BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018G03 660 bp,

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086884.1|  PREDICTED: ethylene-responsive transcription...    119   4e-29   Sesamum indicum [beniseed]
ref|XP_011086885.1|  PREDICTED: ethylene-responsive transcription...    118   7e-29   Sesamum indicum [beniseed]
ref|XP_011086886.1|  PREDICTED: ethylene-responsive transcription...    116   3e-28   Sesamum indicum [beniseed]
ref|XP_010250515.1|  PREDICTED: ethylene-responsive transcription...    116   6e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009421022.1|  PREDICTED: ethylene-responsive transcription...    114   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002511085.1|  DNA binding protein, putative                      114   4e-27   Ricinus communis
gb|AFD52632.1|  AP2/ERF transcription factor                            114   6e-27   Jatropha curcas
ref|XP_010929690.1|  PREDICTED: ethylene-responsive transcription...    113   7e-27   Elaeis guineensis
ref|XP_011020891.1|  PREDICTED: ethylene-responsive transcription...    113   8e-27   Populus euphratica
emb|CBI15759.3|  unnamed protein product                                110   9e-27   Vitis vinifera
ref|XP_008791015.1|  PREDICTED: ethylene-responsive transcription...    111   2e-26   Phoenix dactylifera
ref|XP_008356833.1|  PREDICTED: ethylene-responsive transcription...    113   2e-26   
ref|XP_002512669.1|  AP2 domain transcription factor RAP2.3, puta...    112   2e-26   Ricinus communis
ref|XP_002304640.1|  AP2 domain-containing transcription factor f...    112   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006420792.1|  hypothetical protein CICLE_v10005787mg             112   2e-26   Citrus clementina
ref|XP_006487554.1|  PREDICTED: ethylene-responsive transcription...    112   2e-26   Citrus sinensis [Valencia orange]
ref|XP_009339034.1|  PREDICTED: ethylene-responsive transcription...    112   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_007038155.1|  Integrase-type DNA-binding superfamily prote...    112   3e-26   Theobroma cacao [chocolate]
ref|XP_006420791.1|  hypothetical protein CICLE_v10005787mg             111   3e-26   Citrus clementina
ref|XP_006487555.1|  PREDICTED: ethylene-responsive transcription...    111   3e-26   Citrus sinensis [Valencia orange]
gb|ADJ67443.1|  ethylene response factor 14                             111   3e-26   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010663806.1|  PREDICTED: ethylene-responsive transcription...    112   5e-26   Vitis vinifera
gb|EPS59400.1|  hypothetical protein M569_15408                         110   5e-26   Genlisea aurea
gb|KDO58152.1|  hypothetical protein CISIN_1g043184mg                   111   6e-26   Citrus sinensis [Valencia orange]
gb|EYU28473.1|  hypothetical protein MIMGU_mgv1a024534mg                111   6e-26   Erythranthe guttata [common monkey flower]
ref|XP_010667007.1|  PREDICTED: ethylene-responsive transcription...    112   7e-26   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EMT21523.1|  Ethylene-responsive transcription factor ERF113         108   7e-26   Aegilops tauschii
ref|XP_010100029.1|  Ethylene-responsive transcription factor           111   8e-26   Morus notabilis
ref|XP_010249458.1|  PREDICTED: ethylene-responsive transcription...    112   8e-26   Nelumbo nucifera [Indian lotus]
gb|KJB31601.1|  hypothetical protein B456_005G197100                    110   8e-26   Gossypium raimondii
ref|XP_007043782.1|  AP2 6l, putative                                   112   9e-26   Theobroma cacao [chocolate]
gb|AJF23730.1|  ethylene responsive element binding factor              108   9e-26   Camellia sinensis [black tea]
ref|XP_003602747.1|  Ethylene-responsive transcription factor RAP2-6    110   1e-25   Medicago truncatula
gb|AHA93913.1|  ethylene response factor 15                             107   1e-25   Coffea arabica [arabica coffee]
ref|XP_009804195.1|  PREDICTED: ethylene-responsive transcription...    110   1e-25   Nicotiana sylvestris
ref|XP_008369624.1|  PREDICTED: ethylene-responsive transcription...    109   2e-25   Malus domestica [apple tree]
ref|XP_008669488.1|  PREDICTED: uncharacterized protein LOC103646542    112   2e-25   Zea mays [maize]
ref|XP_010942395.1|  PREDICTED: ethylene-responsive transcription...    109   2e-25   Elaeis guineensis
ref|XP_009405112.1|  PREDICTED: ethylene-responsive transcription...    111   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA38048.1|  TPA: putative AP2/EREBP transcription factor sup...    111   2e-25   Zea mays [maize]
ref|XP_011073204.1|  PREDICTED: ethylene-responsive transcription...    109   3e-25   Sesamum indicum [beniseed]
ref|XP_009586804.1|  PREDICTED: ethylene-responsive transcription...    110   4e-25   Nicotiana tomentosiformis
ref|XP_010911409.1|  PREDICTED: ethylene-responsive transcription...    107   5e-25   Elaeis guineensis
dbj|BAJ99457.1|  predicted protein                                      108   5e-25   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006436961.1|  hypothetical protein CICLE_v10032575mg             108   6e-25   Citrus clementina
ref|XP_002267814.1|  PREDICTED: ethylene-responsive transcription...    108   6e-25   Vitis vinifera
emb|CDO98305.1|  unnamed protein product                                108   6e-25   Coffea canephora [robusta coffee]
ref|XP_009359875.1|  PREDICTED: ethylene-responsive transcription...    108   7e-25   Pyrus x bretschneideri [bai li]
ref|XP_009390372.1|  PREDICTED: ethylene-responsive transcription...    107   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001052669.1|  Os04g0398000                                       108   1e-24   
gb|EAY93947.1|  hypothetical protein OsI_15721                          108   1e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009390834.1|  PREDICTED: ethylene-responsive transcription...    107   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACO55953.1|  RAP2-like protein                                       107   1e-24   Juglans nigra
ref|XP_010105601.1|  Ethylene-responsive transcription factor           107   2e-24   Morus notabilis
ref|XP_008811102.1|  PREDICTED: ethylene-responsive transcription...    106   2e-24   Phoenix dactylifera
ref|XP_007223939.1|  hypothetical protein PRUPE_ppa011097mg             106   2e-24   Prunus persica
ref|XP_007032031.1|  AP2/ERF domain-containing transcription fact...    107   2e-24   Theobroma cacao [chocolate]
gb|AFW58120.1|  putative AP2/EREBP transcription factor superfami...    108   2e-24   Zea mays [maize]
ref|XP_008390209.1|  PREDICTED: ethylene-responsive transcription...    106   2e-24   
ref|XP_006399824.1|  hypothetical protein EUTSA_v10014575mg             106   2e-24   Eutrema salsugineum
ref|XP_010239814.1|  PREDICTED: ethylene-responsive transcription...    107   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_009353514.1|  PREDICTED: ethylene-responsive transcription...    106   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_009359874.1|  PREDICTED: ethylene-responsive transcription...    107   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_009339054.1|  PREDICTED: ethylene-responsive transcription...    107   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_009383009.1|  PREDICTED: ethylene-responsive transcription...    106   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006469112.1|  PREDICTED: ethylene-responsive transcription...    107   3e-24   
emb|CDX78517.1|  BnaA03g04290D                                          106   3e-24   Brassica napus [oilseed rape]
ref|XP_006446923.1|  hypothetical protein CICLE_v10018158mg             107   4e-24   Citrus clementina
ref|XP_008222249.1|  PREDICTED: ethylene-responsive transcription...    106   4e-24   Prunus mume [ume]
gb|KFK25568.1|  hypothetical protein AALP_AA8G131700                    105   4e-24   Arabis alpina [alpine rockcress]
gb|KJB51301.1|  hypothetical protein B456_008G210600                    105   4e-24   Gossypium raimondii
ref|XP_006485171.1|  PREDICTED: ethylene-responsive transcription...    107   4e-24   
ref|XP_008375519.1|  PREDICTED: ethylene-responsive transcription...    107   5e-24   
ref|XP_002866459.1|  hypothetical protein ARALYDRAFT_919438             105   5e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_011457529.1|  PREDICTED: ethylene-responsive transcription...    105   6e-24   Fragaria vesca subsp. vesca
dbj|BAJ53126.1|  JHL07K02.16                                            105   6e-24   Jatropha curcas
ref|XP_006394454.1|  hypothetical protein EUTSA_v10005416mg             105   7e-24   Eutrema salsugineum
ref|XP_010419908.1|  PREDICTED: ethylene-responsive transcription...    104   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009131332.1|  PREDICTED: ethylene-responsive transcription...    105   7e-24   Brassica rapa
ref|XP_009339033.1|  PREDICTED: ethylene-responsive transcription...    105   7e-24   Pyrus x bretschneideri [bai li]
ref|XP_009130180.1|  PREDICTED: ethylene-responsive transcription...    105   8e-24   Brassica rapa
ref|NP_196837.1|  ethylene-responsive transcription factor ERF113       104   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007032032.1|  AP2/ERF domain-containing transcription fact...    105   8e-24   Theobroma cacao [chocolate]
ref|XP_007137849.1|  hypothetical protein PHAVU_009G161000g             105   9e-24   Phaseolus vulgaris [French bean]
ref|XP_008392694.1|  PREDICTED: ethylene-responsive transcription...    105   9e-24   Malus domestica [apple tree]
ref|XP_007211200.1|  hypothetical protein PRUPE_ppa008772mg             106   9e-24   Prunus persica
ref|XP_002871562.1|  hypothetical protein ARALYDRAFT_488151             104   1e-23   Arabidopsis lyrata subsp. lyrata
emb|CDX70498.1|  BnaC03g05820D                                          105   1e-23   Brassica napus [oilseed rape]
gb|EEE60921.1|  hypothetical protein OsJ_14639                          104   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011463208.1|  PREDICTED: ethylene-responsive transcription...    104   1e-23   Fragaria vesca subsp. vesca
ref|XP_008239643.1|  PREDICTED: ethylene-responsive transcription...    105   1e-23   
ref|XP_009373652.1|  PREDICTED: ethylene-responsive transcription...    105   1e-23   Pyrus x bretschneideri [bai li]
gb|KDP41861.1|  hypothetical protein JCGZ_26879                         105   1e-23   Jatropha curcas
ref|XP_010066464.1|  PREDICTED: ethylene-responsive transcription...    104   1e-23   Eucalyptus grandis [rose gum]
emb|CDX91131.1|  BnaC02g04660D                                          104   1e-23   Brassica napus [oilseed rape]
ref|XP_009125903.1|  PREDICTED: ethylene-responsive transcription...    104   2e-23   Brassica rapa
ref|XP_006580881.1|  PREDICTED: ethylene-responsive transcription...    104   2e-23   Glycine max [soybeans]
ref|XP_003528089.1|  PREDICTED: ethylene-responsive transcription...    104   2e-23   Glycine max [soybeans]
gb|AFK45569.1|  unknown                                                 103   2e-23   Lotus japonicus
ref|XP_010444024.1|  PREDICTED: ethylene-responsive transcription...    104   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006279688.1|  hypothetical protein CARUB_v10027012mg             104   2e-23   Capsella rubella
gb|KCW64343.1|  hypothetical protein EUGRSUZ_G01970                     102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010483875.1|  PREDICTED: ethylene-responsive transcription...    104   2e-23   Camelina sativa [gold-of-pleasure]
gb|KDP22531.1|  hypothetical protein JCGZ_26362                         103   2e-23   Jatropha curcas
ref|NP_200995.1|  ethylene-responsive transcription factor ERF114       104   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453397.1|  PREDICTED: ethylene-responsive transcription...    103   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010927797.1|  PREDICTED: ethylene-responsive transcription...    103   2e-23   Elaeis guineensis
ref|XP_010556085.1|  PREDICTED: ethylene-responsive transcription...    103   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_003522453.1|  PREDICTED: ethylene-responsive transcription...    104   3e-23   Glycine max [soybeans]
gb|KHN31248.1|  Ethylene-responsive transcription factor ERF114         104   3e-23   Glycine soja [wild soybean]
ref|XP_010044889.1|  PREDICTED: ethylene-responsive transcription...    103   3e-23   Eucalyptus grandis [rose gum]
ref|XP_002318176.2|  hypothetical protein POPTR_0012s11030g             103   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011463207.1|  PREDICTED: ethylene-responsive transcription...    103   3e-23   Fragaria vesca subsp. vesca
ref|XP_009759799.1|  PREDICTED: ethylene-responsive transcription...    103   4e-23   Nicotiana sylvestris
ref|XP_010492081.1|  PREDICTED: ethylene-responsive transcription...    102   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008375518.1|  PREDICTED: ethylene-responsive transcription...    103   4e-23   Malus domestica [apple tree]
ref|XP_010105603.1|  Ethylene-responsive transcription factor           103   4e-23   Morus notabilis
ref|XP_008375520.1|  PREDICTED: ethylene-responsive transcription...    104   5e-23   
ref|XP_010546103.1|  PREDICTED: ethylene-responsive transcription...    102   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_009587768.1|  PREDICTED: ethylene-responsive transcription...    103   5e-23   Nicotiana tomentosiformis
ref|XP_002297877.1|  AP2 domain-containing transcription factor f...    102   5e-23   Populus trichocarpa [western balsam poplar]
emb|CDX69647.1|  BnaA10g19960D                                          102   6e-23   Brassica napus [oilseed rape]
ref|XP_009121770.1|  PREDICTED: ethylene-responsive transcription...    102   6e-23   Brassica rapa
gb|ABC40568.1|  putative AP2/EREBP transcription factor                 100   7e-23   Capsicum annuum
ref|XP_008351719.1|  PREDICTED: ethylene-responsive transcription...    103   7e-23   Malus domestica [apple tree]
ref|XP_011036184.1|  PREDICTED: ethylene-responsive transcription...    102   7e-23   Populus euphratica
gb|EYU21807.1|  hypothetical protein MIMGU_mgv1a020102mg                103   8e-23   Erythranthe guttata [common monkey flower]
ref|XP_006288550.1|  hypothetical protein CARUB_v10001831mg             102   8e-23   Capsella rubella
gb|KHN31250.1|  Ethylene-responsive transcription factor ERF114         102   1e-22   Glycine soja [wild soybean]
gb|KDO51250.1|  hypothetical protein CISIN_1g036963mg                   101   1e-22   Citrus sinensis [Valencia orange]
ref|XP_009587769.1|  PREDICTED: ethylene-responsive transcription...    101   1e-22   Nicotiana tomentosiformis
ref|XP_010457918.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   Camelina sativa [gold-of-pleasure]
emb|CDX98982.1|  BnaC09g48530D                                          102   1e-22   Brassica napus [oilseed rape]
ref|XP_004501759.1|  PREDICTED: ethylene-responsive transcription...    102   1e-22   Cicer arietinum [garbanzo]
ref|XP_006399213.1|  hypothetical protein EUTSA_v10015583mg             102   1e-22   Eutrema salsugineum
emb|CDX70027.1|  BnaA10g23760D                                          102   2e-22   Brassica napus [oilseed rape]
ref|XP_008460191.1|  PREDICTED: ethylene-responsive transcription...    101   2e-22   Cucumis melo [Oriental melon]
ref|XP_009122352.1|  PREDICTED: ethylene-responsive transcription...    101   2e-22   Brassica rapa
gb|ADN33698.1|  AP2 domain transcription factor RAP2                    101   2e-22   Cucumis melo subsp. melo
gb|KGN46410.1|  hypothetical protein Csa_6G091830                       100   3e-22   Cucumis sativus [cucumbers]
ref|XP_007159952.1|  hypothetical protein PHAVU_002G281300g             100   3e-22   Phaseolus vulgaris [French bean]
gb|KJB77208.1|  hypothetical protein B456_012G125700                    101   3e-22   Gossypium raimondii
ref|XP_009339053.1|  PREDICTED: ethylene-responsive transcription...    101   3e-22   Pyrus x bretschneideri [bai li]
emb|CDY53152.1|  BnaCnng24520D                                          100   3e-22   Brassica napus [oilseed rape]
ref|XP_009780575.1|  PREDICTED: ethylene-responsive transcription...    101   3e-22   Nicotiana sylvestris
gb|KFK25131.1|  hypothetical protein AALP_AA8G070000                    100   4e-22   Arabis alpina [alpine rockcress]
emb|CAN81030.1|  hypothetical protein VITISV_011003                     102   4e-22   Vitis vinifera
ref|XP_003522452.1|  PREDICTED: ethylene-responsive transcription...    100   5e-22   Glycine max [soybeans]
ref|XP_002275870.2|  PREDICTED: ethylene-responsive transcription...    100   6e-22   Vitis vinifera
