38



>gb|AAT80652.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80660.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80661.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80662.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +SG NPG A   PGKC
Sbjct  38   FDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNAESLPGKC  97

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  98   GVNVPYKISTSTNCATV  114



>gb|AAT80650.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80651.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80653.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80654.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80655.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80656.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80657.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80658.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80659.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +SG NPG A   PGKC
Sbjct  38   FDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNAESLPGKC  97

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  98   GVNVPYKISTSTNCATV  114



>ref|NP_001065989.2| Os12g0115500 [Oryza sativa Japonica Group]
 dbj|BAF29008.2| Os12g0115500, partial [Oryza sativa Japonica Group]
Length=93

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +3

Query  63   IKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVN  242
            + G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +   N G  AG PGKCGVN
Sbjct  19   MAGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKCGVN  78

Query  243  VGYPISTSTDCPKI  284
            VG+PIS STDC K+
Sbjct  79   VGFPISLSTDCNKV  92



>ref|NP_001065586.1| Os11g0116200 [Oryza sativa Japonica Group]
 dbj|BAF27431.1| Os11g0116200 [Oryza sativa Japonica Group]
Length=132

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  33   GE*LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLA  212
            G  ++    Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSLAG +   N G  
Sbjct  34   GSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTV  93

Query  213  AGAPGKCGVNVGYPISTSTDC  275
            AG PGKCGVNVG+PIS STDC
Sbjct  94   AGVPGKCGVNVGFPISLSTDC  114



>gb|AAF71695.1|AF198168_1 phospholipid transfer protein [Hygrochilus japonicus]
Length=120

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              YI+G   L   CC GVK L A A T+ DRQ AC+CLK+LA  +   NP  AAG PG C
Sbjct  43   ISYIRGDSTLPQTCCSGVKKLNALASTSPDRQGACSCLKNLASHIPNLNPARAAGLPGNC  102

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V YPISTSTDC K+ 
Sbjct  103  GVSVPYPISTSTDCSKVR  120



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K    + AACC G++ L +AAKTTADRQT CNCLK  +G + G NP LAAG PGKC
Sbjct  40   VNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNV Y ISTST+C  + 
Sbjct  100  GVNVPYKISTSTNCAAVK  117



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K    + AACC GV+ L +AAKTTADRQT CNCLK  +G + G NP LAAG PGKC
Sbjct  40   VNYVKSGGAVPAACCNGVRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNV Y ISTST+C  + 
Sbjct  100  GVNVPYKISTSTNCAAVK  117



>gb|AAT80665.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +SG NPG     PGKC
Sbjct  38   FDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNVESLPGKC  97

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  98   GVNVPYKISTSTNCATV  114



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    + AACC G+K L +AA TTADRQ  CNCLKSLAGK+SG N GLAAG P KCGV
Sbjct  43   YLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            ++ Y IS STDC  + 
Sbjct  103  SISYKISPSTDCKSVK  118



>ref|XP_009384323.1| PREDICTED: non-specific lipid-transfer protein-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y +GT PLT  CC GV+ L  AA+TT DRQ  CNCLK  A  +SG  PGL AG P KCG+
Sbjct  42   YAQGTGPLTDGCCSGVRALNGAAQTTPDRQATCNCLKRSAAGVSGIQPGLIAGIPSKCGI  101

Query  240  NVGYPISTSTDCPKIH  287
            NV Y IS STDC ++ 
Sbjct  102  NVPYRISPSTDCSRVR  117



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y++    + AACC G+K L +AA TTADRQ  CNCLKSLAGK+SG N G+AAG 
Sbjct  37   LAQCITYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGL  96

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV++ Y IS STDC  + 
Sbjct  97   PSKCGVSISYKISPSTDCKSVK  118



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    + AACC G+K L +AA TT DRQ  CNCLKSLAGK+SG N GLAAG P KCGV
Sbjct  43   YLQKGGAVPAACCSGLKSLNSAAATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            ++ Y IS STDC  + 
Sbjct  103  SISYKISPSTDCKTVK  118



>emb|CAT99615.1| lipid transfer protein [Malus domestica]
Length=82

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +SG NPG A   PGKC
Sbjct  11   FDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNPGNAESLPGKC  70

Query  234  GVNVGYPISTST  269
            GVNV Y ISTST
Sbjct  71   GVNVPYKISTST  82



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K    + AACC G++ L +AAKTTADRQ  CNCLK  +G + G NP LAAG PGKC
Sbjct  40   VNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y ISTST+C  + 
Sbjct  100  GVSVPYKISTSTNCAAVK  117



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y+K   P+   CC G+K+L +AA+TTADRQTAC CLKSL+G + G N GLA+G 
Sbjct  38   LSPCLNYLKSGGPVPPGCCSGIKNLNSAAQTTADRQTACKCLKSLSGSIPGINYGLASGL  97

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV+V Y IS STDC K+
Sbjct  98   PGKCGVSVPYKISPSTDCSKV  118



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    + A CC G++ L + AKTT DR+TAC+CLKSLAG++   N GLAAG PGKCGV
Sbjct  43   YLQKGGAVPAGCCTGIRSLNSQAKTTVDRRTACSCLKSLAGRVR-VNQGLAAGLPGKCGV  101

Query  240  NVGYPISTSTDCPKIH  287
            NVGYPISTST+C  + 
Sbjct  102  NVGYPISTSTNCNSVQ  117



>ref|XP_008391369.1| PREDICTED: non-specific lipid-transfer protein [Malus domestica]
Length=113

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G  P+  ACC G++ + + A+TT DRQ  CNCLKSLA  +SG NPG A   PGKCGV
Sbjct  40   YLRGGGPVPPACCNGIRTINSLAETTPDRQAVCNCLKSLASSVSGVNPGNAESLPGKCGV  99

Query  240  NVGYPISTSTDC  275
            NV Y ISTST+C
Sbjct  100  NVPYKISTSTNC  111



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    + AACC G+K L +AA TTADRQ  CNCLKSLAGK+SG N G+AAG P KCGV
Sbjct  43   YLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            ++ Y IS STDC  + 
Sbjct  103  SISYKISPSTDCKSVK  118



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K    + AACC G+++L   AKTTADRQ ACNCLK  AG + G NP LAAG PGKC
Sbjct  40   LTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y IST+T+C  + 
Sbjct  100  GVSVPYKISTTTNCAAVK  117



>ref|XP_010035997.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW47517.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=118

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G+ PL++ACC GVK L  AA+TTADRQ AC CL+S AG + G +  LAAG PGKCGV
Sbjct  43   YLRGSGPLSSACCSGVKSLNTAARTTADRQAACRCLQSAAGSIQGIDFNLAAGLPGKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            +V Y IS +TDC  + 
Sbjct  103  SVPYKISPTTDCKSVK  118



>ref|XP_002442774.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
 gb|EES16612.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
Length=123

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +    GT P +AACC GV+ L +AA +TAD++TACNCLKS AG++SG N G AA  P 
Sbjct  45   LAYARGTGTAP-SAACCSGVRSLNSAASSTADKRTACNCLKSAAGRVSGLNAGNAASIPS  103

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGVN+ Y IS S DC +++
Sbjct  104  KCGVNIPYTISASIDCSRVN  123



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    +  ACC G++ + + A+TTADRQTACNCLK+LAG +SG NP  AAG PGKCGV
Sbjct  40   YVRNGGAVPPACCNGIRTINSLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV  99

Query  240  NVGYPISTSTDCPKI  284
            NV Y ISTST+C  +
Sbjct  100  NVPYKISTSTNCATV  114



>ref|XP_009346912.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +  ACC G+K + A AKTT DRQ ACNCLKSL+G +SG NPG A   PGKC
Sbjct  38   INYVRSGGAVPPACCNGIKTINALAKTTPDRQAACNCLKSLSGSISGVNPGNAESLPGKC  97

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  98   GVNVPYKISTSTNCATV  114



>gb|KCW47519.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=116

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G+ PL++ACC GVK L  AA+TTADRQ AC CL+S AG + G +  LAAG PGKCGV
Sbjct  43   YLRGSGPLSSACCSGVKSLNTAARTTADRQAACRCLQSAAGSIQGIDFNLAAGLPGKCGV  102

Query  240  NVGYPISTSTDC  275
            +V Y IS +TDC
Sbjct  103  SVPYKISPTTDC  114



>gb|AGN56422.1| non-specific lipid transfer protein 2, partial [Linum usitatissimum]
Length=116

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G  P+T ACC G++ L   AKTTADR+ AC CLK+ AG + G NP +AAG PGKC
Sbjct  39   LTYLTGRAPVTPACCNGMRGLLNMAKTTADRRLACTCLKTAAGNVPGLNPAIAAGLPGKC  98

Query  234  GVNVGYPISTSTDC  275
            GV + Y ISTST+C
Sbjct  99   GVKIPYKISTSTNC  112



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG NP  AAG PGKCGV
Sbjct  40   YVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV  99

Query  240  NVGYPISTSTDCPKI  284
            NV Y ISTST+C  +
Sbjct  100  NVPYKISTSTNCATV  114



>emb|CAB96874.1| mal d 3 [Malus domestica]
Length=91

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG NP  AAG PGKCGV
Sbjct  16   YVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV  75

Query  240  NVGYPISTSTDCPKIH  287
            NV Y ISTST+C  + 
Sbjct  76   NVPYKISTSTNCATVK  91



>gb|AGN56421.1| non-specific lipid transfer protein 1 [Linum usitatissimum]
Length=116

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G  P+T ACC G++ L   AKTTADR+ AC CLK+ AG + G NP +AAG PGKC
Sbjct  39   LTYLTGRAPVTPACCNGMRGLLNMAKTTADRRLACTCLKTAAGNVPGLNPAIAAGLPGKC  98

Query  234  GVNVGYPISTSTDC  275
            GV + Y ISTST+C
Sbjct  99   GVKIPYKISTSTNC  112



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG NP  AAG PGKCGV
Sbjct  40   YVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV  99

Query  240  NVGYPISTSTDCPKI  284
            NV Y ISTST+C  +
Sbjct  100  NVPYKISTSTNCATV  114



>gb|AET05730.1| lipid transfer protein isoform a, partial [Pyrus communis]
Length=94

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y++    +  ACC G+K +   A TT DRQ ACNCLK+LAG +SG NPG A   
Sbjct  13   LAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSVSGVNPGNAESL  72

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGVNV Y ISTST+C  +
Sbjct  73   PGKCGVNVPYKISTSTNCATV  93



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG NP  AAG PGKCGV
Sbjct  40   YVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV  99

Query  240  NVGYPISTSTDCPKI  284
            NV Y ISTST+C  +
Sbjct  100  NVPYKISTSTNCATV  114



>gb|AET05731.1| lipid transfer protein isoform b, partial [Pyrus communis]
Length=94

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y++    +  ACC G+K +   AKTT DRQ ACNCLK+LAG +SG NPG A   
Sbjct  13   LAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESL  72

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGVNV Y ISTST+C  +
Sbjct  73   PGKCGVNVPYKISTSTNCATV  93



>dbj|BAI94496.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+KG    +A CC G+K L   A+T  DR+TAC CLKS A  +SG N GLA+G PGKC
Sbjct  42   ITYLKGAPGPSALCCAGIKRLNGMAQTPPDRKTACGCLKSAAAAISGLNYGLASGLPGKC  101

