BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018G12 408 bp,:Filtered

Length=363
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18101.1|  hypothetical protein                                 82.0    2e-16   Ipomoea batatas [batate]



>dbj|BAD18101.1| hypothetical protein [Ipomoea batatas]
Length=248

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    GTTLIDIESTWAELASYVDISVRPPWILDDVVTRLRFLCSCGVVTASVCPSRANMPAQAL  180
            GT  + IES   +L  YVD S   PW+ D  V+RLRFLCSC  V+   C  + N+P  AL
Sbjct  160  GTNSLIIESALPDLEGYVDTSAPTPWLHDFDVSRLRFLCSCTTVSVLQCLPQGNLPGDAL  219

Query  181  ANWAVDKPGEAIFRSLNDLPRRVRALLIH  267
            A+W  +K G+  F  L +LP RVRAL+ H
Sbjct  220  ADWVGNKDGQLSFSCLAELPPRVRALIAH  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561481202700