emb|CDY14051.1|  BnaC02g01680D                                          100   6e-22   Brassica napus [oilseed rape]
emb|CDY09787.1|  BnaC09g43740D                                        99.8    7e-22   Brassica napus [oilseed rape]
ref|XP_010527717.1|  PREDICTED: ethylene-responsive transcription...    100   7e-22   Tarenaya hassleriana [spider flower]
ref|XP_004140654.1|  PREDICTED: uncharacterized protein LOC101205898    100   8e-22   
ref|XP_006346662.1|  PREDICTED: ethylene-responsive transcription...    100   9e-22   
emb|CDX78288.1|  BnaA03g02000D                                        99.8    9e-22   Brassica napus [oilseed rape]
ref|XP_003621630.1|  Ethylene-responsive transcription factor         98.2    9e-22   Medicago truncatula
ref|XP_009132220.1|  PREDICTED: ethylene-responsive transcription...  99.8    1e-21   Brassica rapa
ref|XP_011043029.1|  PREDICTED: ethylene-responsive transcription...    100   1e-21   Populus euphratica
ref|XP_008239644.1|  PREDICTED: ethylene-responsive transcription...  99.8    1e-21   Prunus mume [ume]
ref|XP_006844465.1|  hypothetical protein AMTR_s00016p00092590        98.2    1e-21   
ref|XP_006471819.1|  PREDICTED: paramyosin-like isoform X1              102   1e-21   Citrus sinensis [Valencia orange]
gb|KDO46348.1|  hypothetical protein CISIN_1g005229mg                   102   2e-21   Citrus sinensis [Valencia orange]
ref|XP_002871264.1|  hypothetical protein ARALYDRAFT_487556           99.4    2e-21   Arabidopsis lyrata subsp. lyrata
gb|KEH21859.1|  ethylene response factor                              97.4    2e-21   Medicago truncatula
ref|XP_010530814.1|  PREDICTED: ethylene-responsive transcription...  99.4    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_004252471.2|  PREDICTED: ethylene-responsive transcription...  99.4    2e-21   Solanum lycopersicum
ref|XP_009597481.1|  PREDICTED: ethylene-responsive transcription...  99.0    2e-21   Nicotiana tomentosiformis
ref|XP_004242192.1|  PREDICTED: ethylene-responsive transcription...  99.4    2e-21   Solanum lycopersicum
gb|AES77850.2|  ethylene response factor                              95.9    2e-21   Medicago truncatula
ref|XP_002512829.1|  DNA binding protein, putative                    97.8    3e-21   
ref|XP_009125683.1|  PREDICTED: ethylene-responsive transcription...  98.6    3e-21   Brassica rapa
ref|XP_006289257.1|  hypothetical protein CARUB_v10002723mg           98.6    3e-21   Capsella rubella
ref|XP_003621632.1|  Ethylene-responsive transcription factor         98.2    3e-21   
emb|CDY55173.1|  BnaAnng13660D                                        98.6    3e-21   Brassica napus [oilseed rape]
ref|NP_196348.1|  ethylene-responsive transcription factor ERF115     98.6    4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28684.1|  unknown                                               98.2    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527715.1|  PREDICTED: ethylene-responsive transcription...  97.8    6e-21   Tarenaya hassleriana [spider flower]
ref|XP_007151718.1|  hypothetical protein PHAVU_004G069900g           97.4    7e-21   Phaseolus vulgaris [French bean]
ref|XP_010452687.1|  PREDICTED: ethylene-responsive transcription...  97.4    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010423229.1|  PREDICTED: ethylene-responsive transcription...  97.4    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010491335.1|  PREDICTED: ethylene-responsive transcription...  97.4    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008464362.1|  PREDICTED: ethylene-responsive transcription...  94.4    1e-20   Cucumis melo [Oriental melon]
gb|KJB40070.1|  hypothetical protein B456_007G045100                  96.3    1e-20   Gossypium raimondii
ref|XP_004138017.1|  PREDICTED: ethylene-responsive transcription...  93.6    2e-20   Cucumis sativus [cucumbers]
ref|XP_008647050.1|  PREDICTED: ethylene-responsive transcription...  97.8    2e-20   Zea mays [maize]
ref|XP_010540431.1|  PREDICTED: ethylene-responsive transcription...  95.5    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_007161612.1|  hypothetical protein PHAVU_001G084000g           97.1    2e-20   Phaseolus vulgaris [French bean]
ref|XP_003548854.1|  PREDICTED: ethylene-responsive transcription...  96.3    2e-20   Glycine max [soybeans]
ref|XP_006601759.1|  PREDICTED: uncharacterized protein LOC100500...  95.9    2e-20   Glycine max [soybeans]
gb|KHN13818.1|  Ethylene-responsive transcription factor ERF113       95.5    3e-20   Glycine soja [wild soybean]
ref|XP_007139323.1|  hypothetical protein PHAVU_008G019600g           95.5    3e-20   Phaseolus vulgaris [French bean]
ref|XP_004492035.1|  PREDICTED: ethylene-responsive transcription...  95.9    3e-20   
ref|XP_007210235.1|  hypothetical protein PRUPE_ppa015392mg           95.5    3e-20   Prunus persica
gb|KGN63431.1|  hypothetical protein Csa_1G000550                     94.7    4e-20   Cucumis sativus [cucumbers]
ref|NP_001239988.1|  uncharacterized protein LOC100796480             94.4    5e-20   Glycine max [soybeans]
ref|XP_003530479.2|  PREDICTED: ethylene-responsive transcription...  95.1    7e-20   Glycine max [soybeans]
gb|KHN13389.1|  Ethylene-responsive transcription factor ERF114       94.4    7e-20   Glycine soja [wild soybean]
ref|XP_006433144.1|  hypothetical protein CICLE_v10003903mg           94.0    8e-20   Citrus clementina
ref|XP_003548033.1|  PREDICTED: ethylene-responsive transcription...  94.4    8e-20   Glycine max [soybeans]
emb|CBI21270.3|  unnamed protein product                              93.6    9e-20   Vitis vinifera
gb|KHN46843.1|  Ethylene-responsive transcription factor ERF114       94.4    9e-20   Glycine soja [wild soybean]
ref|XP_010036849.1|  PREDICTED: ethylene-responsive transcription...  94.0    1e-19   Eucalyptus grandis [rose gum]
ref|XP_010036848.1|  PREDICTED: ethylene-responsive transcription...  94.0    1e-19   Eucalyptus grandis [rose gum]
gb|ABK26999.1|  unknown                                               95.1    2e-19   Picea sitchensis
ref|XP_010037501.1|  PREDICTED: ethylene-responsive transcription...  93.6    2e-19   Eucalyptus grandis [rose gum]
ref|XP_010037500.1|  PREDICTED: ethylene-responsive transcription...  93.6    2e-19   Eucalyptus grandis [rose gum]
ref|XP_010469440.1|  PREDICTED: ethylene-responsive transcription...  92.8    2e-19   Camelina sativa [gold-of-pleasure]
gb|EPS68061.1|  hypothetical protein M569_06713                       90.9    2e-19   Genlisea aurea
ref|XP_010682636.1|  PREDICTED: ethylene-responsive transcription...  93.6    3e-19   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010682635.1|  PREDICTED: ethylene-responsive transcription...  93.6    3e-19   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004515403.1|  PREDICTED: ethylene-responsive transcription...  92.4    3e-19   Cicer arietinum [garbanzo]
ref|XP_010413824.1|  PREDICTED: ethylene-responsive transcription...  91.7    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009373701.1|  PREDICTED: ethylene-responsive transcription...  92.4    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_004142046.1|  PREDICTED: uncharacterized protein LOC101207587  92.4    8e-19   Cucumis sativus [cucumbers]
ref|XP_008440983.1|  PREDICTED: ethylene-responsive transcription...  92.4    8e-19   Cucumis melo [Oriental melon]
emb|CDY17191.1|  BnaA05g09970D                                        91.3    8e-19   Brassica napus [oilseed rape]
emb|CDY27952.1|  BnaCnng05370D                                        90.9    8e-19   Brassica napus [oilseed rape]
ref|XP_002452171.1|  hypothetical protein SORBIDRAFT_04g021160        91.7    9e-19   Sorghum bicolor [broomcorn]
ref|NP_180927.1|  ethylene-responsive transcription factor ERF112     90.9    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296339.1|  hypothetical protein CARUB_v10025511mg           90.9    9e-19   Capsella rubella
ref|NP_001189669.1|  ethylene-responsive transcription factor ERF112  91.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027738.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010027737.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010027739.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-18   Eucalyptus grandis [rose gum]
gb|KDO57151.1|  hypothetical protein CISIN_1g039390mg                 91.3    1e-18   Citrus sinensis [Valencia orange]
gb|EEE57097.1|  hypothetical protein OsJ_06940                        92.4    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010513072.1|  PREDICTED: ethylene-responsive transcription...  91.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002881295.1|  AP2 domain-containing transcription factor f...  90.1    2e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_006427894.1|  hypothetical protein CICLE_v10026032mg           91.3    2e-18   Citrus clementina
ref|XP_009143835.1|  PREDICTED: ethylene-responsive transcription...  90.1    2e-18   Brassica rapa
ref|XP_006464539.1|  PREDICTED: ethylene-responsive transcription...  91.3    2e-18   Citrus sinensis [Valencia orange]
ref|XP_007137573.1|  hypothetical protein PHAVU_009G137900g           90.9    2e-18   Phaseolus vulgaris [French bean]
gb|KDP35295.1|  hypothetical protein JCGZ_09454                       90.9    2e-18   Jatropha curcas
ref|XP_006464540.1|  PREDICTED: ethylene-responsive transcription...  91.3    2e-18   Citrus sinensis [Valencia orange]
ref|XP_006410514.1|  hypothetical protein EUTSA_v10017235mg           89.7    2e-18   Eutrema salsugineum
gb|EPS73412.1|  hypothetical protein M569_01357                       90.5    2e-18   Genlisea aurea
ref|XP_010680295.1|  PREDICTED: ethylene-responsive transcription...  91.3    3e-18   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010025536.1|  PREDICTED: ethylene-responsive transcription...  90.5    3e-18   Eucalyptus grandis [rose gum]
dbj|BAG50064.1|  transcription factor AP2-EREBP                       91.7    3e-18   Lotus japonicus
gb|KHN09568.1|  Ethylene-responsive transcription factor ERF114       90.5    3e-18   Glycine soja [wild soybean]
ref|XP_011464560.1|  PREDICTED: ethylene-responsive transcription...  90.5    3e-18   Fragaria vesca subsp. vesca
ref|XP_011025557.1|  PREDICTED: ethylene-responsive transcription...  90.5    4e-18   Populus euphratica
ref|XP_010096464.1|  Ethylene-responsive transcription factor         90.1    4e-18   Morus notabilis
ref|XP_006581744.1|  PREDICTED: ethylene-responsive transcription...  89.4    5e-18   
ref|XP_003523249.1|  PREDICTED: ethylene-responsive transcription...  89.7    5e-18   Glycine max [soybeans]
ref|XP_003528031.1|  PREDICTED: ethylene-responsive transcription...  89.7    5e-18   Glycine max [soybeans]
ref|XP_011101230.1|  PREDICTED: ethylene-responsive transcription...  90.9    5e-18   Sesamum indicum [beniseed]
ref|XP_001764298.1|  predicted protein                                85.1    6e-18   Physcomitrella patens
gb|EAY86070.1|  hypothetical protein OsI_07439                        89.4    6e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_009408302.1|  PREDICTED: ethylene-responsive transcription...  89.0    6e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002532770.1|  DNA binding protein, putative                    90.1    6e-18   Ricinus communis
dbj|BAG50063.1|  transcription factor AP2-EREBP                       89.0    6e-18   Lotus japonicus
ref|XP_004288079.1|  PREDICTED: ethylene-responsive transcription...  90.1    6e-18   Fragaria vesca subsp. vesca
ref|XP_011090449.1|  PREDICTED: ethylene-responsive transcription...  90.1    7e-18   Sesamum indicum [beniseed]
ref|XP_009777817.1|  PREDICTED: ethylene-responsive transcription...  89.7    7e-18   Nicotiana sylvestris
ref|XP_009777818.1|  PREDICTED: ethylene-responsive transcription...  89.7    8e-18   Nicotiana sylvestris
ref|XP_001773250.1|  predicted protein                                84.3    8e-18   Physcomitrella patens
ref|XP_002310625.2|  hypothetical protein POPTR_0007s07090g           89.4    8e-18   Populus trichocarpa [western balsam poplar]
ref|XP_007151985.1|  hypothetical protein PHAVU_004G092100g           90.5    9e-18   Phaseolus vulgaris [French bean]
ref|XP_009777819.1|  PREDICTED: ethylene-responsive transcription...  89.4    9e-18   Nicotiana sylvestris
emb|CDY53788.1|  BnaC04g44080D                                        87.8    9e-18   Brassica napus [oilseed rape]
ref|XP_009589948.1|  PREDICTED: ethylene-responsive transcription...  89.7    1e-17   Nicotiana tomentosiformis
gb|KHN00748.1|  Ethylene-responsive transcription factor ERF112       89.4    1e-17   Glycine soja [wild soybean]
ref|XP_010681129.1|  PREDICTED: ethylene-responsive transcription...  90.5    1e-17   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EAZ19774.1|  hypothetical protein OsJ_35354                        88.6    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KHN41295.1|  Ethylene-responsive transcription factor ERF112       89.4    1e-17   Glycine soja [wild soybean]
ref|XP_009777816.1|  PREDICTED: ethylene-responsive transcription...  89.7    1e-17   Nicotiana sylvestris
ref|XP_003602514.1|  Ethylene-responsive transcription factor ERF110  89.0    1e-17   Medicago truncatula
ref|XP_010314475.1|  PREDICTED: ethylene-responsive transcription...  88.6    1e-17   Solanum lycopersicum
ref|XP_010527318.1|  PREDICTED: ethylene-responsive transcription...  87.8    1e-17   Tarenaya hassleriana [spider flower]
gb|AJK26923.1|  ethylene response factor protein 3                    89.0    2e-17   Betula platyphylla [Asian white birch]
gb|ABY57638.1|  RAP2.6-like protein                                   89.0    2e-17   Solanum lycopersicum
ref|XP_009112156.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-17   Brassica rapa
ref|XP_006363442.1|  PREDICTED: ethylene-responsive transcription...  89.7    2e-17   Solanum tuberosum [potatoes]
ref|XP_009420504.1|  PREDICTED: ethylene-responsive transcription...  88.2    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006599482.1|  PREDICTED: ethylene-responsive transcription...  89.7    2e-17   
ref|XP_010026922.1|  PREDICTED: ethylene-responsive transcription...  86.7    2e-17   Eucalyptus grandis [rose gum]
ref|XP_004503061.1|  PREDICTED: ethylene-responsive transcription...  88.2    2e-17   Cicer arietinum [garbanzo]
ref|XP_006599481.1|  PREDICTED: ethylene-responsive transcription...  89.7    2e-17   
ref|NP_001066252.1|  Os12g0168100                                     88.2    2e-17   
ref|XP_010314474.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-17   
ref|XP_004252593.1|  PREDICTED: ethylene-responsive transcription...  89.0    2e-17   
ref|XP_002307142.2|  hypothetical protein POPTR_0005s08940g           88.2    2e-17   
gb|AID51426.1|  ethylene response factor 21                           88.6    2e-17   
ref|XP_003548975.2|  PREDICTED: ethylene-responsive transcription...  89.4    2e-17   
ref|XP_004237817.1|  PREDICTED: ethylene-responsive transcription...  89.4    2e-17   
gb|KHN34033.1|  Ethylene-responsive transcription factor ERF114       88.2    3e-17   
gb|KFK31025.1|  hypothetical protein AALP_AA6G058200                  86.7    3e-17   
ref|XP_008372740.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  89.4    3e-17   
gb|ADZ28106.1|  ethylene response factor 3                            89.4    3e-17   
gb|AFI57747.1|  ethylene-responsive transcription factor ABR1         88.2    3e-17   
gb|AET34450.1|  ethylene response factor 110                          87.0    3e-17   
ref|NP_199819.3|  ethylene-responsive transcription factor ERF110     86.7    3e-17   
ref|XP_011021971.1|  PREDICTED: ethylene-responsive transcription...  87.8    3e-17   
emb|CAE45640.1|  putative AP2 domain transcription factor             86.7    3e-17   
ref|XP_011021969.1|  PREDICTED: ethylene-responsive transcription...  87.8    3e-17   
ref|XP_009411924.1|  PREDICTED: ethylene-responsive transcription...  88.2    3e-17   
dbj|BAB10294.1|  unnamed protein product                              86.7    3e-17   
gb|AAC49772.1|  AP2 domain containing protein RAP2.6                  85.5    3e-17   
ref|XP_011021970.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-17   
ref|XP_010500096.1|  PREDICTED: ethylene-responsive transcription...  86.3    4e-17   
ref|XP_003519981.2|  PREDICTED: ethylene-responsive transcription...  89.4    4e-17   
ref|XP_010500097.1|  PREDICTED: ethylene-responsive transcription...  86.3    4e-17   
ref|XP_010479000.1|  PREDICTED: ethylene-responsive transcription...  86.3    4e-17   
ref|NP_175008.1|  ethylene-responsive transcription factor RAP2-6     85.9    4e-17   
ref|XP_006574788.1|  PREDICTED: ethylene-responsive transcription...  89.4    4e-17   