Query  234  GVNVGYPISTSTDCPKIH  287
            GV++ YPIS STDC K++
Sbjct  102  GVSIPYPISPSTDCSKVN  119



>sp|Q9M5X6.1|NLTP_PYRCO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pyr c 3; Flags: Precursor [Pyrus communis]
 gb|AAF26451.1| lipid transfer protein precursor [Pyrus communis]
Length=115

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +  ACC G+K +   AKTT DRQ ACNCLK+LAG +SG NPG A   PGKC
Sbjct  38   INYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKC  97

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  98   GVNVPYKISTSTNCATV  114



>gb|ACI47547.1| nonspecific lipid transfer protein [Juglans regia]
Length=119

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +3

Query  60   YIKGTEP-LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCG  236
            Y++GT P +  +CC GVK L  AA TTADRQ AC CLK  +G + G NPGLAAG PGKCG
Sbjct  43   YLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIPGLNPGLAAGLPGKCG  102

Query  237  VNVGYPISTSTDCPKIH  287
            V+V Y ISTST+C  + 
Sbjct  103  VSVPYKISTSTNCKAVK  119



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    + A+CC GV+ LA +AKTTADR+T CNCLKS A ++SG  P LAAG P KC
Sbjct  41   ISYVRSGGSIPASCCSGVRSLAGSAKTTADRRTVCNCLKSTAARISGIKPALAAGLPSKC  100

Query  234  GVNVGYPISTSTDCPKI  284
            GV + + IS STDC K+
Sbjct  101  GVRIPFTISPSTDCSKV  117



>emb|CAA80809.1| lipid transfer protein [Oryza sativa Indica Group]
Length=117

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G  P +AACC GV+ L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  37   VSPCLSYARGLRP-SAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASI  95

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV++ Y IS S DC +++
Sbjct  96   PSKCGVSIPYTISPSIDCSRVN  117



>ref|XP_006663744.1| PREDICTED: probable non-specific lipid-transfer protein 3-like 
[Oryza brachyantha]
Length=116

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +3

Query  60   YIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCG  236
            Y+ G +  L+  CC GVK L +AA++TADRQ AC CLKSL G +   N G AAG P KCG
Sbjct  40   YVTGRSSALSQGCCNGVKGLNSAARSTADRQAACRCLKSLVGTVKSLNLGTAAGIPAKCG  99

Query  237  VNVGYPISTSTDCPKIH  287
            VNVG+PI  STDC K+ 
Sbjct  100  VNVGFPIRLSTDCNKVR  116



>ref|XP_009372013.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y KG   +  ACC G++ +   A+TTADRQ ACNCLK+LAG + G NP  AA  PGKC
Sbjct  38   INYAKGGGVVPPACCNGIRTINGIARTTADRQAACNCLKNLAGSIRGVNPNNAAALPGKC  97

Query  234  GVNVGYPISTSTDCPKI  284
            GVNV Y ISTST+C  +
Sbjct  98   GVNVPYKISTSTNCATV  114



>sp|P80273.2|NLTP3_VITSX RecName: Full=Non-specific lipid-transfer protein P3; Short=LTP 
P3 [Vitis sp.]
Length=91

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++G  PL AACC GVK+L  +A TT DR+TAC CL S +  +SG N GLAAG P KC
Sbjct  14   INYLRGAGPLPAACCNGVKNLKNSATTTQDRRTACKCLISASKTISGVNFGLAAGLPAKC  73

Query  234  GVNVGYPISTSTDCPKIH  287
            GV++ Y IS ST+C +++
Sbjct  74   GVSIPYKISPSTNCDQVN  91



>ref|XP_003579021.1| PREDICTED: probable non-specific lipid-transfer protein 3 [Brachypodium 
distachyon]
Length=123

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  60   YIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCG  236
            Y+ G    ++  CC G++ L   A+TTADRQ AC CLKS+AG +   N G  AG PGKCG
Sbjct  47   YVTGKAAAVSPGCCSGIRGLNNMARTTADRQAACRCLKSMAGSIKALNMGKVAGVPGKCG  106

Query  237  VNVGYPISTSTDCPKI  284
            VNVG+PIS STDC K+
Sbjct  107  VNVGFPISMSTDCNKV  122



>gb|ADV02772.1| lipid transfer protein 1a [Ipomoea batatas]
Length=120

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query  42   LSLLFQYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAA  215
            LS    Y++G  T    AACC  +K + + A TT DRQ AC CLK +AG  S  N G+ +
Sbjct  37   LSSCLSYVQGKVTGGPPAACCGAIKSINSVATTTPDRQAACKCLKQMAGSYSSVNMGVVS  96

Query  216  GAPGKCGVNVGYPISTSTDCPKIH  287
              P KCGVN+GYPISTS DC K+H
Sbjct  97   SLPSKCGVNIGYPISTSVDCAKVH  120



>dbj|BAI94497.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y+KG    + ACC G+K L   A+T  DR+TAC CLKS A  +SG N GLA   
Sbjct  38   LASCISYLKGAPGPSGACCGGIKRLNGMAQTPPDRKTACGCLKSAAAAISGINYGLANAL  97

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            PGKCGV++ YPIS +TDC ++H
Sbjct  98   PGKCGVSIPYPISPNTDCSRVH  119



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y+KG   +  ACC G++++   A+TTADR+ ACNCLK L+G + G NP  AA  
Sbjct  10   LAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAAL  69

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            PGKCGVNV Y IS ST+C  + 
Sbjct  70   PGKCGVNVPYKISASTNCATVK  91



>sp|Q43766.1|NLTP3_HORVU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; AltName: Full=CW-19; AltName: Full=CW-20; Short=CW20; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA48623.1| Cw-19 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
Length=118

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  90   ACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTST  269
            ACC GVK LA AA++TAD+Q AC CLKSLA  + G N G  +G PGKCGV+V +PIS ST
Sbjct  53   ACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMST  112

Query  270  DCPKIH  287
            DC K+H
Sbjct  113  DCNKVH  118



>ref|XP_009132019.1| PREDICTED: non-specific lipid-transfer protein 3-like [Brassica 
rapa]
 emb|CDX88678.1| BnaA03g09710D [Brassica napus]
Length=125

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y+ G   LTAACC GV+DL A A+TT DRQ  C CL+++A K+ GFN   A+  
Sbjct  33   MSPCITYLSGRMDLTAACCGGVRDLNAIAQTTPDRQQTCKCLQAVAKKIPGFNQTRASDL  92

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            PGKC V+  +PIS ST+C  +H
Sbjct  93   PGKCRVSFPFPISISTNCDNVH  114



>sp|P85105.1|NLTP5_VITSX RecName: Full=Non-specific lipid-transfer protein P5; Short=LTP 
P5 [Vitis sp.]
Length=91

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG N GLAAG PGKC
Sbjct  14   INYLRSAGPLPVACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKC  73

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS ST+C +++
Sbjct  74   GVNIPYKISPSTNCDQVN  91



>dbj|BAK05751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   K + P +A CC GV+ L   A T ADRQ AC CLK+LAG   G + G AAG PG
Sbjct  39   MSYATGKASAP-SAGCCSGVRSLNGKASTAADRQAACRCLKNLAGSFKGISMGNAAGIPG  97

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV+V +PISTS DC K+H
Sbjct  98   KCGVSVSFPISTSVDCNKLH  117



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    L  ACC G+K L +AAKTT DRQ  CNCLKSLAGK+SG N GLAAG P KCGV
Sbjct  43   YLQKGGALPPACCSGLKSLNSAAKTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            ++ Y IS +TDC  + 
Sbjct  103  SIPYKISPATDCKTVK  118



>gb|AER92599.1| putative lipid transfer protein [Linum usitatissimum]
Length=119

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G   +T  CC G+K L   A+TTADR+ ACNCLKS A KL G NP LAAG PGKC
Sbjct  44   VSYLTGRGAVTPGCCNGMKGLLVEARTTADRRQACNCLKSAASKLPGLNPALAAGLPGKC  103

Query  234  GVNVGYPISTSTDC  275
            GV + Y IS ST+C
Sbjct  104  GVKIPYKISISTNC  117



>gb|AAY83344.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K    + A CC G++ L +AAKTTADRQT CNCLK  +G + G NP LAAG PGK 
Sbjct  40   VNYVKSGGAVPAGCCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKX  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNV Y ISTST+C  + 
Sbjct  100  GVNVPYKISTSTNCAAVK  117



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y +G    ++ACC GV+ L++AA TTADR+TACNCLK+ AG +SG N G AA  P KC
Sbjct  40   LSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSISGLNAGNAASIPSKC  99

Query  234  GVNVGYPISTSTDCPKI  284
            GV++ Y ISTS DC ++
Sbjct  100  GVSIPYTISTSIDCSRV  116



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K    + A CC G+++L   AKTTADRQ  CNCLK  AG + G NP LAAG PGKC
Sbjct  40   VTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y IST+T+C  + 
Sbjct  100  GVSVPYKISTTTNCAAVK  117



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y +G    ++ACC GV+ L++AA TTADR+TACNCLK+ AG +SG N G AA  P KC
Sbjct  40   LSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSISGLNAGNAASIPSKC  99

Query  234  GVNVGYPISTSTDCPKI  284
            GV++ Y ISTS DC ++
Sbjct  100  GVSIPYTISTSIDCSRV  116



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +  +CC G++ L  AAKTTADR+TACNCLKS AG++ G  PGLAAG PGKC
Sbjct  41   INYVRSGGVVPPSCCGGIRGLVGAAKTTADRRTACNCLKSAAGRIPGLKPGLAAGLPGKC  100

Query  234  GVNVGYPISTSTDC  275
            GV+V +PISTS +C
Sbjct  101  GVSVPFPISTSVNC  114



>emb|CBI18043.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG N GLAAG PGKC
Sbjct  62   INYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKC  121

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS ST+C +++
Sbjct  122  GVNIPYKISPSTNCDQVN  139



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 67.0 bits (162),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K   P+  ACC G+K L AAAKTTADRQ ACNCLK+ +  ++G N   A+  PGKC
Sbjct  43   LNYLKKGGPVPPACCNGIKSLNAAAKTTADRQAACNCLKTASTSIAGINLSYASSLPGKC  102

Query  234  GVNVGYPISTSTDCPKIH  287
            GVNV Y IS STDC K+ 
Sbjct  103  GVNVPYKISPSTDCSKVQ  120


 Score = 29.6 bits (65),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  1   NAESAITCGTVASSLVSCFN  60
           +AE+AITCGTV  SL  C N
Sbjct  25  HAEAAITCGTVTVSLAPCLN  44



>gb|AAP92127.1| lipid transfer protein LPT1 [Oryza sativa]
Length=118

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y +G  P +AACC GV+ L +AA TTADR+TACNCLK++AG +SG N G AA  P KC
Sbjct  41   LSYARGLRP-SAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKC  99

Query  234  GVNVGYPISTSTDCPK  281
            GV++ Y IS S DC +
Sbjct  100  GVSIPYTISPSIDCSR  115



>ref|XP_009396871.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=116

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y  G   LT+ CC GVK L +AAKT+ADR+TAC C+KSL  + S  N G+ +G 
Sbjct  35   LSPCIPYATGKGSLTSGCCNGVKSLNSAAKTSADRKTACTCIKSLVSRFSSANTGVVSGI  94