ref|XP_001769698.1|  predicted protein                                84.3    4e-17   
ref|XP_009393416.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-17   
ref|XP_010478998.1|  PREDICTED: ethylene-responsive transcription...  86.3    4e-17   
gb|EYU31118.1|  hypothetical protein MIMGU_mgv1a008130mg              87.8    4e-17   
ref|XP_010062103.1|  PREDICTED: ethylene-responsive transcription...  88.2    4e-17   
ref|XP_010478999.1|  PREDICTED: ethylene-responsive transcription...  86.3    4e-17   
emb|CDX81250.1|  BnaC09g06610D                                        88.2    4e-17   
emb|CDY37698.1|  BnaA04g19700D                                        85.5    4e-17   
ref|XP_006361609.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-17   
ref|XP_007159794.1|  hypothetical protein PHAVU_002G267800g           87.0    4e-17   
ref|XP_006361610.1|  PREDICTED: ethylene-responsive transcription...  87.8    5e-17   
gb|EEC68921.1|  hypothetical protein OsI_37608                        87.4    5e-17   
gb|EPS64637.1|  hypothetical protein M569_10144                       86.3    5e-17   
ref|XP_006427893.1|  hypothetical protein CICLE_v10026052mg           87.0    5e-17   
gb|KDO57153.1|  hypothetical protein CISIN_1g020801mg                 87.0    5e-17   
gb|KDO57152.1|  hypothetical protein CISIN_1g020801mg                 87.0    5e-17   
ref|XP_001758105.1|  predicted protein                                82.8    5e-17   
ref|XP_009141338.1|  PREDICTED: ethylene-responsive transcription...  85.9    6e-17   
ref|XP_006464861.1|  PREDICTED: ethylene-responsive transcription...  87.0    6e-17   
ref|XP_010520153.1|  PREDICTED: ethylene-responsive transcription...  87.4    7e-17   
ref|XP_006304255.1|  hypothetical protein CARUB_v10010478mg           84.7    7e-17   
ref|XP_004978318.1|  PREDICTED: ethylene-responsive transcription...  86.3    8e-17   
ref|XP_011044262.1|  PREDICTED: ethylene-responsive transcription...  87.8    8e-17   
ref|XP_004503984.1|  PREDICTED: ethylene-responsive transcription...  85.5    8e-17   
ref|XP_011044263.1|  PREDICTED: ethylene-responsive transcription...  87.8    9e-17   
ref|XP_010546448.1|  PREDICTED: ethylene-responsive transcription...  87.0    9e-17   
gb|AGE92355.1|  ethylene response factor 1                            86.7    9e-17   
ref|XP_003630161.1|  Ethylene-responsive transcription factor         86.3    1e-16   
gb|KCW54328.1|  hypothetical protein EUGRSUZ_I00292                   84.3    1e-16   
ref|XP_002306712.2|  AP2 domain-containing transcription factor f...  87.4    1e-16   
ref|XP_001779530.1|  predicted protein                                81.3    1e-16   
ref|XP_008454945.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-16   
ref|XP_001771353.1|  predicted protein                                80.9    2e-16   
gb|ACF84395.1|  unknown                                               84.7    2e-16   
ref|NP_001143036.1|  uncharacterized protein LOC100275504             84.7    2e-16   
gb|KJB48436.1|  hypothetical protein B456_008G075600                  83.6    2e-16   
gb|AGE97364.1|  ethylene response factor 9                            87.4    3e-16   
emb|CBI32415.3|  unnamed protein product                              84.3    3e-16   
gb|KHN29138.1|  Ethylene-responsive transcription factor ERF114       84.3    3e-16   
gb|KJB32377.1|  hypothetical protein B456_005G238000                  84.3    4e-16   
gb|ACU19933.1|  unknown                                               84.0    4e-16   
ref|XP_002968099.1|  hypothetical protein SELMODRAFT_73177            79.7    5e-16   
ref|XP_008654680.1|  PREDICTED: uncharacterized protein LOC100275...  84.7    5e-16   
gb|ABP35524.1|  AP2/EREBP-type transcription factor                   84.3    5e-16   
ref|XP_009405265.1|  PREDICTED: ethylene-responsive transcription...  84.0    6e-16   
gb|AHB33877.1|  ERF transcription factor 06                           83.6    7e-16   
ref|XP_010231329.1|  PREDICTED: ethylene-responsive transcription...  82.8    8e-16   
ref|XP_009417035.1|  PREDICTED: ethylene-responsive transcription...  83.2    8e-16   
ref|XP_009407011.1|  PREDICTED: ethylene-responsive transcription...  82.8    8e-16   
ref|XP_009365682.1|  PREDICTED: ethylene-responsive transcription...  83.2    8e-16   
gb|AES92926.1|  transcription factor ERF1                             83.6    8e-16   
ref|XP_004974033.1|  PREDICTED: ethylene-responsive transcription...  82.8    8e-16   
ref|XP_011079396.1|  PREDICTED: ethylene-responsive transcription...  84.3    9e-16   
ref|XP_002442881.1|  hypothetical protein SORBIDRAFT_08g004260        84.7    9e-16   
ref|XP_007047243.1|  AP2/ERF domain-containing transcription fact...  82.4    1e-15   
ref|NP_001235751.1|  uncharacterized protein LOC100527415             81.6    1e-15   
ref|XP_010269994.1|  PREDICTED: ethylene-responsive transcription...  82.8    1e-15   
gb|KHN02940.1|  Ethylene-responsive transcription factor RAP2-3       81.3    1e-15   
ref|XP_004235847.1|  PREDICTED: ethylene-responsive transcription...  82.4    1e-15   
gb|AHA93906.1|  ethylene response factor 3                            84.0    1e-15   
ref|XP_011088263.1|  PREDICTED: ethylene-responsive transcription...  82.8    1e-15   
ref|XP_010227136.1|  PREDICTED: ethylene-responsive transcription...  82.4    1e-15   
gb|KJB79317.1|  hypothetical protein B456_013G043700                  82.4    1e-15   
emb|CDP15674.1|  unnamed protein product                              82.8    1e-15   
ref|XP_004166670.1|  PREDICTED: ethylene-responsive transcription...  81.3    2e-15   
ref|XP_006341471.1|  PREDICTED: ethylene-responsive transcription...  82.4    2e-15   
dbj|BAK03348.1|  predicted protein                                    81.6    2e-15   
gb|AFW78172.1|  putative AP2/EREBP transcription factor superfami...  82.4    2e-15   
ref|XP_009375704.1|  PREDICTED: ethylene-responsive transcription...  82.0    2e-15   
gb|AJK26922.1|  ethylene response factor protein 2                    81.6    2e-15   
ref|XP_007042425.1|  Redox responsive transcription factor 1, put...  82.4    2e-15   
ref|XP_008649697.1|  PREDICTED: ethylene-responsive transcription...  82.8    2e-15   
ref|XP_002460334.1|  hypothetical protein SORBIDRAFT_02g026630        82.0    2e-15   
ref|XP_008340012.1|  PREDICTED: ethylene-responsive transcription...  80.9    2e-15   
ref|XP_011000462.1|  PREDICTED: ethylene-responsive transcription...  81.6    2e-15   
gb|KDP42285.1|  hypothetical protein JCGZ_01609                       81.6    3e-15   
ref|XP_002313851.1|  hypothetical protein POPTR_0009s10470g           81.6    3e-15   
ref|XP_007156515.1|  hypothetical protein PHAVU_003G292400g           81.3    3e-15   
ref|XP_004137113.1|  PREDICTED: ethylene-responsive transcription...  81.3    3e-15   
ref|XP_010238677.1|  PREDICTED: ethylene-responsive transcription...  81.6    3e-15   
gb|AGN90956.1|  ethylene-responsive transcription factor 10           81.3    3e-15   
ref|XP_002445794.1|  hypothetical protein SORBIDRAFT_07g025843        81.3    3e-15   
ref|XP_002990228.1|  hypothetical protein SELMODRAFT_131245           77.8    3e-15   
ref|XP_004974032.1|  PREDICTED: ethylene-responsive transcription...  82.0    4e-15   
ref|XP_004985469.1|  PREDICTED: ethylene-responsive transcription...  81.6    4e-15   
ref|XP_008670238.1|  PREDICTED: ethylene-responsive transcription...  81.3    4e-15   
gb|KJB47408.1|  hypothetical protein B456_008G025100                  81.3    4e-15   
ref|XP_009417624.1|  PREDICTED: ethylene-responsive transcription...  79.3    5e-15   
ref|XP_004505214.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-15   
emb|CDO97803.1|  unnamed protein product                              82.4    5e-15   
gb|AHA93905.1|  ethylene response factor 5                            82.4    5e-15   
ref|XP_010263553.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-15   
gb|AFP49821.1|  ethylene responsive transcription factor 6            80.1    5e-15   
ref|XP_004957315.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-15   
ref|XP_002282169.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-15   
gb|AEQ58798.1|  ethylene response factor                              80.1    5e-15   
ref|XP_010026297.1|  PREDICTED: ethylene-responsive transcription...  80.5    6e-15   
gb|AGE92354.1|  ethylene response factor 2                            80.9    6e-15   
gb|KCW59032.1|  hypothetical protein EUGRSUZ_H01659                   80.5    6e-15   
ref|XP_006423025.1|  hypothetical protein CICLE_v10028930mg           80.9    6e-15   
ref|XP_006487104.1|  PREDICTED: ethylene-responsive transcription...  80.9    6e-15   
ref|XP_010068468.1|  PREDICTED: ethylene-responsive transcription...  80.5    7e-15   
ref|XP_004289221.1|  PREDICTED: ethylene-responsive transcription...  80.1    7e-15   
dbj|BAJ93265.1|  predicted protein                                    80.9    7e-15   
ref|XP_009587851.1|  PREDICTED: ethylene-responsive transcription...  79.7    7e-15   
ref|XP_009772463.1|  PREDICTED: ethylene-responsive transcription...  80.1    7e-15   
ref|XP_009587871.1|  PREDICTED: ethylene-responsive transcription...  80.1    7e-15   
ref|XP_002453961.1|  hypothetical protein SORBIDRAFT_04g022245        80.5    7e-15   
ref|XP_010098462.1|  Ethylene-responsive transcription factor         80.1    8e-15   
gb|EYU21280.1|  hypothetical protein MIMGU_mgv1a008553mg              81.3    8e-15   
ref|XP_004957018.1|  PREDICTED: ethylene-responsive transcription...  80.1    8e-15   
gb|AHA93901.1|  ethylene response factor 2                            80.5    9e-15   
ref|XP_002960908.1|  hypothetical protein SELMODRAFT_73854            76.3    9e-15   
ref|XP_007038272.1|  AP2/ERF domain-containing transcription fact...  80.1    1e-14   
ref|XP_009609381.1|  PREDICTED: ethylene-responsive transcription...  80.1    1e-14   
ref|XP_010107942.1|  Ethylene-responsive transcription factor         80.1    1e-14   
gb|EPS64992.1|  hypothetical protein M569_09787                       79.3    1e-14   
dbj|BAJ92553.1|  predicted protein                                    79.7    1e-14   
gb|ACU23153.1|  unknown                                               79.7    1e-14   
gb|EYU20175.1|  hypothetical protein MIMGU_mgv1a010816mg              80.1    1e-14   
ref|XP_008241498.1|  PREDICTED: ethylene-responsive transcription...  79.7    1e-14   
ref|NP_001147356.1|  AP2 domain containing protein                    79.7    1e-14   
ref|XP_006604931.1|  PREDICTED: ethylene-responsive transcription...  79.7    1e-14   
ref|XP_004954977.1|  PREDICTED: ethylene-responsive transcription...  79.3    1e-14   
gb|KCW55217.1|  hypothetical protein EUGRSUZ_I01153                   79.3    2e-14   
gb|AGE97363.1|  ethylene response factor 8                            79.3    2e-14   
ref|XP_011006490.1|  PREDICTED: ethylene-responsive transcription...  79.3    2e-14   
ref|XP_010057374.1|  PREDICTED: ethylene-responsive transcription...  79.3    2e-14   
gb|KEH30912.1|  AP2/ERF domain transcription factor                   78.6    2e-14   
ref|XP_006384411.1|  hypothetical protein POPTR_0004s14840g           79.3    2e-14   
ref|XP_009367028.1|  PREDICTED: ethylene-responsive transcription...  79.0    2e-14   
ref|XP_009150111.1|  PREDICTED: ethylene-responsive transcription...  79.0    2e-14   
gb|ADP37420.1|  ethylene-responsive-element-binding factor 5          79.0    2e-14   
ref|XP_006388237.1|  hypothetical protein POPTR_0270s00200g           79.0    2e-14   
gb|EYU45910.1|  hypothetical protein MIMGU_mgv1a009975mg              79.7    2e-14   
emb|CAC12822.1|  AP2 domain-containing transcription factor           78.6    2e-14   
ref|XP_002518767.1|  hypothetical protein RCOM_0813580                79.3    2e-14   
ref|XP_008236506.1|  PREDICTED: ethylene-responsive transcription...  79.0    2e-14   
ref|XP_007204172.1|  hypothetical protein PRUPE_ppa017002mg           79.0    2e-14   
ref|XP_006841505.1|  hypothetical protein AMTR_s00003p00135920        79.3    2e-14   
gb|AFP49820.1|  ethylene responsive transcription factor 6            78.6    2e-14   
ref|XP_010317277.1|  PREDICTED: ethylene-responsive transcription...  78.2    2e-14   
gb|AFB35653.1|  ERF8                                                  78.6    3e-14   
ref|XP_008666509.1|  PREDICTED: ethylene-responsive transcription...  79.0    3e-14   
gb|ABO09809.1|  EREB                                                  80.1    3e-14   
tpg|DAA48287.1|  TPA: putative AP2/EREBP transcription factor sup...  77.4    3e-14   
gb|AHA93911.1|  ethylene response factor 12                           78.6    3e-14   
ref|XP_004230791.1|  PREDICTED: ethylene-responsive transcription...  79.0    3e-14   
ref|XP_009597158.1|  PREDICTED: ethylene-responsive transcription...  78.6    3e-14   
ref|XP_007199307.1|  hypothetical protein PRUPE_ppa023235mg           78.6    3e-14   
ref|XP_010030650.1|  PREDICTED: uncharacterized protein LOC104420521  80.9    3e-14   
gb|AES90174.2|  AP2/ERF domain transcription factor                   78.2    3e-14   
ref|XP_007038275.1|  AP2/ERF domain-containing transcription fact...  78.6    3e-14   
ref|XP_002460502.1|  hypothetical protein SORBIDRAFT_02g029550        78.2    3e-14   
gb|KEH25639.1|  AP2 domain class transcription factor                 78.2    3e-14   
gb|AIU05286.1|  EREBP-like factor                                     78.6    3e-14   
dbj|BAG50061.1|  transcription factor AP2-EREBP                       78.2    3e-14   
ref|XP_007139636.1|  hypothetical protein PHAVU_008G046400g           77.8    3e-14   
ref|XP_006660332.1|  PREDICTED: uncharacterized protein LOC102713488  80.9    3e-14   
ref|XP_006346432.1|  PREDICTED: ethylene-responsive transcription...  78.6    3e-14   
ref|XP_009803667.1|  PREDICTED: ethylene-responsive transcription...  78.6    3e-14   
ref|XP_003607983.1|  Ethylene responsive transcription factor 2b      78.2    3e-14   
ref|XP_009609421.1|  PREDICTED: ethylene-responsive transcription...  79.0    4e-14   
ref|XP_004294810.1|  PREDICTED: ethylene-responsive transcription...  78.6    4e-14   
gb|ADE41151.1|  AP2 domain class transcription factor                 78.2    4e-14   
emb|CDP05379.1|  unnamed protein product                              79.0    4e-14   
gb|AFK39816.1|  unknown                                               78.2    4e-14   
ref|XP_004294809.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
ref|XP_003607980.1|  Ethylene responsive transcription factor 2a      77.8    4e-14   
ref|XP_003638741.1|  Ethylene-responsive transcription factor         77.8    4e-14   
ref|XP_011072679.1|  PREDICTED: ethylene-responsive transcription...  79.7    4e-14   
gb|KJB25504.1|  hypothetical protein B456_004G195000                  78.2    4e-14   
ref|XP_008347410.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
dbj|BAA97381.1|  unnamed protein product                              78.2    4e-14   
gb|AID51425.1|  ethylene response factor 20                           77.8    4e-14   
ref|XP_010939424.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
ref|XP_010507879.1|  PREDICTED: ethylene-responsive transcription...  77.0    4e-14   
ref|XP_010482454.1|  PREDICTED: ethylene-responsive transcription...  77.8    4e-14   
ref|XP_006349648.1|  PREDICTED: ethylene-responsive transcription...  77.4    4e-14   
ref|XP_011022363.1|  PREDICTED: ethylene-responsive transcription...  77.8    4e-14   
ref|XP_011092575.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
gb|KJB40081.1|  hypothetical protein B456_007G046000                  77.8    4e-14   
gb|KJB25506.1|  hypothetical protein B456_004G195200                  78.2    5e-14   
gb|AIA57937.1|  ethylene responsive element binding factor            78.2    5e-14   
gb|AEQ93555.1|  AP2/ERF transcription factor                          77.4    5e-14   
gb|KDP22468.1|  hypothetical protein JCGZ_26299                       78.2    5e-14   
gb|EPS68207.1|  hypothetical protein M569_06565                       79.3    5e-14   
ref|XP_008784363.1|  PREDICTED: ethylene-responsive transcription...  79.3    5e-14   
ref|XP_008652886.1|  PREDICTED: ethylene-responsive transcription...  77.8    5e-14   
gb|EYU37678.1|  hypothetical protein MIMGU_mgv1a010618mg              78.2    5e-14   
gb|KFK39991.1|  hypothetical protein AALP_AA3G315900                  77.0    5e-14   
emb|CDP18985.1|  unnamed protein product                              77.8    5e-14   
dbj|BAK06359.1|  predicted protein                                    78.2    5e-14   
gb|AFP90336.1|  transcription factor 3                                77.4    5e-14   