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            PGKCGV++ Y IS STDC K++
Sbjct  95   PGKCGVSIPYTISPSTDCSKVN  116



>ref|XP_002270970.1| PREDICTED: non-specific lipid-transfer protein P5 [Vitis vinifera]
Length=118

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG N GLAAG PGKC
Sbjct  41   INYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS ST+C +++
Sbjct  101  GVNIPYKISPSTNCDQVN  118



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +SG NP  AA  PGKCGV
Sbjct  16   YVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGV  75

Query  240  NVGYPISTSTDCPKI  284
            N+ Y IS ST+C  +
Sbjct  76   NIPYKISASTNCATV  90



>ref|XP_009398877.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y +G   LT +CC GV+ L  AAKTT DRQTAC+CLKS    L G   G  AG PGKCGV
Sbjct  42   YARGQGLLTKSCCSGVRSLNDAAKTTPDRQTACSCLKSTVAGLKGIQSGTVAGIPGKCGV  101

Query  240  NVGYPISTSTDCPKIH  287
            +V YPISTS DC K+ 
Sbjct  102  SVPYPISTSVDCSKVK  117



>gb|ACG30522.1| nonspecific lipid-transfer protein 1 precursor [Zea mays]
Length=121

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  LSG N G AA  P K
Sbjct  43   LSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGLSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>gb|ACJ62320.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62321.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62322.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62327.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62334.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62336.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62359.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62360.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62386.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  29   VSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASI  88

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV++ Y IS S DC  ++
Sbjct  89   PSKCGVSIPYTISPSIDCSSVN  110



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  37   VSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASI  96

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV++ Y IS S DC  ++
Sbjct  97   PSKCGVSIPYTISPSIDCSSVN  118



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  36   VSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASI  95

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV++ Y IS S DC  ++
Sbjct  96   PSKCGVSIPYTISPSIDCSSVN  117



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y++    + A CC G++ L +AA TT DRQT CNC+KS AG +SG N  LAA  
Sbjct  37   LSPCLDYVRMGGAIPAMCCNGIRSLFSAASTTQDRQTVCNCMKSAAGAISGVNLNLAAAL  96

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGVN+ Y IS S DC K+ 
Sbjct  97   PNKCGVNIPYKISPSIDCAKVQ  118



>dbj|BAC77694.1| lipid transfer protein [Atriplex nummularia]
Length=117

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G    T ACC GVK L + A T ADR+ AC CLKS AG ++  N G AA  PGKC
Sbjct  40   MSYLTGGGSPTPACCGGVKSLNSMASTPADRKAACGCLKSAAGAMTNLNMGNAASLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            G+++ YPISTSTDC K++
Sbjct  100  GISLPYPISTSTDCSKVN  117



>gb|ABA34098.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34102.1| phospholipid transfer protein 2, partial [Zea diploperennis]
Length=116

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +3

Query  54   FQYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT P  +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  40   LSYARGTGPAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  99

Query  231  CGVNVGYPISTSTDCPK  281
            CGV++ Y ISTSTDC +
Sbjct  100  CGVSIPYTISTSTDCSR  116



>gb|ACJ62323.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62356.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>gb|ACJ62315.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62317.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62335.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62338.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62340.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62341.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62343.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62351.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62358.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62362.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62363.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62365.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62366.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62367.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62368.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62369.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62371.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62372.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62373.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62374.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62376.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +SG NP  AA  PGKCGV
Sbjct  42   YVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGV  101

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y IS ST+C  + 
Sbjct  102  NIPYKISASTNCATVK  117



>gb|AFK38461.1| unknown [Lotus japonicus]
Length=115

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            YI+G    +  CC GV+ + +AA +TADR+ ACNCLKS AG  S FN G AA  PGKCGV
Sbjct  40   YIQGGAGPSPPCCAGVRRVNSAASSTADRRAACNCLKSAAGSFSRFNAGNAASLPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  I 
Sbjct  100  NIPYKISTSTNCANIK  115



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  37   VSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASI  96

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV + Y IS S DC  ++
Sbjct  97   PSKCGVTIPYTISPSIDCSSVN  118



>gb|ACJ62316.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62332.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62333.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62337.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62380.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62382.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62383.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62384.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62385.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  38   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  97

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  98   CGVSIPYTISTSTDCSRVN  116



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    +AACC GV++L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  37   VSPCLSYPRGGSGPSAACCSGVRNLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASI  96

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV++ Y IS S DC  ++
Sbjct  97   PSKCGVSIPYTISPSIDCSSVN  118



>gb|AHB19225.1| non specific lipid transfer protein 1C [Punica granatum]
Length=120

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +3

Query  54   FQYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
             QY +G    P+  ACC G++ L +AAKTT DRQ AC CLKSLA  +SG N GL AGAPG
Sbjct  41   IQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG  100

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y I+ ST+C  + 
Sbjct  101  KCGVSIPYKIAPSTNCDNVK  120



>gb|ACJ62355.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=109

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  31   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  90

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  91   CGVSIPYTISTSTDCSRVN  109



>gb|ACJ62319.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62329.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62330.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62331.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  38   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  97

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  98   CGVSIPYTISTSTDCSRVN  116



>gb|ACJ62318.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62324.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62325.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62328.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62345.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62346.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62347.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62348.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62349.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62350.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62352.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62353.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62354.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62357.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62364.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62370.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62375.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62377.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62378.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62379.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  38   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  97

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  98   CGVSIPYTISTSTDCSRVN  116



>emb|CAT99613.1| lipid transfer protein [Malus domestica]
Length=82

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG NP  AAG PGKCGV
Sbjct  13   YVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV  72

Query  240  NVGYPISTST  269
            NV Y ISTST
Sbjct  73   NVPYKISTST  82



>gb|ACJ62339.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +SG NP  AA  PGKCGV
Sbjct  42   YVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGV  101

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y IS ST+C  + 
Sbjct  102  NIPYKISISTNCAAVK  117



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+ G  PL   CC GVK L  AA+TT DRQ  CNCLK+LA   SG N G AAG PGKC
Sbjct  39   LPYVTGKGPL-GGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKC  97

Query  234  GVNVGYPISTSTDCPKIH  287
            GV++ Y IS +TDC K+H
Sbjct  98   GVSIPYQISPNTDCSKVH  115



>gb|ACJ62326.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV+ L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRSLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>gb|ACL01093.1| lipid transfer protein [Castanea mollissima]
Length=118

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++     T ACC GVK L  AAKTTADRQ AC CLK+ AG +SG +P  AA  PGKCGV
Sbjct  43   YLRSGGSPTQACCNGVKSLNNAAKTTADRQAACECLKTAAGSISGLSPANAASLPGKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            NV Y ISTST+C  + 
Sbjct  103  NVPYKISTSTNCKNVK  118



>ref|NP_001150972.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
 gb|ACG41114.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
Length=122

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  81   LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPIS  260
            L A+CC GVK L +AA+T+ADRQ AC CLKSLA  +   N G  A  PGKCGV+VG+PIS
Sbjct  54   LPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVKSVNMGTVATIPGKCGVSVGFPIS  113

Query  261  TSTDCPKIH  287
             STDC KI 
Sbjct  114  MSTDCNKIS  122



>gb|ADK60918.1| lipid transfer protein [Castanea sativa]
Length=118

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++     T ACC GVK L  AAKTTADRQ AC CLK+ AG +SG +P  AA  PGKCGV
Sbjct  43   YLRSGGSPTQACCNGVKSLNNAAKTTADRQAACECLKTAAGSISGLSPANAASLPGKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            NV Y ISTST+C  + 
Sbjct  103  NVPYKISTSTNCKNVK  118



>ref|NP_001142300.1| uncharacterized protein LOC100274469 precursor [Zea mays]
 gb|ACF79347.1| unknown [Zea mays]
 gb|ACF86436.1| unknown [Zea mays]
 gb|ACF88133.1| unknown [Zea mays]
 gb|ACR36788.1| unknown [Zea mays]
 tpg|DAA59276.1| TPA: non-specific lipid-transfer protein [Zea mays]
Length=123

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  81   LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPIS  260
            L A+CC GVK L +AA+T+ADRQ AC CLKSLA  +   N G  A  PGKCGV+VG+PIS
Sbjct  55   LPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVKSVNMGTVATIPGKCGVSVGFPIS  114

Query  261  TSTDCPKIH  287
             STDC KI 
Sbjct  115  MSTDCNKIS  123



>gb|AET05733.1| lipid transfer protein isoform d, partial [Pyrus communis]
Length=94

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+K    +  ACC G++ +   A+TTADRQT CNCLKSLAG + G NP  AA  PGKCGV
Sbjct  19   YVKNGGVVPPACCNGIRTVNGLARTTADRQTTCNCLKSLAGSIKGVNPNNAATLPGKCGV  78

Query  240  NVGYPISTSTDCPKI  284
            NV + ISTST+C  +
Sbjct  79   NVPFKISTSTNCATV  93



>ref|NP_001105392.1| phospholipid transfer protein precursor [Zea mays]
 gb|AAB06443.1| phospholipid transfer protein [Zea mays]
 gb|ACF86016.1| unknown [Zea mays]
 gb|ACJ62344.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 tpg|DAA59231.1| TPA: phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>pdb|1T12|A Chain A, Solution Structure Of A New Ltp1
Length=91

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++ T PL   CC GVK L  +A+TT DRQ AC CLKS AG +SG N G AAG P  C
Sbjct  15   LAYLRNTGPL-GRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTC  73

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS STDC K+ 
Sbjct  74   GVNIPYKISPSTDCSKVQ  91



>ref|XP_002442776.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
 gb|EES16614.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
Length=119

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +   +G+ P +A CC GV+ L +AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  41   LSYARGQGSAP-SAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPS  99

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV+V Y ISTSTDC +++
Sbjct  100  KCGVSVPYTISTSTDCSRVN  119



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G    +A CC GV++L +AA TT DRQ ACNCLKS AG +S  N   AA  PGKCGV
Sbjct  40   YLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C   H
Sbjct  100  NIPYKISTSTNCATYH  115



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+K     TAACC GVK L + A T ADR+ AC CLKS A  +SG N   A+  P KCGV
Sbjct  43   YLKSGGAPTAACCGGVKSLNSMASTPADRKAACGCLKSAAASISGMNTAAASSLPSKCGV  102

Query  240  NVGYPISTSTDCPKIH  287
            ++ YPISTS DC K++
Sbjct  103  SIPYPISTSVDCAKVN  118



>gb|ACJ62381.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +3

Query  54   FQYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
              Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  43   LSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPS  101

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  102  KCGVSIPYTISTSTDCSRVN  121



>ref|XP_008798560.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +3

Query  33   GE*LSLL---FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNP  203
            G+ +S L     Y +   P+ A CC GVK L AAAK+T DRQTAC+CLK  A  +SG N 
Sbjct  31   GQVVSFLTPCIAYARNGGPIPAGCCSGVKGLVAAAKSTPDRQTACSCLKRAAASISGLNT  90

Query  204  GLAAGAPGKCGVNVGYPISTSTDCPKIH  287
            GL AG P KCGV + Y IS STDC K+ 
Sbjct  91   GLIAGVPAKCGVRIPYSISPSTDCSKVK  118