>ref|XP_011086884.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X1 [Sesamum indicum]
Length=255

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+  V++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYDEAAL+FKGSKA
Sbjct  54   DQATVKKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDEAALRFKGSKA  113

Query  126  KLNFPERVQGKTELRYV  76
            KLNFPERVQG+TELRYV
Sbjct  114  KLNFPERVQGRTELRYV  130



>ref|XP_011086885.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X2 [Sesamum indicum]
Length=229

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  318  ILCFDKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFK  139
             +   +  V++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYDEAAL+FK
Sbjct  24   CMVLMEATVKKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDEAALRFK  83

Query  138  GSKAKLNFPERVQGKTELRYV  76
            GSKAKLNFPERVQG+TELRYV
Sbjct  84   GSKAKLNFPERVQGRTELRYV  104



>ref|XP_011086886.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X3 [Sesamum indicum]
Length=215

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
            V++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYDEAAL+FKGSKAKLNF
Sbjct  18   VKKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDEAALRFKGSKAKLNF  77

Query  114  PERVQGKTELRYV  76
            PERVQG+TELRYV
Sbjct  78   PERVQGRTELRYV  90



>ref|XP_010250515.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Nelumbo 
nucifera]
Length=242

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNV-RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN  RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYD+AALKFKG+K
Sbjct  45   DQGNSSRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAVAYDQAALKFKGTK  104

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQG+TEL Y
Sbjct  105  AKLNFPERVQGRTELSY  121



>ref|XP_009421022.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Musa acuminata subsp. malaccensis]
Length=227

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -2

Query  315  LCFDKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKG  136
            +  ++G VRRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG
Sbjct  45   ISEEQGTVRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAVAYDEAALRFKG  104

Query  135  SKAKLNFPERVQGKTELRYV  76
            SKAKLNFP+RVQG+ EL ++
Sbjct  105  SKAKLNFPQRVQGRAELSFL  124



>ref|XP_002511085.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF51687.1| DNA binding protein, putative [Ricinus communis]
Length=230

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AALAYDEAAL+FKGSK
Sbjct  45   DQGNVRRRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEAAALAYDEAALRFKGSK  104

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG++EL Y+
Sbjct  105  AKLNFPERVQGRSELGYL  122



>gb|AFD52632.1| AP2/ERF transcription factor [Jatropha curcas]
 gb|KDP23262.1| hypothetical protein JCGZ_23095 [Jatropha curcas]
Length=252

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = -2

Query  312  CFDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKG  136
              D+ N RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AALKFKG
Sbjct  45   TLDQENTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAALKFKG  104

Query  135  SKAKLNFPERVQGKTELRY  79
            +KAKLNFPERVQGK E  Y
Sbjct  105  TKAKLNFPERVQGKPEFSY  123



>ref|XP_010929690.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Elaeis 
guineensis]
Length=234

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYDEAAL+FKG+K
Sbjct  57   EQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEQAAIAYDEAALRFKGTK  116

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG+T+L ++
Sbjct  117  AKLNFPERVQGRTDLGFL  134



>ref|XP_011020891.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Populus euphratica]
Length=236

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ N RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYD+AALKFKG+K
Sbjct  46   DQENTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAVAYDKAALKFKGTK  105

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQGKTE  Y
Sbjct  106  AKLNFPERVQGKTEFGY  122



>emb|CBI15759.3| unnamed protein product [Vitis vinifera]
Length=134

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 2/82 (2%)
 Frame = -2

Query  315  LCFDKGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            L  D+GN   RRHYRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAEDAALAYDEAAL+F
Sbjct  44   LLQDQGNQLRRRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEDAALAYDEAALRF  103

Query  141  KGSKAKLNFPERVQGKTELRYV  76
            KG+KAKLNFPERVQG++EL Y+
Sbjct  104  KGNKAKLNFPERVQGRSELGYL  125



>ref|XP_008791015.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Phoenix dactylifera]
Length=196

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G VRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYDEAAL+FKG+K
Sbjct  19   DQGTVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEQAAIAYDEAALRFKGTK  78

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG+T+L ++
Sbjct  79   AKLNFPERVQGRTDLGFL  96



>ref|XP_008356833.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Malus domestica]
Length=312

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 74/79 (94%), Gaps = 2/79 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AA++YDEAAL+FKGSK
Sbjct  110  DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAAISYDEAALRFKGSK  169

Query  129  AKLNFPERVQGK-TELRYV  76
            AKLNFPERVQG+ TEL Y+
Sbjct  170  AKLNFPERVQGRITELGYL  188



>ref|XP_002512669.1| AP2 domain transcription factor RAP2.3, putative [Ricinus communis]
 gb|EEF50121.1| AP2 domain transcription factor RAP2.3, putative [Ricinus communis]
Length=249

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ N RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AALKFKG+K
Sbjct  48   DQENTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAALKFKGTK  107

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQGK E  Y
Sbjct  108  AKLNFPERVQGKPEFSY  124



>ref|XP_002304640.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|EEE79619.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=234

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ N RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYD+AALKFKG+K
Sbjct  46   DQENTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAVAYDKAALKFKGTK  105

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQG+TE  Y
Sbjct  106  AKLNFPERVQGRTEFGY  122



>ref|XP_006420792.1| hypothetical protein CICLE_v10005787mg [Citrus clementina]
 gb|ESR34032.1| hypothetical protein CICLE_v10005787mg [Citrus clementina]
Length=232

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +G  RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD+AALKFKG+KAK
Sbjct  48   EGTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAMAYDKAALKFKGTKAK  107

Query  123  LNFPERVQGKTELRYV  76
            LNFPERVQG TE  Y+
Sbjct  108  LNFPERVQGTTEFVYL  123



>ref|XP_006487554.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
isoform X1 [Citrus sinensis]
Length=234

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +G  RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD+AALKFKG+KAK
Sbjct  50   EGTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAMAYDKAALKFKGTKAK  109

Query  123  LNFPERVQGKTELRYV  76
            LNFPERVQG TE  Y+
Sbjct  110  LNFPERVQGTTEFVYL  125



>ref|XP_009339034.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Pyrus x bretschneideri]
Length=269

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 2/79 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSK
Sbjct  66   DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSK  125

Query  129  AKLNFPERVQGK-TELRYV  76
            AKLNFPERVQG+ TEL Y+
Sbjct  126  AKLNFPERVQGRITELGYL  144



>ref|XP_007038155.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY22656.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=296

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSK
Sbjct  104  DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSK  163

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG++EL Y+
Sbjct  164  AKLNFPERVQGRSELGYL  181



>ref|XP_006420791.1| hypothetical protein CICLE_v10005787mg [Citrus clementina]
 gb|ESR34031.1| hypothetical protein CICLE_v10005787mg [Citrus clementina]
Length=231

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  300  GNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKL  121
            G  RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD+AALKFKG+KAKL
Sbjct  48   GTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAMAYDKAALKFKGTKAKL  107

Query  120  NFPERVQGKTELRYV  76
            NFPERVQG TE  Y+
Sbjct  108  NFPERVQGTTEFVYL  122



>ref|XP_006487555.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
isoform X2 [Citrus sinensis]
Length=233

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  300  GNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKL  121
            G  RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD+AALKFKG+KAKL
Sbjct  50   GTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAMAYDKAALKFKGTKAKL  109

Query  120  NFPERVQGKTELRYV  76
            NFPERVQG TE  Y+
Sbjct  110  NFPERVQGTTEFVYL  124



>gb|ADJ67443.1| ethylene response factor 14 [Actinidia deliciosa]
Length=235

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNV-RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNV +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYDEAAL+FKG+K
Sbjct  27   DQGNVGKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDEAALRFKGTK  86

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPE+VQ KTE  Y+
Sbjct  87   AKLNFPEKVQAKTEYAYL  104



>ref|XP_010663806.1| PREDICTED: ethylene-responsive transcription factor ERF114, partial 
[Vitis vinifera]
Length=306

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 2/82 (2%)
 Frame = -2

Query  315  LCFDKGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            L  D+GN   RRHYRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAEDAALAYDEAAL+F
Sbjct  104  LLQDQGNQLRRRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEDAALAYDEAALRF  163

Query  141  KGSKAKLNFPERVQGKTELRYV  76
            KG+KAKLNFPERVQG++EL Y+
Sbjct  164  KGNKAKLNFPERVQGRSELGYL  185



>gb|EPS59400.1| hypothetical protein M569_15408 [Genlisea aurea]
Length=201

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +G  R+HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE+AA+AYDEAAL+FKGSKAK
Sbjct  26   QGISRKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEEAAVAYDEAALRFKGSKAK  85

Query  123  LNFPERVQGK-TELRYV  76
            LNFPERVQG+ TELRY+
Sbjct  86   LNFPERVQGETTELRYL  102



>gb|KDO58152.1| hypothetical protein CISIN_1g043184mg, partial [Citrus sinensis]
Length=270

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +G  RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD+AALKFKG+KAK
Sbjct  86   EGTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAMAYDKAALKFKGTKAK  145

Query  123  LNFPERVQGKTELRYV  76
            LNFPERVQG TE  Y+
Sbjct  146  LNFPERVQGTTEFVYL  161



>gb|EYU28473.1| hypothetical protein MIMGU_mgv1a024534mg [Erythranthe guttata]
Length=260

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 2/79 (3%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+G V++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYDEAALKFKGSKA
Sbjct  36   DQGGVKKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDEAALKFKGSKA  95

Query  126  KLNFPER-VQGK-TELRYV  76
            KLNFPER VQG  T+LRY+
Sbjct  96   KLNFPERVVQGNTTQLRYL  114



>ref|XP_010667007.1| PREDICTED: ethylene-responsive transcription factor ERF114 [Beta 
vulgaris subsp. vulgaris]
Length=313

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  360  HILQLRLIRTFFF*ILCFDKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTa  184
            HIL     +   F  L   +G+VR RHYRGVRQRPWGKWA+EIRDPKKAA VWLGTFDTA
Sbjct  77   HILHANQPQNLNFQPLETGQGDVRKRHYRGVRQRPWGKWASEIRDPKKAARVWLGTFDTA  136

Query  183  edaalaydeaaLKFKGSKAKLNFPERVQGK  94
            E AALAYDEAALKFKG+KAKLNFPERVQGK
Sbjct  137  EAAALAYDEAALKFKGNKAKLNFPERVQGK  166



>gb|EMT21523.1| Ethylene-responsive transcription factor ERF113 [Aegilops tauschii]
Length=135

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  50   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFP  109

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L +V
Sbjct  110  ERVQGRTDLGFV  121



>ref|XP_010100029.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXB81200.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=271

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 1/72 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AALKFKG+K
Sbjct  53   DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAALKFKGTK  112

Query  129  AKLNFPERVQGK  94
            AKLNFPERVQGK
Sbjct  113  AKLNFPERVQGK  124



>ref|XP_010249458.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Nelumbo 
nucifera]
Length=329

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYDEAALKFKG+K
Sbjct  131  DQGNSRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAESAAIAYDEAALKFKGTK  190

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG+T L  V
Sbjct  191  AKLNFPERVQGRTGLGCV  208



>gb|KJB31601.1| hypothetical protein B456_005G197100 [Gossypium raimondii]
Length=233

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ N R RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD AALKFKG+K
Sbjct  41   DQENTRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDRAALKFKGTK  100

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG  E+ Y+
Sbjct  101  AKLNFPERVQGNREVSYL  118



>ref|XP_007043782.1| AP2 6l, putative [Theobroma cacao]
 gb|EOX99613.1| AP2 6l, putative [Theobroma cacao]
Length=362

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 79/117 (68%), Gaps = 11/117 (9%)
 Frame = -2

Query  429  DIELLCMKHFLIWYHYEMRGETEHILQLRLIRTFFF*ILCFDKGNVRRHYRGVRQRPWGK  250
            D E   M  FL  Y+            +  I      +   ++   RRHYRGVRQRPWGK
Sbjct  144  DQESETMSKFLDIYNL-----------VAFICDVMHWLSVCEENTRRRHYRGVRQRPWGK  192

Query  249  WAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPERVQGKTELRY  79
            WAAEIRDPKKAA VWLGTFDTAEDAALAYD AALKFKG+KAKLNFPERVQG TE+ Y
Sbjct  193  WAAEIRDPKKAARVWLGTFDTAEDAALAYDRAALKFKGTKAKLNFPERVQGNTEVSY  249



>gb|AJF23730.1| ethylene responsive element binding factor [Camellia sinensis]
Length=160

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKG+KAKLNFP
Sbjct  52   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEGAALAYDEAALRFKGNKAKLNFP  111

Query  111  ERVQGKTELRYV  76
            ERVQG+TEL Y+
Sbjct  112  ERVQGRTELGYL  123



>ref|XP_003602747.1| Ethylene-responsive transcription factor RAP2-6 [Medicago truncatula]
 gb|AES72998.1| AP2 domain class transcription factor [Medicago truncatula]
Length=261

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AA+AYDEAAL+FKGSK
Sbjct  67   DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAAVAYDEAALRFKGSK  126

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQ  TE  Y
Sbjct  127  AKLNFPERVQSATEFGY  143



>gb|AHA93913.1| ethylene response factor 15 [Coffea arabica]
Length=158

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GN RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKG+K
Sbjct  46   EQGNQRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGNK  105

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQGKTE  Y+
Sbjct  106  AKLNFPERVQGKTEYGYL  123



>ref|XP_009804195.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Nicotiana sylvestris]
Length=273

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYDEAALKFKG+KAKLNFP
Sbjct  67   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAIAYDEAALKFKGNKAKLNFP  126

Query  111  ERVQGKTELRYV  76
            ERVQGKTE  ++
Sbjct  127  ERVQGKTEFSFL  138



>ref|XP_008369624.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Malus 
domestica]
Length=244

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AALKFKG+KAKLNFP
Sbjct  53   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALKFKGTKAKLNFP  112

Query  111  ERVQGKTEL  85
            ERVQGKT+L
Sbjct  113  ERVQGKTDL  121



>ref|XP_008669488.1| PREDICTED: uncharacterized protein LOC103646542 [Zea mays]
 tpg|DAA38049.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
 gb|AIB04617.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=443

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  318  ILCFDKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFK  139
            +   ++  +RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FK
Sbjct  205  VAAEEEQGLRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFK  264

Query  138  GSKAKLNFPERVQGKTELRYV  76
            G+KAKLNFPERVQG+T+L +V
Sbjct  265  GTKAKLNFPERVQGRTDLGFV  285



>ref|XP_010942395.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Elaeis guineensis]
Length=232

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 75/78 (96%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GNVRR HYRGVRQRPWGKWAAEIRDP+KAA VWLGT++TAE+AA+AYDEAAL+FKG+K
Sbjct  54   EQGNVRRRHYRGVRQRPWGKWAAEIRDPRKAARVWLGTYNTAEEAAIAYDEAALRFKGTK  113

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG+T+L ++
Sbjct  114  AKLNFPERVQGRTDLGFL  131



>ref|XP_009405112.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 75/78 (96%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GNVRR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTFDTAEDAA+AYDEAAL+FKG+K
Sbjct  218  EQGNVRRRHYRGVRQRPWGKWAAEIRDPRKAARVWLGTFDTAEDAAVAYDEAALRFKGTK  277

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG+T+L ++
Sbjct  278  AKLNFPERVQGRTDLGFL  295



>tpg|DAA38048.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=445

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -2

Query  300  GNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKL  121
              +RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKL
Sbjct  213  AGLRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKL  272

Query  120  NFPERVQGKTELRYV  76
            NFPERVQG+T+L +V
Sbjct  273  NFPERVQGRTDLGFV  287



>ref|XP_011073204.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Sesamum 
indicum]
Length=263

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 3/80 (4%)
 Frame = -2

Query  306  DKGNV---RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKG  136
            ++GN    RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFD+AE AALAYDEAAL+FKG
Sbjct  54   EQGNANARRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDSAEAAALAYDEAALRFKG  113

Query  135  SKAKLNFPERVQGKTELRYV  76
            +KAKLNFPERVQG++EL Y+
Sbjct  114  NKAKLNFPERVQGRSELGYL  133



>ref|XP_009586804.1| PREDICTED: ethylene-responsive transcription factor ERF114-like, 
partial [Nicotiana tomentosiformis]
Length=338

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAALKFKG+KAKLNFP
Sbjct  127  KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALKFKGNKAKLNFP  186

Query  111  ERVQGKTELRYV  76
            ERVQGKTE  ++
Sbjct  187  ERVQGKTEFSFL  198



>ref|XP_010911409.1| PREDICTED: ethylene-responsive transcription factor ERF113-like, 
partial [Elaeis guineensis]
Length=198

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +G  R HYRGVRQRPWGKWAAEIRDPKKA  VWLGTFDTAEDAALAYDEAALKFKGSKAK
Sbjct  30   EGTQREHYRGVRQRPWGKWAAEIRDPKKATRVWLGTFDTAEDAALAYDEAALKFKGSKAK  89

Query  123  LNFPERVQGKTELRYV  76
            LNF ERVQG+ +L ++
Sbjct  90   LNFSERVQGRADLDFL  105



>dbj|BAJ99457.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  46   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFP  105

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L +V
Sbjct  106  ERVQGRTDLGFV  117



>ref|XP_006436961.1| hypothetical protein CICLE_v10032575mg [Citrus clementina]
 gb|ESR50201.1| hypothetical protein CICLE_v10032575mg [Citrus clementina]
Length=244

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKGSK
Sbjct  48   DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGSK  107

Query  129  AKLNFPERVQGK-TELRY  79
            AKLNFPERVQ   T  RY
Sbjct  108  AKLNFPERVQANLTTHRY  125



>ref|XP_002267814.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Vitis 
vinifera]
 emb|CBI29260.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 1/74 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AAL+FKG+K
Sbjct  44   DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDQAALRFKGTK  103

Query  129  AKLNFPERVQGKTE  88
            AKLNFPERVQ +T 
Sbjct  104  AKLNFPERVQQQTS  117



>emb|CDO98305.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GN RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKG+K
Sbjct  46   EQGNQRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGNK  105

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQGKTE  Y+
Sbjct  106  AKLNFPERVQGKTEYGYL  123



>ref|XP_009359875.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
isoform X2 [Pyrus x bretschneideri]
Length=249

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AALKFKG+KAKLNFP
Sbjct  53   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALKFKGTKAKLNFP  112

Query  111  ERVQGKTEL  85
            ERVQGKT+ 
Sbjct  113  ERVQGKTDF  121



>ref|XP_009390372.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Musa 
acuminata subsp. malaccensis]
Length=213

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFD AEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  50   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDRAEDAAMAYDEAALRFKGTKAKLNFP  109

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L ++
Sbjct  110  ERVQGRTDLGFL  121



>ref|NP_001052669.1| Os04g0398000 [Oryza sativa Japonica Group]
 emb|CAE05154.2| OSJNBa0039C07.10 [Oryza sativa Japonica Group]
 dbj|BAF14583.1| Os04g0398000 [Oryza sativa Japonica Group]
 dbj|BAG95092.1| unnamed protein product [Oryza sativa Japonica Group]
Length=268

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  64   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFP  123

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L ++
Sbjct  124  ERVQGRTDLGFL  135



>gb|EAY93947.1| hypothetical protein OsI_15721 [Oryza sativa Indica Group]
Length=269

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  65   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFP  124

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L ++
Sbjct  125  ERVQGRTDLGFL  136



>ref|XP_009390834.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Musa acuminata subsp. malaccensis]
Length=229

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDP+KAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  52   RRHYRGVRQRPWGKWAAEIRDPRKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFP  111

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L ++
Sbjct  112  ERVQGRTDLGFL  123



>gb|ACO55953.1| RAP2-like protein [Juglans nigra]
Length=226

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ N RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD AAL+FKG+K
Sbjct  49   DQENARRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALRFKGTK  108

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQG +E  Y
Sbjct  109  AKLNFPERVQGTSEFGY  125



>ref|XP_010105601.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXC05168.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=260

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = -2

Query  315  LCFDKGNVR-----RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaa  151
            L  D+GN R     RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTFDTAE AALAYDEAA
Sbjct  46   LQEDQGNTRSTITRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFDTAEAAALAYDEAA  105

Query  150  LKFKGSKAKLNFPERVQGKT  91
            L+FKGSKAKLNFPERVQG T
Sbjct  106  LRFKGSKAKLNFPERVQGGT  125



>ref|XP_008811102.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Phoenix dactylifera]
Length=212

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 74/78 (95%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GNVRR HYRGVRQRPWGKWAAEIRDP+KAA VWLGT++TAE+AA+AYDEAAL+FKG+K
Sbjct  35   EQGNVRRRHYRGVRQRPWGKWAAEIRDPRKAARVWLGTYNTAEEAAMAYDEAALRFKGTK  94

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQ +T+L ++
Sbjct  95   AKLNFPERVQARTDLGFL  112



>ref|XP_007223939.1| hypothetical protein PRUPE_ppa011097mg [Prunus persica]
 gb|EMJ25138.1| hypothetical protein PRUPE_ppa011097mg [Prunus persica]
Length=224

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AAL+FKG+KAKLNFP
Sbjct  54   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALRFKGTKAKLNFP  113

Query  111  ERVQGKTEL  85
            ERVQGKT+ 
Sbjct  114  ERVQGKTDF  122



>ref|XP_007032031.1| AP2/ERF domain-containing transcription factor-like protein isoform 
1 [Theobroma cacao]
 gb|EOY02957.1| AP2/ERF domain-containing transcription factor-like protein isoform 
1 [Theobroma cacao]
Length=270

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 2/72 (3%)
 Frame = -2

Query  306  DKGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGS  133
            D+GNV  +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AALKFKGS
Sbjct  44   DQGNVIRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAAAYDAAALKFKGS  103

Query  132  KAKLNFPERVQG  97
            KAKLNFPERVQG
Sbjct  104  KAKLNFPERVQG  115



>gb|AFW58120.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB04883.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=422

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  190  RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFP  249

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L ++
Sbjct  250  ERVQGRTDLGFL  261



>ref|XP_008390209.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Malus domestica]
 gb|ADE41119.1| AP2 domain class transcription factor [Malus domestica]
Length=245

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AAL+FKG+KAKLNFP
Sbjct  53   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALRFKGTKAKLNFP  112

Query  111  ERVQGKTEL  85
            ERVQGKT+ 
Sbjct  113  ERVQGKTDF  121



>ref|XP_006399824.1| hypothetical protein EUTSA_v10014575mg [Eutrema salsugineum]
 dbj|BAJ34121.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41277.1| hypothetical protein EUTSA_v10014575mg [Eutrema salsugineum]
Length=231

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  43   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  102

Query  111  ERVQGKTELRYV  76
            ERVQG +   YV
Sbjct  103  ERVQGPSTTTYV  114



>ref|XP_010239814.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Brachypodium distachyon]
Length=285

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFP
Sbjct  54   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFP  113

Query  111  ERVQGKTELRYV  76
            ERVQG+T+L +V
Sbjct  114  ERVQGRTDLGFV  125



>ref|XP_009353514.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Pyrus x bretschneideri]
 ref|XP_009378798.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Pyrus x bretschneideri]
Length=250

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AAL+FKG+KAKLNFP
Sbjct  53   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALRFKGTKAKLNFP  112

Query  111  ERVQGKTEL  85
            ERVQGKT+ 
Sbjct  113  ERVQGKTDF  121



>ref|XP_009359874.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AALKFKG+KAKLNFP
Sbjct  89   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALKFKGTKAKLNFP  148

Query  111  ERVQGKTEL  85
            ERVQGKT+ 
Sbjct  149  ERVQGKTDF  157



>ref|XP_009339054.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Pyrus x bretschneideri]
Length=279

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = -2

Query  318  ILCFDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            +L  D+GN+RR HYRGVR+RPWGKWA+EIRDP KAA VWLGTFDTAE AALAYD+AAL+F
Sbjct  109  VLLQDQGNLRRQHYRGVRRRPWGKWASEIRDPVKAARVWLGTFDTAEAAALAYDKAALQF  168

Query  141  KGSKAKLNFPERVQGKTE  88
            KG+KAKLNFPERVQG +E
Sbjct  169  KGNKAKLNFPERVQGSSE  186



>ref|XP_009383009.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Musa acuminata subsp. malaccensis]
Length=256

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNV-RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GN  RRHYRGVRQRPWGKWAAEIRDP+KAA VWLGTFDTA DAA+AYDEAAL+FKG K
Sbjct  82   EQGNAGRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFDTAVDAAIAYDEAALRFKGCK  141

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG+++L ++
Sbjct  142  AKLNFPERVQGRSDLGFL  159



>ref|XP_006469112.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Citrus sinensis]
Length=328

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 2/79 (3%)
 Frame = -2

Query  306  DKGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGS  133
            D+GN+  RRHYRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA AYD AAL+FKGS
Sbjct  83   DQGNIVRRRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFETAEAAAAAYDAAALRFKGS  142

Query  132  KAKLNFPERVQGKTELRYV  76
            KAKLNFPERVQ   +L ++
Sbjct  143  KAKLNFPERVQAPPDLHHL  161



>emb|CDX78517.1| BnaA03g04290D [Brassica napus]
Length=258

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD AALKFKG+KAKLNFP
Sbjct  74   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALKFKGTKAKLNFP  133

Query  111  ERVQGKTELRYV  76
            ERVQG T   YV
Sbjct  134  ERVQGPTTTSYV  145



>ref|XP_006446923.1| hypothetical protein CICLE_v10018158mg [Citrus clementina]
 gb|ESR60163.1| hypothetical protein CICLE_v10018158mg [Citrus clementina]
Length=330

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 2/79 (3%)
 Frame = -2

Query  306  DKGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGS  133
            D+GN+  RRHYRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA AYD AAL+FKGS
Sbjct  85   DQGNIVRRRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFETAEAAAAAYDAAALRFKGS  144

Query  132  KAKLNFPERVQGKTELRYV  76
            KAKLNFPERVQ   +L ++
Sbjct  145  KAKLNFPERVQAPPDLHHL  163



>ref|XP_008222249.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Prunus 
mume]
Length=246

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AAL+FKG+KAKLNFP
Sbjct  54   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALRFKGTKAKLNFP  113

Query  111  ERVQGKTEL  85
            ERVQGKT+ 
Sbjct  114  ERVQGKTDF  122



>gb|KFK25568.1| hypothetical protein AALP_AA8G131700 [Arabis alpina]
Length=225

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  43   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  102

Query  111  ERVQGKTELRYV  76
            ERVQG +   YV
Sbjct  103  ERVQGPSTTSYV  114



>gb|KJB51301.1| hypothetical protein B456_008G210600 [Gossypium raimondii]
Length=233

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYD+AAL+FKGSKAKLNFP
Sbjct  52   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDDAALRFKGSKAKLNFP  111

Query  111  ERVQGKTELRYV  76
            ERVQG+ E  Y+
Sbjct  112  ERVQGRLESSYL  123



>ref|XP_006485171.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
[Citrus sinensis]
Length=388

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKGSK
Sbjct  50   DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGSK  109

Query  129  AKLNFPERVQGK-TELRY  79
            AKLNFPERVQ   T  RY
Sbjct  110  AKLNFPERVQANLTTHRY  127


 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKGSK
Sbjct  192  DQGNVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGSK  251

Query  129  AKLNFPERVQGK-TELRY  79
            AKLNFPERVQ   T  RY
Sbjct  252  AKLNFPERVQANLTTHRY  269



>ref|XP_008375519.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Malus domestica]
Length=314

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = -2

Query  309  FDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGS  133
             D GN+RR HYRGVR+RPWGKWAAEIRDP KAA VWLGTFDTAE AALAYD+AALKFKGS
Sbjct  147  LDTGNLRRQHYRGVRRRPWGKWAAEIRDPVKAARVWLGTFDTAEAAALAYDKAALKFKGS  206

Query  132  KAKLNFPERVQGKTE  88
            KAKLNFPERVQG +E
Sbjct  207  KAKLNFPERVQGSSE  221



>ref|XP_002866459.1| hypothetical protein ARALYDRAFT_919438 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42718.1| hypothetical protein ARALYDRAFT_919438 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 2/79 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+RR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  77   DQGNLRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSK  136

Query  129  AKLNFPERVQ-GKTELRYV  76
            AKLNFPERVQ G     YV
Sbjct  137  AKLNFPERVQLGSNSTYYV  155



>ref|XP_011457529.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Fragaria 
vesca subsp. vesca]
Length=243

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA+AYD AALKFKG+KAKLNFP
Sbjct  48   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAAIAYDNAALKFKGTKAKLNFP  107

Query  111  ERVQGKTEL  85
            ERVQG + +
Sbjct  108  ERVQGNSSI  116



>dbj|BAJ53126.1| JHL07K02.16 [Jatropha curcas]
Length=230

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G+ RR HYRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AALAYDEAAL+FKG K
Sbjct  46   DQGSTRRRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEAAALAYDEAALRFKGCK  105

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG+T+  ++
Sbjct  106  AKLNFPERVQGRTQSGFL  123



>ref|XP_006394454.1| hypothetical protein EUTSA_v10005416mg [Eutrema salsugineum]
 gb|ESQ31740.1| hypothetical protein EUTSA_v10005416mg [Eutrema salsugineum]
Length=246

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+RR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  73   DQGNLRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSK  132

Query  129  AKLNFPERVQ  100
            AKLNFPERVQ
Sbjct  133  AKLNFPERVQ  142



>ref|XP_010419908.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X1 [Camelina sativa]
 ref|XP_010419909.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X2 [Camelina sativa]
Length=212

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  36   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  95

Query  111  ERVQGKT  91
            ERVQG T
Sbjct  96   ERVQGPT  102



>ref|XP_009131332.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Brassica rapa]
Length=223

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD AALKFKG+KAKLNFP
Sbjct  39   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALKFKGTKAKLNFP  98

Query  111  ERVQGKTELRYV  76
            ERVQG +   YV
Sbjct  99   ERVQGPSTTSYV  110



>ref|XP_009339033.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Pyrus x bretschneideri]
Length=251

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = -2

Query  318  ILCFDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            +L  D+GN+RR H RGVR+RPWGKWAAEIRDP KAA VWLGTFDTAE AALAYD+AAL F
Sbjct  81   VLLQDQGNLRRQHDRGVRRRPWGKWAAEIRDPVKAARVWLGTFDTAEAAALAYDKAALNF  140

Query  141  KGSKAKLNFPERVQGKTE  88
            KGSKAKLNFPERVQG +E
Sbjct  141  KGSKAKLNFPERVQGSSE  158



>ref|XP_009130180.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Brassica rapa]
Length=254

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  77   DQGNLRTRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSK  136

Query  129  AKLNFPERVQ  100
            AKLNFPERVQ
Sbjct  137  AKLNFPERVQ  146



>ref|NP_196837.1| ethylene-responsive transcription factor ERF113 [Arabidopsis 
thaliana]
 sp|Q9LYU3.1|EF113_ARATH RecName: Full=Ethylene-responsive transcription factor ERF113 
[Arabidopsis thaliana]
 emb|CAB86640.1| putative protein [Arabidopsis thaliana]
 gb|AAS47615.1| At5g13330 [Arabidopsis thaliana]
 gb|AAS76737.1| At5g13330 [Arabidopsis thaliana]
 gb|AAT44928.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AED91881.1| ethylene-responsive transcription factor ERF113 [Arabidopsis 
thaliana]
Length=212

 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  36   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  95

Query  111  ERVQGKT  91
            ERVQG T
Sbjct  96   ERVQGPT  102



>ref|XP_007032032.1| AP2/ERF domain-containing transcription factor-like protein isoform 
2 [Theobroma cacao]
 gb|EOY02958.1| AP2/ERF domain-containing transcription factor-like protein isoform 
2 [Theobroma cacao]
Length=276

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 65/71 (92%), Gaps = 2/71 (3%)
 Frame = -2

Query  303  KGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            KGNV  +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AALKFKGSK
Sbjct  51   KGNVIRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAAAYDAAALKFKGSK  110

Query  129  AKLNFPERVQG  97
            AKLNFPERVQG
Sbjct  111  AKLNFPERVQG  121



>ref|XP_007137849.1| hypothetical protein PHAVU_009G161000g [Phaseolus vulgaris]
 gb|ESW09843.1| hypothetical protein PHAVU_009G161000g [Phaseolus vulgaris]
Length=258

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYD AALKFKGSKAKLNF 
Sbjct  80   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDAAALKFKGSKAKLNFS  139

Query  111  ERVQGKTELRYV  76
            ERVQG  E  Y+
Sbjct  140  ERVQGTDEFGYL  151



>ref|XP_008392694.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Malus 
domestica]
Length=272

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 2/76 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G  RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+T E AALAYDEAAL+FKGSK
Sbjct  66   DQGTARRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETDEAAALAYDEAALRFKGSK  125

Query  129  AKLNFPERVQGK-TEL  85
            AKLNFPERVQG+ TEL
Sbjct  126  AKLNFPERVQGRITEL  141



>ref|XP_007211200.1| hypothetical protein PRUPE_ppa008772mg [Prunus persica]
 gb|EMJ12399.1| hypothetical protein PRUPE_ppa008772mg [Prunus persica]
Length=319

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -2

Query  303  KGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
             GNVRR HYRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AALAYD AAL+FKGSKA
Sbjct  100  NGNVRRRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFETAEAAALAYDAAALRFKGSKA  159

Query  126  KLNFPERVQGKTELRYV  76
            KLNFPERVQG  EL Y+
Sbjct  160  KLNFPERVQGGDELGYL  176



>ref|XP_002871562.1| hypothetical protein ARALYDRAFT_488151 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47821.1| hypothetical protein ARALYDRAFT_488151 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  36   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  95

Query  111  ERVQGKT  91
            ERVQG T
Sbjct  96   ERVQGPT  102



>emb|CDX70498.1| BnaC03g05820D [Brassica napus]
Length=258

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD AALKFKG+KAKLNFP
Sbjct  74   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALKFKGTKAKLNFP  133

Query  111  ERVQGKTELRYV  76
            ERVQG +   YV
Sbjct  134  ERVQGPSTTSYV  145



>gb|EEE60921.1| hypothetical protein OsJ_14639 [Oryza sativa Japonica Group]
Length=237

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYDEAAL+FKG+KAKLNFPER
Sbjct  56   HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAIAYDEAALRFKGTKAKLNFPER  115

Query  105  VQGKTELRYV  76
            VQG+T+L ++
Sbjct  116  VQGRTDLGFL  125



>ref|XP_011463208.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Fragaria vesca subsp. vesca]
Length=240

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSKAKLNFP
Sbjct  57   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSKAKLNFP  116

Query  111  ERVQGKTE  88
            ERVQG +E
Sbjct  117  ERVQGTSE  124



>ref|XP_008239643.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Prunus mume]
Length=326

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++GNVRR HYRGVRQRPWGK+AAEIRDP KAA VWLGTF+TAE AALAYD AAL+FKGSK
Sbjct  110  NQGNVRRRHYRGVRQRPWGKFAAEIRDPNKAARVWLGTFETAEAAALAYDAAALRFKGSK  169