>gb|ACJ62361.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +3

Query  54   FQYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
              Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  43   LSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPS  101

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  102  KCGVSIPYTISTSTDCSRVN  121



>ref|XP_008244970.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +  ACC G++ +   A+TT DR+ ACNCLK L+G +SG NP  AAG PGKC
Sbjct  40   INYVRKGGVVPPACCNGIRAVNGLARTTPDRRAACNCLKQLSGSISGVNPNNAAGLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS ST+C  + 
Sbjct  100  GVNIPYKISASTNCATVK  117



>emb|CAN70512.1| hypothetical protein VITISV_005630 [Vitis vinifera]
Length=115

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG N GLAAG PGKC
Sbjct  41   INYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKC  100

Query  234  GVNVGYPISTSTDC  275
            GVN+ Y IS ST+C
Sbjct  101  GVNIPYKISPSTNC  114



>ref|XP_009631888.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana tomentosiformis]
 sp|Q42952.1|NLTP1_TOBAC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Pathogenesis-related protein 14; Short=PR-14; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA44267.1| lipid transferase [Nicotiana tabacum]
Length=114

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++ T PL   CC GVK L  +A+TT DRQ AC CLKS AG +SG N G AAG P  C
Sbjct  38   LAYLRNTGPL-GRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTC  96

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS STDC K+ 
Sbjct  97   GVNIPYKISPSTDCSKVQ  114



>ref|XP_006662670.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
 ref|XP_006663742.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
Length=119

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y+ G     +++CC GVK L   A ++ADR+TAC+CLKS+AG +   N G AA  P K
Sbjct  41   LSYVTGRMSAPSSSCCSGVKTLNGKASSSADRRTACSCLKSMAGSVRNLNMGNAATIPSK  100

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV+V +PISTS DC KI+
Sbjct  101  CGVSVAFPISTSVDCSKIN  119



>gb|ACJ62387.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +3

Query  54   FQYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
              Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  38   LSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPS  96

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  97   KCGVSIPYTISTSTDCSRVN  116



>sp|Q43193.1|NLTP1_SORBI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Sorghum bicolor]
 emb|CAA50660.1| lipid transfer protein [Sorghum bicolor]
Length=118

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +3

Query  42   LSLLFQYIKGT--EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAA  215
            ++L   Y +G    P +A CC GV+ L +AA+TTADR+ ACNCLK+ A  +SG N G AA
Sbjct  36   IALCLSYARGQGFAP-SAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAA  94

Query  216  GAPGKCGVNVGYPISTSTDCPKIH  287
              P KCGV+V Y ISTSTDC ++ 
Sbjct  95   SIPSKCGVSVPYTISTSTDCSRVS  118



>ref|XP_008244911.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X1 [Prunus 
mume]
Length=132

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL--SGFNPGLAA  215
            L+    Y+    PL  +CC GVK L + A+TTADRQ+ CNCLK     +  +  N GLAA
Sbjct  40   LTPCLSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQAVNGIPYTNANAGLAA  99

Query  216  GAPGKCGVNVGYPISTSTDCPKIH*NRLWESAG  314
            G PGKCGVN+ Y IS STDC       LW+ A 
Sbjct  100  GLPGKCGVNIPYKISPSTDCKASSERFLWKPAA  132



>ref|XP_008244959.1| PREDICTED: non-specific lipid-transfer protein 1-like [Prunus 
mume]
Length=117

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG   +  ACCKG++ ++  AKTTADRQ ACNCLK L+G +SG NP  AA  PGKCGV
Sbjct  42   YVKGGGAVPPACCKGIRTVSGLAKTTADRQAACNCLKQLSGSISGVNPNNAAALPGKCGV  101

Query  240  NVGYPISTSTDCPKIH  287
            NV Y I+T  +C  + 
Sbjct  102  NVPYKINTFINCAAVK  117



>gb|AAT68263.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    + AACC G+K L + A +T DRQTACNC+KS A  +SG N GLA+  PGKC
Sbjct  40   INYVRQGGAIPAACCSGIKTLNSQATSTPDRQTACNCIKSAARSISGINFGLASSLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS S DC  + 
Sbjct  100  GVNLPYKISPSIDCSTVQ  117



>gb|ABA33862.1| phospholipid transfer protein 1, partial [Zea diploperennis]
 gb|ABA33863.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=111

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GVK L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  33   ISYARGQGSAP-SAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  91

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  92   KCGVSIPYTISTSTDCSRVN  111



>gb|AFK44274.1| unknown [Medicago truncatula]
Length=116

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +SG N   A+  PGKCGV
Sbjct  40   YLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  I 
Sbjct  100  NIPYKISTSTNCATIR  115



>ref|XP_003605266.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87463.1| Lipid transfer protein [Medicago truncatula]
Length=116

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +SG N   A+  PGKCGV
Sbjct  40   YLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  I 
Sbjct  100  NIPYKISTSTNCATIR  115



>gb|AAZ32875.1| lipid transfer protein precursor [Medicago sativa]
Length=82

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y++G    + ACC GVK L AAA TT DRQ ACNCLKS AG +SG N   AAG 
Sbjct  9    LSPCIAYLRGGAGPSPACCAGVKRLNAAATTTPDRQAACNCLKSAAGAISGLNASTAAGL  68

Query  222  PGKCGVNVGYPIST  263
            PGKCGVN+ Y IST
Sbjct  69   PGKCGVNIPYKIST  82



>ref|XP_006346674.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
tuberosum]
Length=110

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++GT PL   CC GV++LA+AAK+T DR+TAC CLKS AG +SG N   AAG P  CGV
Sbjct  36   YLRGTAPL-GGCCGGVRNLASAAKSTPDRKTACTCLKSAAGAISGINYSKAAGLPSTCGV  94

Query  240  NVGYPISTSTDCPKI  284
            N+ Y IS STDC K+
Sbjct  95   NIPYKISPSTDCSKV  109



>emb|CCD33109.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++     +A+CC GVK L +AA TTADR+TACNCLK+LAG  SG N G AA  PGKC
Sbjct  39   ISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKSGINEGNAASLPGKC  98

Query  234  GVNVGYPISTSTDCPKI  284
             VNV Y ISTST+C  I
Sbjct  99   KVNVPYKISTSTNCANI  115



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G    +A CC GV++L +AA TT DRQ ACNCLKS AG +S  N   AA  PGKCGV
Sbjct  40   YLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  I 
Sbjct  100  NIPYKISTSTNCATIR  115



>emb|CAT99614.1| lipid transfer protein [Malus domestica]
Length=81

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG NP  AAG PGKCGV
Sbjct  13   YVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV  72

Query  240  NVGYPISTS  266
            NV Y ISTS
Sbjct  73   NVPYKISTS  81



>gb|ACJ62342.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    + +CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSGSCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGV++ Y ISTSTDC +++
Sbjct  103  CGVSIPYTISTSTDCSRVN  121



>gb|AFK36168.1| unknown [Lotus japonicus]
Length=115

 Score = 65.9 bits (159),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            YI+G    +  CC GV+ + +AA +TADR+ ACNCLKS AG    FN G AA  PGKCGV
Sbjct  40   YIQGGAGPSPPCCAGVRRVNSAASSTADRRAACNCLKSAAGSFPRFNAGNAASLPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  I 
Sbjct  100  NIPYKISTSTNCANIK  115


 Score = 27.3 bits (59),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  4   AESAITCGTVASSLVSC  54
           AE+AITCG +AS+L+ C
Sbjct  21  AEAAITCGAIASALIPC  37



>ref|NP_001268074.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33394.1|AF467946_1 lipid transfer protein isoform 4 [Vitis vinifera]
Length=119

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y++    + A CC G+K L +AAKTT DRQ AC CLK+ +  +SG N GLA+G 
Sbjct  38   LSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGINYGLASGL  97

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV+V Y IS STDC K+
Sbjct  98   PGKCGVSVPYKISPSTDCSKV  118



>gb|ABA34089.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34091.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
Length=119

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPK  281
            CGV++ Y ISTSTDC +
Sbjct  103  CGVSIPYTISTSTDCSR  119



>gb|ABA33857.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  66   KGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNV  245
            +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P KCGV++
Sbjct  48   QGSAP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSI  106

Query  246  GYPISTSTDCPKIH  287
             Y ISTSTDC +++
Sbjct  107  PYTISTSTDCSRVN  120



>gb|AAK28533.1|AF329829_1 lipid transfer protein precursor [Corylus avellana]
Length=115

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+K    L  +CCKGV+ +  A++TT+DRQ+ACNCLK  A  ++G NP LAAG PGKCGV
Sbjct  40   YLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y IS ST+C  + 
Sbjct  100  NIPYKISPSTNCNNVK  115



>gb|ABA34080.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34081.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34082.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34084.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34085.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34086.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34087.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34088.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34090.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
Length=119

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPK  281
            CGV++ Y ISTSTDC +
Sbjct  103  CGVSIPYTISTSTDCSR  119



>ref|XP_010922734.1| PREDICTED: non-specific lipid-transfer protein 1 [Elaeis guineensis]
Length=118

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y +    + A CC GVK L AAA+TTADR+TAC CLK+ A  LSG  PGL +G 
Sbjct  37   LTPCISYARSGGQVPAGCCSGVKGLVAAARTTADRRTACTCLKNTAAGLSGLKPGLISGI  96

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV V Y IS STDC ++
Sbjct  97   PGKCGVRVPYAISPSTDCSRV  117



>ref|XP_009410515.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=114

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y +   PLTA CC GV+ L  AA+TT DRQT CNCLK     + G  PGL +G P KCGV
Sbjct  39   YARAIGPLTAGCCSGVRALDGAARTTPDRQTTCNCLKRSTAGIQGLQPGLISGIPRKCGV  98

Query  240  NVGYPISTSTDCPKI  284
            N+ Y I  STDC ++
Sbjct  99   NIPYSIGPSTDCSRV  113



>gb|ABQ53932.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
            F Y+ GT  L   CCKG+KDL AAA+TTADRQ+ C+CLK LA   +G + G AAG P +C
Sbjct  42   FPYVTGTGAL-GGCCKGIKDLYAAAQTTADRQSVCDCLKDLAASTTGVDLGKAAGLPSQC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            G+N+ Y I  STDC K+ 
Sbjct  101  GLNIPYKIIPSTDCSKVQ  118



>gb|ABA33855.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A+CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  43   ISYARGQGSGP-SASCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  101

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  102  KCGVSIPYTISTSTDCSRVN  121



>gb|ABA33846.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GVK L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  42   ISYARGQGSGP-SAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  100

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  101  KCGVSIPYTISTSTDCSRVN  120



>gb|ABA33848.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=110

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GVK L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  32   ISYARGQGSGP-SAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  90

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  91   KCGVSIPYTISTSTDCSRVN  110



>emb|CDM80995.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVG  248
            GT P + ACC GV+ LA  A++TAD+Q  C CLKS+AG   G NP  AAG P KCGV+V 
Sbjct  47   GTSP-SGACCSGVRKLAGLARSTADKQATCRCLKSVAG---GLNPNKAAGIPSKCGVSVP  102

Query  249  YPISTSTDCPKIH  287
            Y IS S DC KIH
Sbjct  103  YTISASVDCSKIH  115



>gb|AAK20395.1|AF334185_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAV28706.1| lipid transfer protein [Triticum aestivum]
 emb|CAH69208.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVG  248
            GT P + ACC GV+ LA  A++TAD+Q  C CLKS+AG   G NP  AAG P KCGV+V 
Sbjct  47   GTSP-SGACCSGVRKLAGLARSTADKQATCRCLKSVAG---GLNPNKAAGIPSKCGVSVP  102

Query  249  YPISTSTDCPKIH  287
            Y IS S DC KIH
Sbjct  103  YTISASVDCSKIH  115



>gb|ABE11609.1| lipid-transfer protein precursor [Solanum chacoense]
Length=115

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = +3

Query  33   GE*LSLLFQ---YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNP  203
            G+  S LF    Y++ T PL   CC GVK L   A+TTADRQTACNCLKS AG + G N 
Sbjct  29   GQVTSSLFSCLPYLRNTGPL-GDCCSGVKKLKGQAQTTADRQTACNCLKSTAGSIKGLNF  87

Query  204  GLAAGAPGKCGVNVGYPISTSTDCPKIH  287
            G AA  P  C VN+ Y IS STDC K+ 
Sbjct  88   GKAASLPSTCSVNIPYEISPSTDCSKVQ  115



>gb|AAB70538.1| lipid transfer protein [Oryza sativa Indica Group]
Length=115

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    +AACC GV++L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  34   VSPCLSYARGGSGPSAACCSGVRNLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASI  93

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGV++ Y IS S  C  ++
Sbjct  94   PSKCGVSIPYTISPSVYCSSVN  115



>gb|AFX65219.1| lipid transfer precursor protein, partial [Triticum aestivum]
Length=121

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVG  248
            GT P + ACC GV+ LA  A++TAD+Q  C CLKS+AG   G NP  AAG P KCGV+V 
Sbjct  53   GTSP-SGACCNGVRKLAGLARSTADKQATCRCLKSVAG---GLNPNKAAGIPSKCGVSVP  108

Query  249  YPISTSTDCPKIH  287
            Y IS S DC KIH
Sbjct  109  YTISASVDCSKIH  121



>ref|XP_004977380.1| PREDICTED: non-specific lipid-transfer protein-like [Setaria 
italica]
Length=117

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +   +G++P + ACC GVK L +AA TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  39   LPYARGQGSKP-SDACCSGVKRLNSAATTTADRRAACNCLKNAARGISGLNAGNAASIPS  97

Query  228  KCGVNVGYPISTSTDCPKI  284
            KCGV++ Y ISTSTDC ++
Sbjct  98   KCGVSIPYSISTSTDCSRV  116



>ref|XP_008662435.1| PREDICTED: non-specific lipid-transfer protein [Zea mays]
 gb|ACG24030.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|AFW55967.1| phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GVK L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  43   ISYARGQGSGP-SAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  101

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  102  KCGVSIPYTISTSTDCSRVN  121



>gb|AFD32273.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 52/90 (58%), Gaps = 14/90 (16%)
 Frame = +3

Query  18   YLRHGGE*LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  197
            Y R+GGE              +   CC+GV+ L   AKTT DRQTACNCLKSL     G 
Sbjct  38   YSRNGGE--------------IPPGCCEGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGL  83

Query  198  NPGLAAGAPGKCGVNVGYPISTSTDCPKIH  287
            N  + AG PGKCGVN+ YPIS  TDC K+ 
Sbjct  84   NANIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>gb|ACG29829.1| nonspecific lipid-transfer protein 1 precursor [Zea mays]
Length=123

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPKIH*N  293
            CGV++ Y ISTSTDC +   N
Sbjct  103  CGVSIPYTISTSTDCSRHRVN  123



>ref|XP_008388341.1| PREDICTED: non-specific lipid-transfer protein-like [Malus domestica]
Length=113

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +  ACC G++ +   A+TTADRQT CNCLK+LAG +SG NP  AA  P KC
Sbjct  38   INYVRRGGAVPPACCNGIRTINGLARTTADRQTTCNCLKNLAGSISGVNPNNAAALPVKC  97

Query  234  GVNVGYPISTSTDC  275
            GVNV + ISTST+C
Sbjct  98   GVNVPFKISTSTNC  111



>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Capric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Lauric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Myristic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Palmitoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Stearic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Oleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Alpha-Linolenic Acid 
Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Ricinoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15 
Structures
 pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
 pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With 
Palmitate
Length=93

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  15   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  73

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  74   KCGVSIPYTISTSTDCSRVN  93



>gb|AES87466.2| Lipid transfer protein [Medicago truncatula]
Length=139

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +SG N   A+  PGKCGV
Sbjct  40   YLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  + 
Sbjct  100  NIPYKISTSTNCATVR  115



>gb|ABA33853.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=109

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  31   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  89

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  90   KCGVSIPYTISTSTDCSRVN  109



>gb|ABA33847.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  42   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  100

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  101  KCGVSIPYTISTSTDCSRVN  120



>ref|NP_001105311.1| non-specific lipid-transfer protein precursor [Zea mays]
 sp|P19656.1|NLTP_MAIZE RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Allergen=Zea m 14; Flags: Precursor [Zea mays]
 gb|AAA33493.1| phospholipid transfer protein precursor [Zea mays]
 gb|ABA33851.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
 gb|ABA33852.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  42   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  100

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  101  KCGVSIPYTISTSTDCSRVN  120



>gb|ABA33860.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=109

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  31   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  89

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  90   KCGVSIPYTISTSTDCSRVN  109



>gb|AET05732.1| lipid transfer protein isoform c, partial [Pyrus communis]
Length=94

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y++    +  ACC G+K +   A TT DRQ ACNCLK+LAG +SG NPG A   
Sbjct  13   LAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSVSGVNPGNAESL  72

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGVNV   IST T+C  +
Sbjct  73   PGKCGVNVPCKISTPTNCATV  93



>gb|ABA33866.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=114

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  36   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  94

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  95   KCGVSIPYTISTSTDCSRVN  114



>gb|ABA33849.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  41   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  99

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  100  KCGVSIPYTISTSTDCSRVN  119



>gb|ABA33850.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  42   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  100

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  101  KCGVSIPYTISTSTDCSRVN  120



>ref|XP_008350569.1| PREDICTED: non-specific lipid-transfer protein isoform X2 [Malus 
domestica]
Length=123

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +  ACC G++ +   A+TTADRQT CNCLK+LAG +SG NP  AA  P KC
Sbjct  38   INYVRRGGAVPPACCNGIRTINGLARTTADRQTTCNCLKNLAGSISGVNPNNAAALPVKC  97

Query  234  GVNVGYPISTSTDC  275
            GVNV + ISTST+C
Sbjct  98   GVNVPFKISTSTNC  111



>ref|XP_011091601.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+ GT  L   CCKG+ DL AAA+TTADRQ+ C CLK LA   SG N G AAG P +CG+
Sbjct  44   YVTGTGAL-GGCCKGINDLYAAAQTTADRQSVCGCLKDLAASTSGVNLGKAAGLPSQCGL  102

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y IS STDC K+ 
Sbjct  103  NIPYKISPSTDCSKVQ  118



>gb|ABA33858.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  38   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  96

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  97   KCGVSIPYTISTSTDCSRVN  116



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            ++KG  PL  ACC GV+ L +AAKTTADRQ  C CLKS A  + G N GLA   PGKCGV
Sbjct  48   FVKG-GPLPPACCSGVRTLNSAAKTTADRQATCQCLKSAAASIPGLNLGLANSIPGKCGV  106

Query  240  NVGYPISTSTDCPKIH  287
            N  Y IS STDC ++ 
Sbjct  107  NFPYKISPSTDCSRVR  122



>tpg|DAA59277.1| TPA: hypothetical protein ZEAMMB73_838830 [Zea mays]
Length=157

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  81   LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPIS  260
            L A+CC GVK L +AA+T+ADRQ AC CLKSLA  +   N G  A  PGKCGV+VG+PIS
Sbjct  55   LPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVKSVNMGTVATIPGKCGVSVGFPIS  114

Query  261  TSTDCPK  281
             STDC K
Sbjct  115  MSTDCNK  121



>ref|XP_008442324.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=117

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  87   AACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTS  266
            A CC G++ L   A TTADR+TACNCLKS A  +SG N   AAG PGKCGV++ YPIS +
Sbjct  51   AGCCSGIRSLNGQAATTADRRTACNCLKSAAKSISGINYKAAAGLPGKCGVSISYPISPN  110

Query  267  TDCPKIH  287
            TDC +++
Sbjct  111  TDCSRVN  117



>ref|XP_008350568.1| PREDICTED: non-specific lipid-transfer protein isoform X1 [Malus 
domestica]
Length=124

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +  ACC G++ +   A+TTADRQT CNCLK+LAG +SG NP  AA  P KC
Sbjct  38   INYVRRGGAVPPACCNGIRTINGLARTTADRQTTCNCLKNLAGSISGVNPNNAAALPVKC  97

Query  234  GVNVGYPISTSTDC  275
            GVNV + ISTST+C
Sbjct  98   GVNVPFKISTSTNC  111



>gb|ABA34092.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34093.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 tpg|DAA59230.1| TPA: phospholipid transfer protein-like protein [Zea mays]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDCPK  281
            CGV++ Y ISTSTDC +
Sbjct  103  CGVSIPYTISTSTDCSR  119



>gb|AGV40204.1| nonspecific lipid-transfer protein 3, partial [Oryza sativa]
Length=126

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    +AACC GV+ L +AA TTADR+TACNCLK++AG +SG N G AA  
Sbjct  48   VSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASI  107

Query  222  PGKCGVNVGYPISTSTDC  275
            P KCGV++ Y IS S +C
Sbjct  108  PSKCGVSIPYTISPSIEC  125



>ref|NP_001268120.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33393.1|AF467945_1 lipid transfer protein isoform 1 [Vitis vinifera]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  57   QYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCG  236
             Y++    + A CC G+K L +AAKTT DRQ AC CLK+ +G + G N GLA+G PGKCG
Sbjct  43   SYLQKGGSVPAGCCSGIKSLNSAAKTTVDRQAACKCLKTFSGSIPGINFGLASGLPGKCG  102

Query  237  VNVGYPISTSTDCPKI  284
            V+V Y IS STDC K+
Sbjct  103  VSVPYKISPSTDCSKV  118



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   FQYIKGTEPLT-AACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y+K T P   A CC GV+ +  AAKTTADR+TAC CLKS AG + G NP   AG PGK
Sbjct  38   LSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK  97

Query  231  CGVNVGYPISTSTDCPKIH  287
            CGVN+ Y IS ST+C  + 
Sbjct  98   CGVNIPYKISLSTNCATVK  116



>gb|ABA29446.1| non-specific lipid transfer protein [Vitis vinifera]
Length=119

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y++    +   CC G+K L +AAKTT DRQTAC CLK+ +  +SG N GLA+G 
Sbjct  38   LSQCINYLQKGGAVPPGCCSGIKSLNSAAKTTGDRQTACKCLKTFSSSISGINFGLASGL  97

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV+V Y IS STDC K+
Sbjct  98   PGKCGVSVPYKISPSTDCSKV  118