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQG TEL ++
Sbjct  170  AKLNFPERVQGGTELGHL  187



>ref|XP_009373652.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Pyrus x bretschneideri]
Length=271

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 2/76 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G  RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+T E AALAYDEAAL+FKGSK
Sbjct  66   DQGTARRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETDEAAALAYDEAALRFKGSK  125

Query  129  AKLNFPERVQGK-TEL  85
            AKLNFPERVQG+ TEL
Sbjct  126  AKLNFPERVQGRITEL  141



>gb|KDP41861.1| hypothetical protein JCGZ_26879 [Jatropha curcas]
Length=288

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = -2

Query  303  KGNV-RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            +GN+ RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AALKFKGSKA
Sbjct  59   QGNIKRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAIAYDTAALKFKGSKA  118

Query  126  KLNFPERVQ  100
            KLNFPERVQ
Sbjct  119  KLNFPERVQ  127



>ref|XP_010066464.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Eucalyptus grandis]
 gb|KCW64342.1| hypothetical protein EUGRSUZ_G01970 [Eucalyptus grandis]
Length=224

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
             RRHYRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AALAYD AAL+FKG+KAKLNF
Sbjct  51   TRRHYRGVRQRPWGKWAAEIRDPIKAARVWLGTFDTAEAAALAYDTAALRFKGTKAKLNF  110

Query  114  PERVQGKT  91
            PERVQG T
Sbjct  111  PERVQGNT  118



>emb|CDX91131.1| BnaC02g04660D [Brassica napus]
Length=254

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            ++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  72   KKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  131

Query  111  ERVQGKTELRYV  76
            ERVQG +   YV
Sbjct  132  ERVQGPSTTSYV  143



>ref|XP_009125903.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Brassica rapa]
 emb|CDX85656.1| BnaA02g01570D [Brassica napus]
Length=249

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            ++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  69   KKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  128

Query  111  ERVQGKTELRYV  76
            ERVQG +   YV
Sbjct  129  ERVQGPSTTSYV  140



>ref|XP_006580881.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Glycine max]
Length=246

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +GNVRRHYRGVRQRPWGKWA+EIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKG+KAK
Sbjct  96   QGNVRRHYRGVRQRPWGKWASEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGTKAK  155

Query  123  LNFPERVQGKTELRYV  76
            LNFPERV    E  Y+
Sbjct  156  LNFPERVHFSKEFGYL  171



>ref|XP_003528089.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Glycine max]
 gb|KHN09706.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=269

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 1/71 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++G+VRR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSK
Sbjct  78   EQGSVRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSK  137

Query  129  AKLNFPERVQG  97
            AKLNFPERVQG
Sbjct  138  AKLNFPERVQG  148



>gb|AFK45569.1| unknown [Lotus japonicus]
Length=202

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  282  YRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPERV  103
            YRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAA AYD+AALKF+G+KAKLNFPER+
Sbjct  53   YRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAATAYDKAALKFRGTKAKLNFPERI  112

Query  102  QGKTELRYV  76
            QG T+  YV
Sbjct  113  QGNTDASYV  121



>ref|XP_010444024.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Camelina sativa]
Length=248

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+RR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  78   DEGNLRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSK  137

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQ  +   Y
Sbjct  138  AKLNFPERVQLGSNSTY  154



>ref|XP_006279688.1| hypothetical protein CARUB_v10027012mg [Capsella rubella]
 gb|EOA12586.1| hypothetical protein CARUB_v10027012mg [Capsella rubella]
Length=243

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+RR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  81   DEGNLRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSK  140

Query  129  AKLNFPERVQ  100
            AKLNFPERVQ
Sbjct  141  AKLNFPERVQ  150



>gb|KCW64343.1| hypothetical protein EUGRSUZ_G01970 [Eucalyptus grandis]
Length=175

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
             RRHYRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AALAYD AAL+FKG+KAKLNF
Sbjct  2    TRRHYRGVRQRPWGKWAAEIRDPIKAARVWLGTFDTAEAAALAYDTAALRFKGTKAKLNF  61

Query  114  PERVQGKT  91
            PERVQG T
Sbjct  62   PERVQGNT  69



>ref|XP_010483875.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Camelina sativa]
Length=246

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+RR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  76   DEGNLRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSK  135

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQ  +   Y
Sbjct  136  AKLNFPERVQLGSNSTY  152



>gb|KDP22531.1| hypothetical protein JCGZ_26362 [Jatropha curcas]
Length=231

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AALAYDEAAL+FKG KAKLNFP
Sbjct  53   RRHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEAAALAYDEAALRFKGCKAKLNFP  112

Query  111  ERVQGKTELRYV  76
            ERVQG+T+  ++
Sbjct  113  ERVQGRTQSGFL  124



>ref|NP_200995.1| ethylene-responsive transcription factor ERF114 [Arabidopsis 
thaliana]
 sp|Q9FH54.1|EF114_ARATH RecName: Full=Ethylene-responsive transcription factor ERF114 
[Arabidopsis thaliana]
 dbj|BAB08875.1| AP2 domain transcription factor-like [Arabidopsis thaliana]
 gb|AAT44929.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ACB88827.1| At5g61890 [Arabidopsis thaliana]
 gb|AED97529.1| ethylene-responsive transcription factor ERF114 [Arabidopsis 
thaliana]
Length=248

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G++RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  81   DQGDLRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAESAALAYDEAALKFKGSK  140

Query  129  AKLNFPERVQGKTELRY  79
            AKLNFPERVQ  +   Y
Sbjct  141  AKLNFPERVQLGSNSTY  157



>ref|XP_010453397.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Camelina sativa]
Length=212

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  36   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  95

Query  111  ERVQGKT  91
            ERVQG +
Sbjct  96   ERVQGPS  102



>ref|XP_010927797.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Elaeis guineensis]
Length=227

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 78/102 (76%), Gaps = 8/102 (8%)
 Frame = -2

Query  381  EMRGETEHILQLRLIRTFFF*ILCFDKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWL  202
            E++ ETE I +    R F        +G  R+HYRGVR+RPWGKW AEIRDPKKA  VWL
Sbjct  36   EVKMETEVITKRYSQRNF--------RGTHRKHYRGVRRRPWGKWVAEIRDPKKAIRVWL  87

Query  201  GTFDTaedaalaydeaaLKFKGSKAKLNFPERVQGKTELRYV  76
            GTFDTAEDAALAYDEAALKFKGSKAKLNFPERVQ + +L ++
Sbjct  88   GTFDTAEDAALAYDEAALKFKGSKAKLNFPERVQDQIDLGFL  129



>ref|XP_010556085.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Tarenaya hassleriana]
Length=235

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD AALKFKG+KAKLNFP
Sbjct  52   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALKFKGTKAKLNFP  111

Query  111  ERVQGKT  91
            ERVQG T
Sbjct  112  ERVQGHT  118



>ref|XP_003522453.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Glycine max]
Length=262

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSKAKLNFP
Sbjct  84   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSKAKLNFP  143

Query  111  ERVQGK-TELRYV  76
            ERVQG  +E  Y+
Sbjct  144  ERVQGTASEFGYL  156



>gb|KHN31248.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=262

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSKAKLNFP
Sbjct  84   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSKAKLNFP  143

Query  111  ERVQGK-TELRYV  76
            ERVQG  +E  Y+
Sbjct  144  ERVQGTASEFGYL  156



>ref|XP_010044889.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Eucalyptus grandis]
 gb|KCW87002.1| hypothetical protein EUGRSUZ_B03559 [Eucalyptus grandis]
Length=239

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 1/74 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ +VR+ HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD AALKFKG+K
Sbjct  39   DQESVRKKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALKFKGTK  98

Query  129  AKLNFPERVQGKTE  88
            AKLNFPERVQGK E
Sbjct  99   AKLNFPERVQGKPE  112



>ref|XP_002318176.2| hypothetical protein POPTR_0012s11030g [Populus trichocarpa]
 gb|EEE96396.2| hypothetical protein POPTR_0012s11030g [Populus trichocarpa]
Length=240

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSK
Sbjct  45   DQGNARRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSK  104

Query  129  AKLNFPERV-QGKTELRY  79
            AKLNFPERV  G TEL +
Sbjct  105  AKLNFPERVPSGGTELGF  122



>ref|XP_011463207.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Fragaria vesca subsp. vesca]
Length=255

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  318  ILCFDKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFK  139
            ++   +GNVR+HYRGVR+RPWGKWAAEIRDP KAA VWLGTF+TAE AALAYDEAAL+FK
Sbjct  46   VVLQAQGNVRQHYRGVRRRPWGKWAAEIRDPHKAARVWLGTFETAEAAALAYDEAALRFK  105

Query  138  GSKAKLNFPERVQG  97
            GSKAKLNFPERVQG
Sbjct  106  GSKAKLNFPERVQG  119



>ref|XP_009759799.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Nicotiana sylvestris]
Length=259

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = -2

Query  300  GNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            GN+  RRHYRGVRQRPWGK+AAEIRDPKKAA VWLGTF+TAE AA+AYDEAALKFKG+KA
Sbjct  53   GNIERRRHYRGVRQRPWGKYAAEIRDPKKAARVWLGTFETAEAAAIAYDEAALKFKGNKA  112

Query  126  KLNFPERVQGKTELRYV  76
            KLNFPERV  KTE  Y+
Sbjct  113  KLNFPERVLAKTEFGYL  129



>ref|XP_010492081.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Camelina sativa]
Length=210

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFPE
Sbjct  37   RHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFPE  96

Query  108  RVQGKT  91
            RVQG T
Sbjct  97   RVQGPT  102



>ref|XP_008375518.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Malus domestica]
Length=264

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+RR HYRGVR+RP GKWAAEIRDP KAA VWLGTFDTAE AALAYD+AALKFKGSK
Sbjct  98   DQGNLRRQHYRGVRRRPXGKWAAEIRDPVKAARVWLGTFDTAEAAALAYDKAALKFKGSK  157

Query  129  AKLNFPERVQGKTE  88
            AKLNFPERVQG +E
Sbjct  158  AKLNFPERVQGISE  171



>ref|XP_010105603.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXC05170.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=266

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 68/80 (85%), Gaps = 5/80 (6%)
 Frame = -2

Query  315  LCFDKGN-----VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaa  151
            L  D+GN      RRHYRGVRQRPWGK AAEIRDP+KAA VWLGTFDTAE AALAYDEAA
Sbjct  52   LQEDQGNKRSTITRRHYRGVRQRPWGKGAAEIRDPQKAARVWLGTFDTAEAAALAYDEAA  111

Query  150  LKFKGSKAKLNFPERVQGKT  91
            L+FKGSKAKLNFPERVQG T
Sbjct  112  LRFKGSKAKLNFPERVQGGT  131



>ref|XP_008375520.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Malus domestica]
Length=373

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = -2

Query  318  ILCFDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            +L  D+GN+RR HYRGVR+RP GKWAAEIRDP KAA VWLGTFDTAE AALAYD+AALKF
Sbjct  203  VLLQDQGNLRRQHYRGVRRRPSGKWAAEIRDPVKAARVWLGTFDTAEAAALAYDKAALKF  262

Query  141  KGSKAKLNFPERVQGKTE  88
            KGSKAK NFPERVQG +E
Sbjct  263  KGSKAKXNFPERVQGSSE  280



>ref|XP_010546103.1| PREDICTED: ethylene-responsive transcription factor ERF115 [Tarenaya 
hassleriana]
Length=228

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+RR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAAL+FKGSK
Sbjct  46   DQGNLRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALRFKGSK  105

Query  129  AKLNFPERVQ  100
            AKLNFPERVQ
Sbjct  106  AKLNFPERVQ  115



>ref|XP_009587768.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
isoform X1 [Nicotiana tomentosiformis]
Length=309

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN RR  YRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AA+AYDEAAL+FKG+K
Sbjct  87   DQGNSRRKRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAAIAYDEAALRFKGNK  146

Query  129  AKLNFPERVQGK  94
            AKLNFPERVQGK
Sbjct  147  AKLNFPERVQGK  158



>ref|XP_002297877.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|EEE82682.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=231

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ N RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYD+AALKFKGSK
Sbjct  46   DQENTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAVAYDKAALKFKGSK  105

Query  129  AKLNFPERV  103
            AKLNFPERV
Sbjct  106  AKLNFPERV  114



>emb|CDX69647.1| BnaA10g19960D [Brassica napus]
Length=217

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            R+HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AA AYD AALKFKG+KAKLNFP
Sbjct  43   RKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAAFAYDRAALKFKGTKAKLNFP  102

Query  111  ERVQGKTELRYV  76
            E +QG +   YV
Sbjct  103  EHLQGPSTTTYV  114



>ref|XP_009121770.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Brassica 
rapa]
Length=217

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            R+HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AA AYD AALKFKG+KAKLNFP
Sbjct  43   RKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAAFAYDRAALKFKGTKAKLNFP  102

Query  111  ERVQGKTELRYV  76
            E +QG +   YV
Sbjct  103  EHLQGPSTTTYV  114



>gb|ABC40568.1| putative AP2/EREBP transcription factor [Capsicum annuum]
Length=156

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = -2

Query  315  LCFDKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKG  136
            +    G+ RRHYRGVRQRPWGKWAAEIR+PKKAA VWLGTFD AEDAALAYDEAA++FKG
Sbjct  1    MMLGSGSGRRHYRGVRQRPWGKWAAEIRNPKKAARVWLGTFDRAEDAALAYDEAAVRFKG  60

Query  135  SKAKLNFPER-VQGKTEL  85
            SKAKLNFPER VQG+ +L
Sbjct  61   SKAKLNFPERLVQGQPQL  78



>ref|XP_008351719.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Malus domestica]
Length=304

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 2/79 (3%)
 Frame = -2

Query  318  ILCFDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            +L  D+GN+RR HYRGVR+RPWGKWAAEIRDP KAA VWLGTF+TAE AALAYD AAL+F
Sbjct  139  VLLQDQGNLRRQHYRGVRRRPWGKWAAEIRDPIKAARVWLGTFNTAEAAALAYDGAALRF  198

Query  141  KGSKAKLNFPER-VQGKTE  88
            KGSKAKLNFPER VQG +E
Sbjct  199  KGSKAKLNFPERVVQGSSE  217



>ref|XP_011036184.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Populus euphratica]
Length=230

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+ N RR HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYD+AALKFKGSK
Sbjct  46   DQENTRRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAVAYDKAALKFKGSK  105

Query  129  AKLNFPERV  103
            AKLNFPERV
Sbjct  106  AKLNFPERV  114



>gb|EYU21807.1| hypothetical protein MIMGU_mgv1a020102mg [Erythranthe guttata]
Length=290

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFD+AE AALAYDEAAL+FKG+KAKLNFP
Sbjct  85   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDSAEGAALAYDEAALRFKGNKAKLNFP  144

Query  111  ERVQGKTE  88
            ERVQ K++
Sbjct  145  ERVQPKSD  152



>ref|XP_006288550.1| hypothetical protein CARUB_v10001831mg, partial [Capsella rubella]
 gb|EOA21448.1| hypothetical protein CARUB_v10001831mg, partial [Capsella rubella]
Length=243

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AALAYD AALKFKG+KAKLNFP
Sbjct  69   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFP  128

Query  111  ERVQG  97
            ERVQG
Sbjct  129  ERVQG  133



>gb|KHN31250.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=246

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSKAKLNFP
Sbjct  68   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSKAKLNFP  127

Query  111  ERVQGK-TELRYV  76
            ERVQG  +E  Y+
Sbjct  128  ERVQGTASEFGYL  140



>gb|KDO51250.1| hypothetical protein CISIN_1g036963mg, partial [Citrus sinensis]
Length=194

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKGSKAKLNFP
Sbjct  4    RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGSKAKLNFP  63

Query  111  ERVQGK-TELRY  79
            ERVQ   T  RY
Sbjct  64   ERVQANLTTHRY  75



>ref|XP_009587769.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
isoform X2 [Nicotiana tomentosiformis]
Length=217

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN RR  YRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AA+AYDEAAL+FKG+K
Sbjct  87   DQGNSRRKRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAAIAYDEAALRFKGNK  146

Query  129  AKLNFPERVQGKTELRYV  76
            AKLNFPERVQ   E R +
Sbjct  147  AKLNFPERVQASYEQRQL  164



>ref|XP_010457918.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Camelina sativa]
Length=247

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -2

Query  303  KGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            +GN+RR HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSKA
Sbjct  78   EGNLRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGSKA  137

Query  126  KLNFPERVQGKTELRY  79
            KLNFPERVQ  +   Y
Sbjct  138  KLNFPERVQLGSNSTY  153



>emb|CDX98982.1| BnaC09g48530D [Brassica napus]
Length=253

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  75   DQGNLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  134

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  135  AKLNFPERAQ  144



>ref|XP_004501759.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Cicer arietinum]
Length=251

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AA+AYDEAAL+FKGSKAKLNFP
Sbjct  85   RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAAVAYDEAALRFKGSKAKLNFP  144

Query  111  ERVQGKTE  88
            ERVQ  T+
Sbjct  145  ERVQSSTD  152



>ref|XP_006399213.1| hypothetical protein EUTSA_v10015583mg [Eutrema salsugineum]
 gb|ESQ40666.1| hypothetical protein EUTSA_v10015583mg [Eutrema salsugineum]
Length=260

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  83   DQGNLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>emb|CDX70027.1| BnaA10g23760D [Brassica napus]
Length=253

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  75   DQGNLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  134

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  135  AKLNFPERAQ  144



>ref|XP_008460191.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Cucumis melo]
Length=247

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+G  +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AAL+FKG+KA
Sbjct  75   DQGGRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAIAYDNAALRFKGTKA  134

Query  126  KLNFPERVQG  97
            KLNFPERVQ 
Sbjct  135  KLNFPERVQA  144



>ref|XP_009122352.1| PREDICTED: ethylene-responsive transcription factor ERF115 [Brassica 
rapa]
Length=253

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN+R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  75   DQGNLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  134

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  135  AKLNFPERAQ  144



>gb|ADN33698.1| AP2 domain transcription factor RAP2 [Cucumis melo subsp. melo]
Length=252

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+G  +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AAL+FKG+KA
Sbjct  80   DQGGRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAIAYDNAALRFKGTKA  139

Query  126  KLNFPERVQG  97
            KLNFPERVQ 
Sbjct  140  KLNFPERVQA  149



>gb|KGN46410.1| hypothetical protein Csa_6G091830 [Cucumis sativus]
Length=191

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+   +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AAL+FKG+KA
Sbjct  19   DQSGRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAIAYDNAALRFKGTKA  78

Query  126  KLNFPERVQG  97
            KLNFPERVQ 
Sbjct  79   KLNFPERVQA  88



>ref|XP_007159952.1| hypothetical protein PHAVU_002G281300g [Phaseolus vulgaris]
 gb|ESW31946.1| hypothetical protein PHAVU_002G281300g [Phaseolus vulgaris]
Length=226

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +GN RR YRGVRQRPWGKWAAEIRDPKKAA VWLGTF TAE AALAYDEAAL+FKG+KAK
Sbjct  86   QGNARRQYRGVRQRPWGKWAAEIRDPKKAARVWLGTFPTAEAAALAYDEAALRFKGTKAK  145

Query  123  LNFPERVQGKTELRYV  76
            LNFPE+V    EL Y+
Sbjct  146  LNFPEKVHRSGELGYL  161



>gb|KJB77208.1| hypothetical protein B456_012G125700 [Gossypium raimondii]
Length=261

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -2

Query  303  KGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            +   +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AALKFKG+KAK
Sbjct  83   ENTTKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAALKFKGTKAK  142

Query  123  LNFPERVQ  100
            LNFPER Q
Sbjct  143  LNFPERAQ  150



>ref|XP_009339053.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Pyrus x bretschneideri]
Length=290

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = -2

Query  318  ILCFDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            +L  D+GN+RR HYRGVR+RP GKWAAEIRDP KAA VWLGTFDTAE AALAYD+AALKF
Sbjct  122  VLFQDQGNLRRQHYRGVRRRPGGKWAAEIRDPVKAARVWLGTFDTAEAAALAYDKAALKF  181

Query  141  KGSKAKLNFPERVQGKTE  88
            KG KA LNFPERVQG +E
Sbjct  182  KGCKANLNFPERVQGSSE  199



>emb|CDY53152.1| BnaCnng24520D [Brassica napus]
Length=226

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 65/70 (93%), Gaps = 2/70 (3%)
 Frame = -2

Query  306  DKGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGS  133
            D+GN   RRHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGS
Sbjct  71   DQGNSMGRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAESAALAYDEAALKFKGS  130

Query  132  KAKLNFPERV  103
            KAKLNFPERV
Sbjct  131  KAKLNFPERV  140



>ref|XP_009780575.1| PREDICTED: ethylene-responsive transcription factor ERF113 [Nicotiana 
sylvestris]
Length=290

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN RR  YRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AA+AYDEAAL+FKG+K
Sbjct  85   DQGNSRRKRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAAVAYDEAALRFKGNK  144

Query  129  AKLNFPERVQGK  94
            AKLNFPE+VQGK
Sbjct  145  AKLNFPEKVQGK  156



>gb|KFK25131.1| hypothetical protein AALP_AA8G070000 [Arabis alpina]
Length=260

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GN++ RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  83   DQGNLKKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>emb|CAN81030.1| hypothetical protein VITISV_011003 [Vitis vinifera]
Length=409

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 68/91 (75%), Gaps = 13/91 (14%)
 Frame = -2

Query  330  FFF*ILCFDK------------GNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFD  190
            F    LCF++            G+ R RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFD
Sbjct  135  FLSLTLCFNQQILNYVNWPGREGSARKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFD  194

Query  189  TaedaalaydeaaLKFKGSKAKLNFPERVQG  97
            TAE AA AYD AAL FKG+KAKLNFPERVQG
Sbjct  195  TAEAAAAAYDAAALNFKGTKAKLNFPERVQG  225



>ref|XP_003522452.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Glycine max]
Length=252

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEI DPKKAA VWLGTF+TAE AALAYDEAAL+FKGSKAKLNFP
Sbjct  74   RRHYRGVRQRPWGKWAAEIHDPKKAARVWLGTFETAEAAALAYDEAALRFKGSKAKLNFP  133

Query  111  ERVQGK-TELRYV  76
            ERVQG  +E  Y+
Sbjct  134  ERVQGTASEFGYL  146



>ref|XP_002275870.2| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Vitis vinifera]
Length=254

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AAL FKG+KAKLNFP
Sbjct  56   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAAAYDAAALNFKGTKAKLNFP  115

Query  111  ERVQG  97
            ERVQG
Sbjct  116  ERVQG  120



>emb|CDY14051.1| BnaC02g01680D [Brassica napus]
Length=256

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G++R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AA+AYDEAALKFKGSK
Sbjct  83   DQGDLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAAIAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>emb|CDY09787.1| BnaC09g43740D [Brassica napus]
Length=223

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            R++YRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AA AYD AALKFKG+KAKLNFP
Sbjct  43   RKNYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAAFAYDRAALKFKGTKAKLNFP  102

Query  111  ERVQGKTELRYV  76
            E +QG +   YV
Sbjct  103  EHLQGPSTTTYV  114



>ref|XP_010527717.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
isoform X2 [Tarenaya hassleriana]
Length=261

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 2/71 (3%)
 Frame = -2

Query  306  DKGNVRR--HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGS  133
            D+GN+RR   YRGVRQRPWGKWAAEIRDP+KAA VWLGTFDTAE AALAYDEAAL+FKGS
Sbjct  89   DQGNLRRRQQYRGVRQRPWGKWAAEIRDPQKAARVWLGTFDTAEAAALAYDEAALRFKGS  148

Query  132  KAKLNFPERVQ  100
            KAKLNFPERVQ
Sbjct  149  KAKLNFPERVQ  159



>ref|XP_004140654.1| PREDICTED: uncharacterized protein LOC101205898 [Cucumis sativus]
Length=277

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+   +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AAL+FKG+KA
Sbjct  105  DQSGRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAIAYDNAALRFKGTKA  164

Query  126  KLNFPERVQG  97
            KLNFPERVQ 
Sbjct  165  KLNFPERVQA  174



>ref|XP_006346662.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Solanum tuberosum]
Length=356

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 1/69 (1%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNFP
Sbjct  164  KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGNKAKLNFP  223

Query  111  ERVQ-GKTE  88
            ERVQ G T+
Sbjct  224  ERVQSGNTQ  232



>emb|CDX78288.1| BnaA03g02000D [Brassica napus]
Length=255

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D GN+R+ HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  79   DHGNLRKIHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  138

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  139  AKLNFPERAQ  148



>ref|XP_003621630.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES77848.1| ethylene response factor [Medicago truncatula]
 gb|AFK38363.1| unknown [Medicago truncatula]
Length=176

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AALKFKG+KAKLNFPER
Sbjct  50   HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAALKFKGTKAKLNFPER  109

Query  105  V  103
            V
Sbjct  110  V  110



>ref|XP_009132220.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
[Brassica rapa]
Length=255

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D GN+R+ HYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  79   DHGNLRKIHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  138

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  139  AKLNFPERAQ  148



>ref|XP_011043029.1| PREDICTED: ethylene-responsive transcription factor ERF114 [Populus 
euphratica]
Length=302

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE AALAYDEAAL+FKGSKAKLNFP
Sbjct  112  RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEAAALAYDEAALRFKGSKAKLNFP  171

Query  111  ERV-QGKTELRY  79
            ERV  G TEL +
Sbjct  172  ERVPSGGTELGF  183



>ref|XP_008239644.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Prunus mume]
Length=287

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -2

Query  306  DKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR HYRGVRQR WGKWAAEIRDP +AA +WLGT+DTAE AALAYD+AAL FKGSK
Sbjct  92   DQGNVRRQHYRGVRQRKWGKWAAEIRDPIRAARLWLGTYDTAEAAALAYDKAALSFKGSK  151

Query  129  AKLNFPERVQGKTEL  85
            AKLNFPERVQ  +E 
Sbjct  152  AKLNFPERVQESSEF  166



>ref|XP_006844465.1| hypothetical protein AMTR_s00016p00092590 [Amborella trichopoda]
 gb|ERN06140.1| hypothetical protein AMTR_s00016p00092590 [Amborella trichopoda]
Length=189

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +R+YRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA+AYD+AAL+FKG+KAKLNFP
Sbjct  49   KRNYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAAVAYDKAALRFKGTKAKLNFP  108

Query  111  ERVQGKT  91
            ERVQ  +
Sbjct  109  ERVQSSS  115



>ref|XP_006471819.1| PREDICTED: paramyosin-like isoform X1 [Citrus sinensis]
 ref|XP_006471820.1| PREDICTED: paramyosin-like isoform X2 [Citrus sinensis]
Length=707

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 60/69 (87%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = -2

Query  300  GNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            GNV R H+RGVRQRPWGKWAAEIRDPKKAA +WLGTFDTAE AALAYDEAAL+FKG KAK
Sbjct  632  GNVSRMHFRGVRQRPWGKWAAEIRDPKKAARIWLGTFDTAEAAALAYDEAALRFKGRKAK  691

Query  123  LNFPERVQG  97
            LNFPERVQ 
Sbjct  692  LNFPERVQA  700



>gb|KDO46348.1| hypothetical protein CISIN_1g005229mg [Citrus sinensis]
Length=707

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 60/69 (87%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = -2

Query  300  GNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            GNV R H+RGVRQRPWGKWAAEIRDPKKAA +WLGTFDTAE AALAYDEAAL+FKG KAK
Sbjct  632  GNVSRMHFRGVRQRPWGKWAAEIRDPKKAARIWLGTFDTAEAAALAYDEAALRFKGRKAK  691

Query  123  LNFPERVQG  97
            LNFPERVQ 
Sbjct  692  LNFPERVQA  700



>ref|XP_002871264.1| hypothetical protein ARALYDRAFT_487556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47523.1| hypothetical protein ARALYDRAFT_487556 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G VR RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  83   DQGLVRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>gb|KEH21859.1| ethylene response factor [Medicago truncatula]
Length=176

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            + HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AA KFKG+KAKLNFP
Sbjct  48   KPHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAAFKFKGTKAKLNFP  107

Query  111  ERV  103
            ERV
Sbjct  108  ERV  110



>ref|XP_010530814.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Tarenaya hassleriana]
Length=262

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            R+HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAE+AA AYD AALKFKG+KAKLNFP
Sbjct  88   RQHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAAFAYDRAALKFKGAKAKLNFP  147

Query  111  ERVQGKT  91
            ER+Q  T
Sbjct  148  ERIQIPT  154



>ref|XP_004252471.2| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Solanum lycopersicum]
Length=287

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNFP
Sbjct  86   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGNKAKLNFP  145

Query  111  ERVQG  97
            ERVQ 
Sbjct  146  ERVQS  150



>ref|XP_009597481.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Nicotiana tomentosiformis]
 ref|XP_009597482.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Nicotiana tomentosiformis]
Length=264

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGK+AAEIRDPKKAA VWLGTF+TAE AA+AYDEAAL+FKG+KAKLNFP
Sbjct  54   RRLYRGVRQRPWGKYAAEIRDPKKAARVWLGTFETAEAAAIAYDEAALRFKGNKAKLNFP  113

Query  111  ERVQGKTELRYV  76
            ERV  KTE  Y+
Sbjct  114  ERVLAKTEFGYL  125



>ref|XP_004242192.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Solanum lycopersicum]
Length=289

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP+KAA VWLGTF TAEDAA+AYDEAALKFKG+KAKLNFP
Sbjct  97   RRQYRGVRQRPWGKWAAEIRDPEKAARVWLGTFHTAEDAAIAYDEAALKFKGNKAKLNFP  156

Query  111  ERVQGKTE  88
            ERVQ  T+
Sbjct  157  ERVQSTTD  164



>gb|AES77850.2| ethylene response factor [Medicago truncatula]
Length=137

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AA KFKG+KAKLNFPER
Sbjct  11   HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAAFKFKGTKAKLNFPER  70

Query  105  V  103
            V
Sbjct  71   V  71



>ref|XP_002512829.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF49332.1| DNA binding protein, putative [Ricinus communis]
Length=212

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RRHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AALKFKG+KAKLNFP
Sbjct  3    RRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAATAYDAAALKFKGTKAKLNFP  62

Query  111  ERVQG  97
            ERVQG
Sbjct  63   ERVQG  67



>ref|XP_009125683.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
[Brassica rapa]
Length=255

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G++R RHYRGVRQRPWGKWAAEIRDP+K A VWLGTF+TAE AA+AYDEAALKFKGSK
Sbjct  82   DQGDLRKRHYRGVRQRPWGKWAAEIRDPQKGARVWLGTFETAEAAAIAYDEAALKFKGSK  141

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  142  AKLNFPERAQ  151



>ref|XP_006289257.1| hypothetical protein CARUB_v10002723mg [Capsella rubella]
 gb|EOA22155.1| hypothetical protein CARUB_v10002723mg [Capsella rubella]
Length=263

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G +R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  83   DQGVLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>ref|XP_003621632.1| Ethylene-responsive transcription factor [Medicago truncatula]
Length=239

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAALAYD+AA KFKG+KAKLNFPER
Sbjct  113  HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAALAYDKAAFKFKGTKAKLNFPER  172

Query  105  V  103
            V
Sbjct  173  V  173



>emb|CDY55173.1| BnaAnng13660D [Brassica napus]
Length=255

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G++R RHYRGVRQRPWGKWAAEIRDP+K A VWLGTF+TAE AA+AYDEAALKFKGSK
Sbjct  82   DQGDLRKRHYRGVRQRPWGKWAAEIRDPQKGARVWLGTFETAEAAAIAYDEAALKFKGSK  141

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  142  AKLNFPERAQ  151



>ref|NP_196348.1| ethylene-responsive transcription factor ERF115 [Arabidopsis 
thaliana]
 sp|Q9LY29.1|EF115_ARATH RecName: Full=Ethylene-responsive transcription factor ERF115 
[Arabidopsis thaliana]
 emb|CAB87920.1| putative transcription factor [Arabidopsis thaliana]
 gb|AAT44952.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABF82620.1| At5g07310 [Arabidopsis thaliana]
 dbj|BAH30579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91135.1| ethylene-responsive transcription factor ERF115 [Arabidopsis 
thaliana]
Length=263

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G +R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYD AALKFKGSK
Sbjct  83   DQGLLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDNAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>gb|ABK28684.1| unknown [Arabidopsis thaliana]
Length=264

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G +R RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYD AALKFKGSK
Sbjct  83   DQGLLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDNAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>ref|XP_010527715.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
isoform X1 [Tarenaya hassleriana]
Length=262

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 2/70 (3%)
 Frame = -2

Query  303  KGNVRR--HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            +GN+RR   YRGVRQRPWGKWAAEIRDP+KAA VWLGTFDTAE AALAYDEAAL+FKGSK
Sbjct  91   EGNLRRRQQYRGVRQRPWGKWAAEIRDPQKAARVWLGTFDTAEAAALAYDEAALRFKGSK  150

Query  129  AKLNFPERVQ  100
            AKLNFPERVQ
Sbjct  151  AKLNFPERVQ  160



>ref|XP_007151718.1| hypothetical protein PHAVU_004G069900g [Phaseolus vulgaris]
 gb|ESW23712.1| hypothetical protein PHAVU_004G069900g [Phaseolus vulgaris]
Length=248

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 3/71 (4%)
 Frame = -2

Query  306  DKGNV---RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKG  136
            ++GN    ++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AALKFKG
Sbjct  35   NQGNADIRKKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAMAYDVAALKFKG  94

Query  135  SKAKLNFPERV  103
            +KAKLNFPERV
Sbjct  95   NKAKLNFPERV  105



>ref|XP_010452687.1| PREDICTED: ethylene-responsive transcription factor ERF115 [Camelina 
sativa]
Length=263

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G ++ RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  83   DQGPLKKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>ref|XP_010423229.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
[Camelina sativa]
Length=263

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G ++ RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  83   DQGPLKKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>ref|XP_010491335.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
[Camelina sativa]
Length=263

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 1/70 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+G ++ RHYRGVRQRPWGKWAAEIRDP+KAA VWLGTF+TAE AALAYDEAALKFKGSK
Sbjct  83   DQGPLKKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDEAALKFKGSK  142

Query  129  AKLNFPERVQ  100
            AKLNFPER Q
Sbjct  143  AKLNFPERAQ  152



>ref|XP_008464362.1| PREDICTED: ethylene-responsive transcription factor ERF115 [Cucumis 
melo]
 gb|ADN33855.1| AP2 domain transcription factor RAP2.3 [Cucumis melo subsp. melo]
Length=129

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNFPE
Sbjct  46   RHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGTKAKLNFPE  105