>sp|E6Y8S8.1|NLTP1_APIGR RecName: Full=Non-specific lipid-transfer protein; AltName: Full=Allergen 
Api g 2.0101; AltName: Allergen=Api g 2; Flags: 
Precursor [Apium graveolens]
 gb|ACV04796.1| stalk non-specific lipid-transfer protein 1 [Apium graveolens]
Length=118

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+KG    + ACC GVK L + AKT ADR+ AC CLK+LAG + G N G A+  PGKC
Sbjct  41   LGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            G+ + YPIS STDC +++
Sbjct  101  GIRIPYPISPSTDCSRVN  118



>sp|Q43871.1|NLTP8_HORVU RecName: Full=Non-specific lipid-transfer protein Cw18; Short=LTP 
Cw-18; AltName: Full=PKG2316; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48622.1| Cw-18 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 emb|CAA85483.1| lipid transfer protein precursor [Hordeum vulgare subsp. vulgare]
 dbj|BAK01310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVG  248
            GT P +A CC GVK LA  A++TAD+Q  C CLKS+AG    +N G AAG P +CGV+V 
Sbjct  47   GTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSVAG---AYNAGRAAGIPSRCGVSVP  102

Query  249  YPISTSTDCPKIH  287
            Y IS S DC KIH
Sbjct  103  YTISASVDCSKIH  115



>ref|XP_004978532.1| PREDICTED: non-specific lipid-transfer protein-like [Setaria 
italica]
Length=117

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +   +G+ P +A CC GV+ L +AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  39   LPYARGQGSAP-SAGCCNGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPS  97

Query  228  KCGVNVGYPISTSTDCPKI  284
            KCGV++ Y ISTSTDC ++
Sbjct  98   KCGVSIPYSISTSTDCSRV  116



>gb|ABA33854.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  43   ISYARGQGSGP-SAGCCSGVRSLKNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  101

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  102  KCGVSIPYTISTSTDCSRVN  121



>emb|CCJ09772.1| putative non-specific lipid transfer protein, partial [Hirudo 
medicinalis]
Length=82

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G   +   CC G+K L  +AKTTADR++ C CLKSLAG   G N   AAG PGKCGV
Sbjct  7    YVQGGNVVPPPCCGGIKSLYTSAKTTADRRSICYCLKSLAGSFKGINYSKAAGLPGKCGV  66

Query  240  NVGYPISTSTDCPKI  284
            N+ Y I  STDC K+
Sbjct  67   NIPYKIDPSTDCSKV  81



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+ G   +  ACC G++++   AKTTADRQ ACNCLK L+G + G NP  AA  PGKCGV
Sbjct  42   YVIGGGAVPPACCNGIRNVENLAKTTADRQAACNCLKQLSGSIPGVNPNNAAALPGKCGV  101

Query  240  NVGYPISTSTDCPKIH  287
            NV Y IS ST+C  + 
Sbjct  102  NVPYKISISTNCAAVK  117



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+ G    T +CC GVK L AAA TTADRQ ACNCLK+ AG ++  NPG AA  PGKC V
Sbjct  42   YLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTAAGNINNLNPGNAAALPGKCNV  101

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y IST+T+C  I 
Sbjct  102  NIPYKISTTTNCNTIK  117



>ref|XP_010043171.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88335.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
 gb|KCW88336.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    L +ACC G++ L +AA+TT DRQTAC CL+S AG + G N GL +  PGKCGV
Sbjct  41   YLRAGGTLPSACCSGIRSLNSAARTTPDRQTACRCLQSAAGNIRGLNLGLVSALPGKCGV  100

Query  240  NVGYPISTSTDCPKIH  287
            +V Y IS STDC ++ 
Sbjct  101  SVPYKISPSTDCSRVK  116



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG   +  ACC G++++   A+TT DRQ ACNCLK L+  + G NP  AA  PGKCGV
Sbjct  42   YVKGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGV  101

Query  240  NVGYPISTSTDCPKI  284
            N+ Y IS ST+C  +
Sbjct  102  NIPYQISPSTNCANV  116



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y++    + A+CC+GV  L +AAKTTADRQ AC+CLKS    +SG  P LA+  
Sbjct  38   LSPCITYVRNGGSVPASCCQGVAALNSAAKTTADRQAACSCLKSALSSVSGIQPSLASSL  97

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            PGKCGV++ Y IS STDC K+ 
Sbjct  98   PGKCGVSIPYQISPSTDCSKVK  119



>emb|CAA65680.1| lipid transfer protein 7a2b [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  60   YIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCG  236
            Y+ G    ++  CC GV+ L   A+++ DRQTAC CLKSLA  +   N G  +G PGKCG
Sbjct  46   YVTGRASAISKECCSGVQGLNGLARSSPDRQTACRCLKSLATSIKAINMGKVSGVPGKCG  105

Query  237  VNVGYPISTSTDCPKIH  287
            V+V +PIS STDC K+H
Sbjct  106  VSVPFPISMSTDCNKVH  122



>dbj|BAJ91878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVG  248
            GT P +A CC GVK LA  A++TAD+Q  C CLKS+AG    +N G AAG P +CGV+V 
Sbjct  47   GTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSVAG---AYNAGRAAGIPSRCGVSVP  102

Query  249  YPISTSTDCPKIH  287
            Y IS S DC KIH
Sbjct  103  YTISASVDCTKIH  115



>ref|XP_008244937.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+ G   +  ACC G++++   A TTADRQ ACNCLK L+G + G NP  AA  PGKCGV
Sbjct  42   YVIGGGAVPPACCNGIRNVDNLANTTADRQAACNCLKQLSGSIPGVNPNNAASLPGKCGV  101

Query  240  NVGYPISTSTDCPKI  284
            N+ Y IS+ST+C  +
Sbjct  102  NIPYNISSSTNCATV  116



>gb|ABA33856.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=117

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  39   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  97

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC +++
Sbjct  98   KCGVSIPYTISTSTDCSRVN  117



>gb|ACM78613.1| lipid transfer protein 1 [Tamarix hispida]
Length=118

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              +++   P  A CC  +K L +  ++T DR+ AC CLKS A    G N G AA  PGKC
Sbjct  41   LTFLQRGGPPAAGCCGAIKSLNSMVRSTPDRKAACGCLKSAAKSFPGINMGNAAALPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+GYPISTS DC ++ 
Sbjct  101  GVNIGYPISTSVDCSRVK  118



>gb|ABA34083.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
Length=119

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +3

Query  54   FQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P K
Sbjct  43   LSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSK  102

Query  231  CGVNVGYPISTSTDC  275
            CGV++ Y ISTSTDC
Sbjct  103  CGVSIPYTISTSTDC  117



>ref|XP_003605269.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=166

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 55/97 (57%), Gaps = 5/97 (5%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  AG +SG N   A+  PGKCGV
Sbjct  40   YLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGV  99

Query  240  NVGYPISTSTDCPKIH*NRLWESAGFLRQAITENYDD  350
            N+ Y ISTST+C          S+G        NY +
Sbjct  100  NIPYKISTSTNCATAT-----RSSGLEDDVAASNYAN  131



>ref|XP_010454878.1| PREDICTED: non-specific lipid-transfer protein 3-like [Camelina 
sativa]
Length=115

 Score = 62.8 bits (151),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  93   CCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTSTD  272
            CC+GVK L   A+TT DRQ AC CL+S A  LSG +P LA+G PGKCGV + YPIS ST+
Sbjct  51   CCEGVKSLNGMAQTTPDRQQACRCLQSTAKGLSGLDPSLASGLPGKCGVTIPYPISMSTN  110

Query  273  CPKIH  287
            C  + 
Sbjct  111  CENVK  115


 Score = 28.5 bits (62),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +1

Query  1   NAESAITCGTVASSLVSCFN  60
           +A++AI+CGTVASSL  C N
Sbjct  20  SADAAISCGTVASSLAPCAN  39



>ref|XP_010483551.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 62.4 bits (150),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  93   CCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTSTD  272
            CC+GVK L   A+TT DRQ AC CL+S A  LSG +P LA+G PGKCGV++ YPIS ST+
Sbjct  51   CCEGVKSLNGMAQTTPDRQQACRCLQSTAKGLSGLDPSLASGLPGKCGVSIPYPISMSTN  110

Query  273  CPKIH  287
            C  + 
Sbjct  111  CDNVK  115


 Score = 28.9 bits (63),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +1

Query  1   NAESAITCGTVASSLVSCFN  60
           +A++AI+CGTVASSL  C N
Sbjct  20  SADAAISCGTVASSLAPCAN  39



>gb|AAO33357.1|AF465408_1 nonspecific lipid transfer protein 1 [Vitis cinerea var. helleri 
x Vitis vinifera]
Length=119

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y+K    +   CC G+K+L +AA+TTADRQ AC CLK+ +  + G N GLA+G 
Sbjct  38   LSSCLGYLKNGGAVPPGCCSGIKNLNSAAQTTADRQAACKCLKTFSNSIPGINLGLASGL  97

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV+V Y IS STDC K+
Sbjct  98   PGKCGVSVPYKISPSTDCSKV  118



>pir||JH0379 phospholipid transfer protein 6B6 - maize (fragment)
 gb|AAA33494.1| phospholipid transfer protein, partial [Zea mays]
Length=99

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            + +   +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  13   ISYARGQGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS  71

Query  228  KCGVNVGYPISTSTDCPKIH*NRLWESA  311
            KCGV++ Y ISTSTDC +    R+  SA
Sbjct  72   KCGVSIPYTISTSTDCSRYS-RRMHASA  98



>ref|XP_010443685.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 62.4 bits (150),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  93   CCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTSTD  272
            CC+GVK L   A+TT DRQ AC CL+S A  LSG +P LA+G PGKCGV++ YPIS ST+
Sbjct  51   CCEGVKSLNGMAQTTPDRQQACRCLQSTAKGLSGLDPSLASGLPGKCGVSIPYPISMSTN  110

Query  273  CPKIH  287
            C  + 
Sbjct  111  CDNVK  115


 Score = 28.5 bits (62),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +1

Query  1   NAESAITCGTVASSLVSCFN  60
           +A++AI+CGTVASSL  C N
Sbjct  20  SADAAISCGTVASSLAPCAN  39



>gb|AFD32275.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=114

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y +    +   CC GV+ L   AKTT DRQTACNCLKSL     G N  + AG 
Sbjct  33   LTSCLAYARNGGQIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGLNANIVAGI  92

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            PGKCGVN+ YPIS  TDC K+ 
Sbjct  93   PGKCGVNIPYPISMQTDCNKVR  114



>ref|XP_010922736.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=120

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
             QY++    +   CC GV+ L AAA+T  DR+TAC C+K+ A  LSG + G A   PGKC
Sbjct  43   IQYLRSGGAVAPQCCSGVRSLLAAARTVTDRRTACRCIKTAAAGLSGLDIGRARALPGKC  102

Query  234  GVNVGYPISTSTDCPKIH  287
            GV++ Y IS STDC KI+
Sbjct  103  GVSIPYKISASTDCSKIN  120



>sp|A0AT28.1|NLTP1_LENCU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Flags: Precursor [Lens culinaris]
 gb|AAX35806.1| lipid transfer protein 1 precursor [Lens culinaris]
Length=118

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+KG    +  CC GVK L  AA+TT DR+ ACNCLKS AG +SG  PG  A  PGKC
Sbjct  40   LTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSSAGSISGLKPGNVATLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GV + Y ISTST+C  I 
Sbjct  100  GVRLPYTISTSTNCNTIR  117



>ref|XP_007134675.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
 gb|ADC80502.1| non-specific lipid transfer protein 1a precursor [Phaseolus vulgaris]
 gb|ESW06669.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
Length=115

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  87   AACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTS  266
            A CC GV+++  +A++TADR+  CNCLK+ AG + G NP  A   PGKCGVN+ Y ISTS
Sbjct  49   AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTS  108

Query  267  TDCPKIH  287
            T+C  I+
Sbjct  109  TNCASIN  115



>ref|XP_004978531.1| PREDICTED: non-specific lipid-transfer protein 3-like [Setaria 
italica]
Length=121

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  81   LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPIS  260
            + + CC GV+ L +AA+T+ADRQ AC CLKSLAG +   N G  AG PGKCGV+V +PIS
Sbjct  53   MPSGCCGGVRSLNSAARTSADRQAACRCLKSLAGSIKKLNMGTVAGIPGKCGVSVPFPIS  112

Query  261  TSTDCPKIH  287
             STDC K+ 
Sbjct  113  MSTDCNKVS  121



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
             QY++    +   CC GV+ L AAA+T  DR+TAC C+K+ A  LSG + G A+  PGKC
Sbjct  41   IQYLRSGGAVAPQCCSGVRSLLAAARTVTDRRTACRCIKTAAAGLSGLDIGRASALPGKC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GV++ Y IS STDC KI+
Sbjct  101  GVSIPYKISPSTDCSKIN  118



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + G NP  AA  PGKCGV
Sbjct  42   YVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGV  101

Query  240  NVGYPISTSTDCPKI  284
            N+ Y IS ST+C  +
Sbjct  102  NIPYQISPSTNCANV  116



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G   +  ACC G++D+   A+TT DRQ ACNCLK L+  + G NP  AA  PGKCGV
Sbjct  42   YVRGGGAVPPACCNGIRDVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAVLPGKCGV  101

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y IS ST+C  + 
Sbjct  102  NIPYKISPSTNCATVK  117



>gb|AAT68265.1| lipid transfer protein precursor [Nicotiana glauca]
Length=112

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y++    +  ACC G+K L + A +T DRQTACNC+KS AG +SG N GLA+  
Sbjct  36   LTPCINYVRQGGDIPTACCSGIKTLNSQATSTPDRQTACNCIKSAAGSISGINFGLASSL  95

Query  222  PGKCGVNVGYPISTSTD  272
            PGKCGVN+ Y IS S D
Sbjct  96   PGKCGVNLPYKISPSID  112



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 63.5 bits (153),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G    + ACC G+K L + A T ADR+TAC CLKS A  + G +   A+G PGKC V
Sbjct  41   YLQGGASPSPACCGGIKSLNSMASTPADRKTACGCLKSAAASVKGIDMSAASGLPGKCDV  100

Query  240  NVGYPISTSTDCPKIH  287
            ++ YPISTSTDC K++
Sbjct  101  SIPYPISTSTDCSKVN  116


 Score = 27.3 bits (59),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  1   NAESAITCGTVASSLVSCFN  60
           +AE+A+TCG V SSL+ C  
Sbjct  21  HAEAAVTCGQVTSSLLPCLG  40



>ref|XP_006387199.1| hypothetical protein POPTR_1545s00200g, partial [Populus trichocarpa]
 gb|ERP46113.1| hypothetical protein POPTR_1545s00200g, partial [Populus trichocarpa]
Length=47

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  156  CNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTSTDCPKIH  287
            CNCLKSLAGK+SG N GLAAG P KCGV++ Y IS STDC  + 
Sbjct  4    CNCLKSLAGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKSVK  47



>gb|AAA03283.1| CW18=non-specific lipid transfer protein [barley, cv. Bomi, leaves, 
Peptide, 90 aa]
Length=90

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +3

Query  69   GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVG  248
            GT P +A CC GVK LA  A++TAD+Q  C CLKS+AG    +N G AAG P +CGV+V 
Sbjct  22   GTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSVAG---AYNAGRAAGIPSRCGVSVP  77

Query  249  YPISTSTDCPKIH  287
            Y IS S DC KIH
Sbjct  78   YTISASVDCSKIH  90



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+K    + AACC GV+ L +AAKTTADRQ ACNCLK+ +  + G N  LAAG PGKC
Sbjct  38   INYLKVGGAVPAACCNGVRSLNSAAKTTADRQAACNCLKTASASIKGINLSLAAGLPGKC  97

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y IS ST+C + +
Sbjct  98   GVSVPYKISPSTNCNRYN  115



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+     + A CC G+K L   A +T DRQTACNC+KS  G +SG N GLA+  PGKC
Sbjct  40   ISYVTKGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSAVGSISGINFGLASSLPGKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS S DC  + 
Sbjct  100  GVNLPYKISPSIDCSTVQ  117



>ref|XP_008244918.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X2 [Prunus 
mume]
Length=123

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL--SGFNPGLAAGAPG  227
              Y+    PL  +CC GVK L + A+TTADRQ+ CNCLK     +  +  N GLAAG PG
Sbjct  44   LSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPG  103

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGVN+ Y IS STDC  I 
Sbjct  104  KCGVNIPYKISPSTDCKSIK  123



>sp|P85894.1|LTP1_MORNI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Allergen=Mor n 3 [Morus nigra]
Length=91

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    + A CC GV+ L  AAKTTADRQ ACNCLKS    + G N  LAAG PGKC
Sbjct  14   INYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC  73

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y IS STDC  + 
Sbjct  74   GVSVPYKISPSTDCKSVK  91



>gb|AAQ74628.1| lipid tranfer protein II [Vigna radiata]
 emb|CCF23017.1| lipid transfer protein [Vigna radiata]
 emb|CCF23314.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++     +A+CC GVK L +AA TTADR+TACNCLK+LAG  SG N G AA  PGKC
Sbjct  39   ISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKSGINEGNAASLPGKC  98

Query  234  GVNVGYPISTSTDCPKI  284
             VNV Y IST T+C  I
Sbjct  99   KVNVPYKISTFTNCANI  115



>ref|XP_008779709.1| PREDICTED: non-specific lipid-transfer protein 1-like, partial 
[Phoenix dactylifera]
Length=115

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y +    +   CC GV+ L ++AKT+ADR+T CNCLK  A  +SG  PGL AG PGKC
Sbjct  41   ISYARSGGSIPPNCCSGVRGLVSSAKTSADRRTVCNCLKRTASSISGLKPGLVAGIPGKC  100

Query  234  GVNVGYPISTSTDC  275
            GV + Y IS STDC
Sbjct  101  GVRIPYTISPSTDC  114



>gb|KJB71535.1| hypothetical protein B456_011G128300 [Gossypium raimondii]
Length=120

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = +3

Query  54   FQYIKGTEPLTA--ACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
              Y+KG    +A  ACC G++ L +AAKTT DRQ AC+C+KS A  +SG N   AAG PG
Sbjct  41   IAYLKGNGAGSAPPACCNGIRSLNSAAKTTPDRQAACSCIKSAATGISGINYSTAAGLPG  100

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCG+N+ Y IS STDC + H
Sbjct  101  KCGINIPYKISPSTDCKRFH  120



>ref|XP_009372014.1| PREDICTED: non-specific lipid-transfer protein-like [Pyrus x 
bretschneideri]
Length=115

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y+K    +  ACC G++ +   A+TTADRQT CNCLKSLAG + G NP  AA  P KCGV
Sbjct  40   YVKNGGAVPPACCNGIRTVNGLARTTADRQTTCNCLKSLAGSIKGVNPNNAATLPAKCGV  99

Query  240  NVGYPISTSTDCPKI  284
            NV + IS ST+C  +
Sbjct  100  NVPFKISISTNCATV  114



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 63.2 bits (152),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+    PL  +CC GVK L  AAKTT DRQ+ CNCLKSLA   +  +   AAG PG+C
Sbjct  42   LSYLTNKGPL-GSCCSGVKGLYGAAKTTQDRQSVCNCLKSLADSYTDVDLSKAAGLPGQC  100

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y IS STDC  +H
Sbjct  101  GVNIPYKISPSTDCSTVH  118


 Score = 26.9 bits (58),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +1

Query  1   NAESAITCGTVASSLVSCFN  60
            +E+AITCGTV S L SC +
Sbjct  24  RSEAAITCGTVVSDLDSCLS  43



>ref|NP_568905.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
 sp|Q9LLR7.1|NLTP3_ARATH RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76929.1| lipid transfer protein 3 [Arabidopsis thaliana]
 gb|AAL38769.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM19801.1| AT5g59320/mnc17_210 [Arabidopsis thaliana]
 gb|AAM20222.1| putative nonspecific lipid-transfer precursor [Arabidopsis thaliana]
 gb|AAN60256.1| unknown [Arabidopsis thaliana]
 gb|AED97171.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
Length=115

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  90   ACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTST  269
            +CC GVK L + AKTT DRQ AC C++S A  +SG NP LA+G PGKCGV++ YPIS ST
Sbjct  50   SCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMST  109

Query  270  DCPKIH  287
            +C  I 
Sbjct  110  NCNNIK  115



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y++    +  ACC G+K L ++AKTTADRQ AC CLK+ +  +SG N  LA+G 
Sbjct  38   LSPCISYLQKGGAVPPACCSGIKSLNSSAKTTADRQAACKCLKNFSSTVSGINLSLASGL  97

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV+V Y IS STDC K+
Sbjct  98   PGKCGVSVPYKISPSTDCTKV  118



>gb|AFD32274.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 50/90 (56%), Gaps = 14/90 (16%)
 Frame = +3

Query  18   YLRHGGE*LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  197
            Y R GGE              +   CC GV+ L   AKTT DRQTACNCLKSL     G 
Sbjct  38   YARKGGE--------------IPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGL  83

Query  198  NPGLAAGAPGKCGVNVGYPISTSTDCPKIH  287
            N  + AG PGKCGVN+ YPIS  TDC K+ 
Sbjct  84   NANIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>dbj|BAB09777.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=113

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  90   ACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTST  269
            +CC GVK L + AKTT DRQ AC C++S A  +SG NP LA+G PGKCGV++ YPIS ST
Sbjct  50   SCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMST  109

Query  270  DCPK  281
            +C K
Sbjct  110  NCNK  113



>gb|ABA34096.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34097.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34099.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34100.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34101.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34103.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34104.1| phospholipid transfer protein 2, partial [Zea diploperennis]
Length=116

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +    G+ P +A CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  40   LSYARGMGSAP-SAGCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPS  98

Query  228  KCGVNVGYPISTSTDCPK  281
            KCGV++ Y ISTSTDC +
Sbjct  99   KCGVSIPYTISTSTDCSR  116



>gb|ABA34094.1| phospholipid transfer protein 2, partial [Zea diploperennis]
 gb|ABA34095.1| phospholipid transfer protein 2, partial [Zea diploperennis]
Length=107

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +    G+ P +A CC GV++L +AA T ADR+ ACNCLK+ A  +SG N G AA  P 
Sbjct  31   LSYARGMGSAP-SAGCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPS  89

Query  228  KCGVNVGYPISTSTDCPK  281
            KCGV++ Y ISTSTDC +
Sbjct  90   KCGVSIPYTISTSTDCSR  107



>ref|XP_006573392.1| PREDICTED: non-specific lipid-transfer protein 1-like [Glycine 
max]
Length=119

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
             +  +G  P  A CC+GV  L  AA  TADR+TACNCLKS+A  +SG N   AA  PG+C
Sbjct  43   LRSRRGGSP-EAECCRGVTSLNRAASNTADRRTACNCLKSVAASISGLNANNAASLPGRC  101

Query  234  GVNVGYPISTSTDCPKIH  287
             V V Y ISTST+C +I 
Sbjct  102  RVRVPYRISTSTNCNRIR  119



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++G    +A CC GV++L +AA TT DRQ ACNCLKS AG +S  N   AA  PGKC V
Sbjct  40   YLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCVV  99

Query  240  NVGYPISTSTDCPKIH  287
            N+ Y ISTST+C  I 
Sbjct  100  NIPYKISTSTNCATIR  115



>gb|ABA33859.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33861.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33864.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33865.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +3

Query  66   KGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNV  245
            +G+ P +A CC GV+ L  AA+TTADR+ ACNCLK+ A  +SG N G AA  P KC V++
Sbjct  46   QGSGP-SAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCSVSI  104

Query  246  GYPISTSTDCPKIH  287
             Y ISTSTDC +++
Sbjct  105  PYTISTSTDCSRVN  118



>emb|CAH69207.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 4/83 (5%)
 Frame = +3

Query  42   LSLLFQYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAG  218
            LS    Y +G     +AACC GV+ LA++A++TAD+Q  C C+KS A    G N G AAG
Sbjct  36   LSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAVCKCIKSAAA---GLNAGKAAG  92

Query  219  APGKCGVNVGYPISTSTDCPKIH  287
             P KCGV+V Y IS+S DC KIH
Sbjct  93   IPTKCGVSVPYAISSSVDCSKIH  115



>ref|XP_002442775.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
 gb|EES16613.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
Length=119

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +   +G+ P +A CC GV+ L +AA+TTADR+ ACNCLK+ A  + G N G AA  P 
Sbjct  41   LSYARGQGSGP-SAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPS  99

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC ++ 
Sbjct  100  KCGVSIPYTISTSTDCSRVS  119



>sp|Q43194.1|NLTP2_SORBI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Sorghum bicolor]
 emb|CAA50661.1| lipid transfer protein [Sorghum bicolor]
Length=122

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  48   LLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPG  227
            L +   +G+ P +A CC GV+ L +AA+TTADR+ ACNCLK+ A  + G N G AA  P 
Sbjct  44   LSYARGQGSGP-SAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPS  102

Query  228  KCGVNVGYPISTSTDCPKIH  287
            KCGV++ Y ISTSTDC ++ 
Sbjct  103  KCGVSIPYTISTSTDCSRVS  122



>gb|ACN31666.1| unknown [Zea mays]
Length=77

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +3

Query  84   TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG-FNPGLAAGAPGKCGVNVGYPIS  260
            +AACC GV+ L + A + ADRQ  CNCLKS+ G+L G  +   AA  PGKCGV+VG PIS
Sbjct  9    SAACCSGVRSLNSRASSAADRQATCNCLKSMTGRLGGGVSMANAANIPGKCGVSVGVPIS  68

Query  261  TSTDCPKIH  287
             + DC KI+
Sbjct  69   PTVDCTKIN  77



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            LS    Y++    + A CC G+K L   A +T DRQTACNC+KS A  ++G N  LA   
Sbjct  36   LSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSAAAAINGINYSLAGSL  95

Query  222  PGKCGVNVGYPISTSTDCPKIH  287
            P KCGVN+ Y IS S DC  +H
Sbjct  96   PSKCGVNLPYKISPSIDCSTVH  117



>sp|P81402.1|NLTP1_PRUPE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Allergen Pru p 1; AltName: Full=Major allergen 
Pru p 3; AltName: Allergen=Pru p 3 [Prunus persica]
Length=91

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            L+    Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + G NP  AA  
Sbjct  10   LAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAAL  69

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            PGKCGV++ Y IS ST+C  +
Sbjct  70   PGKCGVHIPYKISASTNCATV  90



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL-SGFNPGLAAG  218
            +S  F Y++     + ACC GVK L++AAKTTADRQ AC+CLK+LA  +    N G AA 
Sbjct  39   MSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKNLANNMGQSLNAGNAAS  98

Query  219  APGKCGVNVGYPISTSTDCPKIH  287
             PGKCGVN+ Y ISTST+C  I 
Sbjct  99   LPGKCGVNIPYKISTSTNCATIK  121



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            +++   P+   CC GV+ L AAA+TT DRQTACNCLK  AG +   N   AAG PG CGV
Sbjct  40   FLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNLNNAAGLPGACGV  99

Query  240  NVGYPISTSTDCPKIH  287
            ++ Y ISTSTDC K+ 
Sbjct  100  SIPYKISTSTDCSKVR  115



>ref|XP_006662672.1| PREDICTED: non-specific lipid-transfer protein 1-like [Oryza 
brachyantha]
Length=117

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  42   LSLLFQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGA  221
            +S    Y +G    ++ACC GVK L AAA+TTADR+TACNCLK+ A  + G N G AA  
Sbjct  36   ISPCLAYARGGAGPSSACCTGVKSLNAAARTTADRRTACNCLKNAARGIRGLNAGNAASI  95

Query  222  PGKCGVNVGYPISTSTDCPKI  284
            P KCGV+V Y IS S DC ++
Sbjct  96   PSKCGVSVPYTISASIDCSRV  116



>emb|CAH03799.1| lipid transfer protein [Citrus sinensis]
Length=91

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++   P+   CC GV+ L AAA+TT DRQTACNCLK  AG +   NP  A G P  CGV
Sbjct  16   YLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGV  75

Query  240  NVGYPISTSTDCPKIH  287
            ++ Y IS STDC K+ 
Sbjct  76   SIPYKISISTDCSKVR  91



>pir||EPRZ phospholipid transfer protein homolog - rice
 pdb|1UVA|A Chain A, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1UVB|A Chain A, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1UVC|A Chain A, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1UVC|B Chain B, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1BV2|A Chain A, Lipid Transfer Protein From Rice Seeds, Nmr, 14 Structures
 pdb|1RZL|A Chain A, Rice Nonspecific Lipid Transfer Protein
Length=91

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y +G    +AACC GV+ L AAA TTADR+TACNCLK+ A  + G N G AA  P KC
Sbjct  14   LTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKC  73

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y IS S DC ++ 
Sbjct  74   GVSVPYTISASIDCSRVS  91



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +3

Query  54   FQYIKGTE-PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGK  230
              Y++G   P+   CC G+K L +AA+TT DRQ AC C+KS A  +SG N G+A+G PGK
Sbjct  41   ITYLRGKGGPVPQGCCGGIKSLNSAAQTTPDRQAACKCIKSAAAGISGINYGIASGLPGK  100

Query  231  CGVNVGYPISTSTDCPKI  284
            CGVN+ Y IS STDC + 
Sbjct  101  CGVNIPYKISPSTDCNRF  118



>gb|ACG43351.1| nonspecific lipid-transfer protein 4 precursor [Zea mays]
Length=76

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +3

Query  84   TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG-FNPGLAAGAPGKCGVNVGYPIS  260
            +AACC GV+ L + A + ADRQ  CNCLKS+ G+L G  +   AA  PGKCGV+VG PIS
Sbjct  8    SAACCSGVRSLNSRASSAADRQATCNCLKSMTGRLGGGVSMANAANIPGKCGVSVGVPIS  67

Query  261  TSTDCPKIH  287
             + DC KI+
Sbjct  68   PTVDCTKIN  76



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y++    +   CC+G++ L  +A TTADRQT CNC+K+ A  ++G N  LAAG P KC
Sbjct  16   LDYVENGGAVPMDCCEGIRSLYTSAATTADRQTVCNCMKNAASSVTGLNLDLAAGLPQKC  75

Query  234  GVNVGYPISTSTDCPKIH  287
            GV++ Y IS S DC  +H
Sbjct  76   GVSIPYQISPSVDCATVH  93



>ref|XP_004516173.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=118

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y+KG    +++CC GVK + AAA TT DR+ ACNCLK+ AG +SG   G AA  P KC
Sbjct  40   ISYLKGGPGPSSSCCGGVKRVNAAAATTPDRRAACNCLKNAAGSISGLKAGNAAALPSKC  99

Query  234  GVNVGYPISTSTDCPKIH  287
            GVN+ Y  STST+C  I+
Sbjct  100  GVNIPYKFSTSTNCNSIN  117



>gb|ACG36597.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
Length=76

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +3

Query  84   TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG-FNPGLAAGAPGKCGVNVGYPIS  260
            +AACC GV+ L + A + ADRQ  CNCLKS+ G+L G  +   AA  PGKCGV+VG PIS
Sbjct  8    SAACCSGVRSLNSRASSAADRQATCNCLKSMTGRLGGGVSMANAANIPGKCGVSVGVPIS  67

Query  261  TSTDCPKIH  287
             + DC KI+
Sbjct  68   PTVDCTKIN  76



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +3

Query  60   YIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGV  239
            Y++    + +ACC G++ L  AA+TT DR+T C C++S AG + G N GL +  PGKCGV
Sbjct  41   YLRAGGKIPSACCSGIRSLNNAARTTHDRRTTCRCVQSAAGNIQGLNLGLVSALPGKCGV  100

Query  240  NVGYPISTSTDCPKI  284
             + Y IS STDC ++
Sbjct  101  RIPYKISPSTDCSRV  115



>gb|ABA91221.2| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=120

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +3

Query  54   FQYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKC  233
              Y +G    +AACC GV+ L AAA +TADR+TACNCLK+ A  + G N G AA  P KC
Sbjct  43   LTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKC  102

Query  234  GVNVGYPISTSTDCPKIH  287
            GV+V Y IS S DC ++ 
Sbjct  103  GVSVPYTISASIDCSRVS  120



>ref|XP_010043291.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88360.1| hypothetical protein EUGRSUZ_A00746 [Eucalyptus grandis]
Length=119

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +3

Query  69   GTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVG  248
            G   + AACC G++ L +AA+TT DRQ AC CLKSL G +SG N G+ AG PGKCGV++ 
Sbjct  47   GAGAVPAACCNGIRSLNSAARTTPDRQAACKCLKSLTGSISGLNYGVVAGLPGKCGVSIP  106

Query  249  YPISTSTDCPKIH  287
            Y IS ST+C  + 
Sbjct  107  YKISPSTNCNSVK  119



>gb|AEV12221.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  93   CCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNPGLAAGAPGKCGVNVGYPISTSTD  272
            CC GV+ L   AKTT DRQTACNCLKSL     G N  + AG PGKCGVN+ YPIS  TD
Sbjct  49   CCAGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGLNAAIVAGIPGKCGVNIPYPISMQTD  108

Query  273  CPKIH  287
            C K+ 
Sbjct  109  CNKVR  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695