Query  108  RVQGKTELRYV  76
            R+       Y 
Sbjct  106  RLTTPPSYSYA  116



>gb|KJB40070.1| hypothetical protein B456_007G045100 [Gossypium raimondii]
Length=218

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -2

Query  303  KGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            +GNVRR HYRGVRQRPWGKWAAEIRDP KAA VWLGTF TAE AALAYDEAAL+FKGSKA
Sbjct  38   QGNVRRIHYRGVRQRPWGKWAAEIRDPNKAARVWLGTFATAEAAALAYDEAALRFKGSKA  97

Query  126  KLNFPERVQGKTELRYV  76
            KLNFPERVQ  +   Y+
Sbjct  98   KLNFPERVQRSSGSGYL  114



>ref|XP_004138017.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Cucumis sativus]
 ref|XP_004167196.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Cucumis sativus]
Length=129

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNFPE
Sbjct  46   RHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGTKAKLNFPE  105

Query  108  RVQGKTELRYV  76
            R+       Y 
Sbjct  106  RLTTPPSYPYA  116



>ref|XP_008647050.1| PREDICTED: ethylene-responsive transcription factor ABI4-like 
[Zea mays]
 gb|AFW71587.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=408

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            RHYRGVR+RPWGKWAAEIRDP KAA VWLGTFDTAE AA AYD AAL+FKG+KAKLNFPE
Sbjct  221  RHYRGVRRRPWGKWAAEIRDPAKAARVWLGTFDTAEAAAAAYDRAALQFKGAKAKLNFPE  280

Query  108  RVQGKT  91
            RV+G+T
Sbjct  281  RVRGRT  286



>ref|XP_010540431.1| PREDICTED: ethylene-responsive transcription factor ERF112 [Tarenaya 
hassleriana]
Length=198

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D   ++R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AA AYD+AA +F+G++A
Sbjct  77   DHIQIQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAASAYDKAAFRFRGNRA  136

Query  126  KLNFPERVQGKT  91
            KLNFPER+  +T
Sbjct  137  KLNFPERIDHQT  148



>ref|XP_007161612.1| hypothetical protein PHAVU_001G084000g [Phaseolus vulgaris]
 gb|ESW33606.1| hypothetical protein PHAVU_001G084000g [Phaseolus vulgaris]
Length=326

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AALKFKGSKAKLNFP
Sbjct  133  KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAAAYDAAALKFKGSKAKLNFP  192

Query  111  ERV  103
            E V
Sbjct  193  EHV  195



>ref|XP_003548854.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Glycine max]
Length=260

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -2

Query  300  GNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            GN R RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AALKFKGSKAK
Sbjct  42   GNGRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAAAYDAAALKFKGSKAK  101

Query  123  LNFPERV  103
            LNFPE V
Sbjct  102  LNFPEHV  108



>ref|XP_006601759.1| PREDICTED: uncharacterized protein LOC100500531 isoform X1 [Glycine 
max]
Length=242

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD+AALKFKG+KAKLNFPER
Sbjct  56   HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDKAALKFKGTKAKLNFPER  115

Query  105  V  103
            V
Sbjct  116  V  116



>gb|KHN13818.1| Ethylene-responsive transcription factor ERF113 [Glycine soja]
Length=242

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD+AALKFKG+KAKLNFPER
Sbjct  56   HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDKAALKFKGTKAKLNFPER  115

Query  105  V  103
            V
Sbjct  116  V  116



>ref|XP_007139323.1| hypothetical protein PHAVU_008G019600g [Phaseolus vulgaris]
 gb|ESW11317.1| hypothetical protein PHAVU_008G019600g [Phaseolus vulgaris]
Length=241

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 3/70 (4%)
 Frame = -2

Query  306  DKGNVRR--HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGS  133
            D+G VR+  HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD AALKFKG+
Sbjct  38   DQG-VRKKAHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDRAALKFKGT  96

Query  132  KAKLNFPERV  103
            KAKLNFPERV
Sbjct  97   KAKLNFPERV  106



>ref|XP_004492035.1| PREDICTED: ethylene-responsive transcription factor ERF113-like, 
partial [Cicer arietinum]
Length=251

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFD AEDAA+AYD+AALKFKG+KAKLNFP+R
Sbjct  99   HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDNAEDAAIAYDKAALKFKGTKAKLNFPQR  158

Query  105  V  103
            +
Sbjct  159  I  159



>ref|XP_007210235.1| hypothetical protein PRUPE_ppa015392mg, partial [Prunus persica]
 gb|EMJ11434.1| hypothetical protein PRUPE_ppa015392mg, partial [Prunus persica]
Length=259

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  306  DKGNVRRH-YRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            D+GNVRR  YRGVRQR WGKWAAEIRDP KA  +WLGT+DTAE AALAYDEAAL FKGSK
Sbjct  88   DRGNVRRQQYRGVRQRKWGKWAAEIRDPNKAVRLWLGTYDTAEAAALAYDEAALGFKGSK  147

Query  129  AKLNFPERVQGKTEL  85
            AKLNFPERVQ  +E 
Sbjct  148  AKLNFPERVQESSEF  162



>gb|KGN63431.1| hypothetical protein Csa_1G000550 [Cucumis sativus]
Length=216

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNFPE
Sbjct  133  RHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGTKAKLNFPE  192

Query  108  RV  103
            R+
Sbjct  193  RL  194



>ref|NP_001239988.1| uncharacterized protein LOC100796480 [Glycine max]
 gb|ACU24559.1| unknown [Glycine max]
 gb|KHN00624.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=228

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            ++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AAL+FKG+KAKLNFP
Sbjct  41   KKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAMAYDAAALRFKGNKAKLNFP  100

Query  111  ERV  103
            ERV
Sbjct  101  ERV  103



>ref|XP_003530479.2| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Glycine max]
 gb|KHN47540.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=277

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = -2

Query  285  HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPER  106
            HYRGVRQRPWGKWAAEIRDPKKAA VWLGTF+TAEDAALAYD+AALKFKG+KAKLNFPER
Sbjct  93   HYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDKAALKFKGTKAKLNFPER  152

Query  105  V  103
            +
Sbjct  153  L  153



>gb|KHN13389.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=239

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            ++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AAL+FKG+KAKLNFP
Sbjct  42   KKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAMAYDAAALRFKGNKAKLNFP  101

Query  111  ERV  103
            ERV
Sbjct  102  ERV  104



>ref|XP_006433144.1| hypothetical protein CICLE_v10003903mg [Citrus clementina]
 gb|ESR46384.1| hypothetical protein CICLE_v10003903mg [Citrus clementina]
Length=223

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 61/66 (92%), Gaps = 1/66 (2%)
 Frame = -2

Query  300  GNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            GNV R H+RGVRQRPWGKWAAEIRDPKKAA +WLGTFDTAE AALAYDEAAL+FKG KAK
Sbjct  117  GNVSRMHFRGVRQRPWGKWAAEIRDPKKAARIWLGTFDTAEAAALAYDEAALRFKGRKAK  176

Query  123  LNFPER  106
            LNFPER
Sbjct  177  LNFPER  182



>ref|XP_003548033.1| PREDICTED: ethylene-responsive transcription factor ERF115-like 
[Glycine max]
Length=239

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            ++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA+AYD AAL+FKG+KAKLNFP
Sbjct  42   KKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAMAYDAAALRFKGNKAKLNFP  101

Query  111  ERV  103
            ERV
Sbjct  102  ERV  104



>emb|CBI21270.3| unnamed protein product [Vitis vinifera]
Length=196

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AAL FKG+KAKLNFP
Sbjct  56   KRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAAAAYDAAALNFKGTKAKLNFP  115

Query  111  ER  106
            ER
Sbjct  116  ER  117



>gb|KHN46843.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=261

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -2

Query  300  GNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAK  124
            GN R RHYRGVRQRPWGKWAAEIRDPKKAA VWLGT DTAE AA AYD AALKFKGSKAK
Sbjct  42   GNGRKRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTLDTAEAAAAAYDAAALKFKGSKAK  101

Query  123  LNFPERV  103
            LNFPE V
Sbjct  102  LNFPEHV  108



>ref|XP_010036849.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW48509.1| hypothetical protein EUGRSUZ_K02193 [Eucalyptus grandis]
Length=266

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
            V R+YRGVRQRPWGK+AAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNF
Sbjct  98   VSRNYRGVRQRPWGKYAAEIRDPKKAARVWLGTFDTAEGAALAYDEAALRFKGNKAKLNF  157

Query  114  PERV  103
            PERV
Sbjct  158  PERV  161



>ref|XP_010036848.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW48508.1| hypothetical protein EUGRSUZ_K02193 [Eucalyptus grandis]
Length=267

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
            V R+YRGVRQRPWGK+AAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNF
Sbjct  99   VSRNYRGVRQRPWGKYAAEIRDPKKAARVWLGTFDTAEGAALAYDEAALRFKGNKAKLNF  158

Query  114  PERV  103
            PERV
Sbjct  159  PERV  162



>gb|ABK26999.1| unknown [Picea sitchensis]
Length=429

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +R YRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAEDAA AYD+AALKF+G++AKLNFP
Sbjct  126  KRRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAARAYDDAALKFRGARAKLNFP  185

Query  111  ERVQGKTE  88
            ERV  + E
Sbjct  186  ERVHVRDE  193



>ref|XP_010037501.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW49201.1| hypothetical protein EUGRSUZ_K02780 [Eucalyptus grandis]
Length=266

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
            V R+YRGVRQRPWGK+AAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNF
Sbjct  98   VSRNYRGVRQRPWGKYAAEIRDPKKAARVWLGTFDTAEGAALAYDEAALRFKGNKAKLNF  157

Query  114  PERV  103
            PERV
Sbjct  158  PERV  161



>ref|XP_010037500.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW49202.1| hypothetical protein EUGRSUZ_K02780 [Eucalyptus grandis]
Length=267

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
            V R+YRGVRQRPWGK+AAEIRDPKKAA VWLGTFDTAE AALAYDEAAL+FKG+KAKLNF
Sbjct  99   VSRNYRGVRQRPWGKYAAEIRDPKKAARVWLGTFDTAEGAALAYDEAALRFKGNKAKLNF  158

Query  114  PERV  103
            PERV
Sbjct  159  PERV  162



>ref|XP_010469440.1| PREDICTED: ethylene-responsive transcription factor ERF112-like 
[Camelina sativa]
Length=216

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N+R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  61   EQSNLRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHK  120

Query  129  AKLNFPERVQ-GKTELRY  79
            AKLNFPE ++   T+L Y
Sbjct  121  AKLNFPENIRINSTQLIY  138



>gb|EPS68061.1| hypothetical protein M569_06713, partial [Genlisea aurea]
Length=143

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  300  GNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKL  121
            G  R+HYRGVR RPWGKWAAEIRDP K A VWLGTFD+ E AA+AYDEAALKFKGSKAKL
Sbjct  69   GRRRQHYRGVRMRPWGKWAAEIRDPGKGARVWLGTFDSPEAAAVAYDEAALKFKGSKAKL  128

Query  120  NFPERVQGK  94
            NFPERV  K
Sbjct  129  NFPERVLQK  137



>ref|XP_010682636.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=300

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA+AYDEAALKFKG+KAKLNFP
Sbjct  80   KRHYRGVRQRPWGKWAAEIRDPIKAARVWLGTFETAEAAAIAYDEAALKFKGTKAKLNFP  139

Query  111  ERV  103
            ERV
Sbjct  140  ERV  142



>ref|XP_010682635.1| PREDICTED: ethylene-responsive transcription factor ERF113 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=301

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +RHYRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA+AYDEAALKFKG+KAKLNFP
Sbjct  81   KRHYRGVRQRPWGKWAAEIRDPIKAARVWLGTFETAEAAAIAYDEAALKFKGTKAKLNFP  140

Query  111  ERV  103
            ERV
Sbjct  141  ERV  143



>ref|XP_004515403.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Cicer arietinum]
Length=228

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            ++HYRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE AA AYD AA KFKG+KAKLNFP
Sbjct  27   KKHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAASAYDAAAYKFKGNKAKLNFP  86

Query  111  ERV  103
            + +
Sbjct  87   QLI  89



>ref|XP_010413824.1| PREDICTED: ethylene-responsive transcription factor ERF112-like 
[Camelina sativa]
Length=216

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  61   EQSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHK  120

Query  129  AKLNFPERVQ-GKTELRY  79
            AKLNFPE ++   T+L Y
Sbjct  121  AKLNFPENIRINSTQLIY  138



>ref|XP_009373701.1| PREDICTED: ethylene-responsive transcription factor ERF114-like 
[Pyrus x bretschneideri]
Length=286

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 69/91 (76%), Gaps = 14/91 (15%)
 Frame = -2

Query  318  ILCFDKGNVRR-HYRGVRQRPWGKWAAEIRDPKKAAGVWL------------GTFDTaed  178
            +L  D+GN+RR HYRGVR+RPWGKWAAEIRDP KAA VWL             TF+TAE 
Sbjct  110  VLLQDQGNLRRQHYRGVRRRPWGKWAAEIRDPNKAARVWLRTFXXXXXXXXXXTFNTAEA  169

Query  177  aalaydeaaLKFKGSKAKLNFPER-VQGKTE  88
            AALAYD AAL+FKGSKAKLNFPER VQG +E
Sbjct  170  AALAYDGAALRFKGSKAKLNFPERVVQGSSE  200



>ref|XP_004142046.1| PREDICTED: uncharacterized protein LOC101207587 [Cucumis sativus]
 ref|XP_004160502.1| PREDICTED: uncharacterized LOC101207587 [Cucumis sativus]
 gb|KGN48406.1| hypothetical protein Csa_6G486790 [Cucumis sativus]
Length=338

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
             RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+GSKAKLNF
Sbjct  130  ARRKYRGVRQRPWGKWAAEIRDPYKAARVWLGTFDTAESAARAYDEAALRFRGSKAKLNF  189

Query  114  PERV  103
            PE V
Sbjct  190  PENV  193



>ref|XP_008440983.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Cucumis 
melo]
Length=339

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
             RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+GSKAKLNF
Sbjct  130  ARRKYRGVRQRPWGKWAAEIRDPYKAARVWLGTFDTAESAARAYDEAALRFRGSKAKLNF  189

Query  114  PERV  103
            PE V
Sbjct  190  PENV  193



>emb|CDY17191.1| BnaA05g09970D [Brassica napus]
Length=216

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  60   EQSNTRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGQK  119

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  120  AKLNFPEHI  128



>emb|CDY27952.1| BnaCnng05370D [Brassica napus]
Length=216

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  60   EQSNTRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGQK  119

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  120  AKLNFPEHI  128



>ref|XP_002452171.1| hypothetical protein SORBIDRAFT_04g021160 [Sorghum bicolor]
 gb|EES05147.1| hypothetical protein SORBIDRAFT_04g021160 [Sorghum bicolor]
Length=247

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            RHYRGVR+RPWGKWAAEIRDP KAA VWLGTFDTAE AA AYD+AAL+FKG+KAKLNFPE
Sbjct  50   RHYRGVRRRPWGKWAAEIRDPAKAARVWLGTFDTAEAAAAAYDDAALRFKGAKAKLNFPE  109

Query  108  RVQGKT  91
            RV+G+T
Sbjct  110  RVRGRT  115



>ref|NP_180927.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
 sp|P93007.1|EF112_ARATH RecName: Full=Ethylene-responsive transcription factor ERF112 
[Arabidopsis thaliana]
 gb|AAC69127.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAM97121.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAN15555.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEC08872.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
Length=218

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            +K N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  61   EKSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHK  120

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  121  AKLNFPEHI  129



>ref|XP_006296339.1| hypothetical protein CARUB_v10025511mg [Capsella rubella]
 gb|EOA29237.1| hypothetical protein CARUB_v10025511mg [Capsella rubella]
Length=214

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            +K N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD AA +F+G K
Sbjct  61   EKSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDRAAFEFRGHK  120

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  121  AKLNFPESI  129



>ref|NP_001189669.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
 gb|AEC08873.1| ethylene-responsive transcription factor ERF112 [Arabidopsis 
thaliana]
Length=231

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            +K N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  61   EKSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHK  120

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  121  AKLNFPEHI  129



>ref|XP_010027738.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Eucalyptus grandis]
Length=348

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  297  NVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLN  118
             VRR YRGVRQRPWGKWAAEIRDP KA+ VWLGTFDTAE AA AYD AAL+F+GSKAKLN
Sbjct  129  TVRRKYRGVRQRPWGKWAAEIRDPFKASRVWLGTFDTAEGAARAYDRAALQFRGSKAKLN  188

Query  117  FPERV  103
            FPE V
Sbjct  189  FPENV  193



>ref|XP_010027737.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Eucalyptus grandis]
Length=349

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  297  NVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLN  118
             VRR YRGVRQRPWGKWAAEIRDP KA+ VWLGTFDTAE AA AYD AAL+F+GSKAKLN
Sbjct  130  TVRRKYRGVRQRPWGKWAAEIRDPFKASRVWLGTFDTAEGAARAYDRAALQFRGSKAKLN  189

Query  117  FPERV  103
            FPE V
Sbjct  190  FPENV  194



>ref|XP_010027739.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X3 [Eucalyptus grandis]
Length=345

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  297  NVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLN  118
             VRR YRGVRQRPWGKWAAEIRDP KA+ VWLGTFDTAE AA AYD AAL+F+GSKAKLN
Sbjct  126  TVRRKYRGVRQRPWGKWAAEIRDPFKASRVWLGTFDTAEGAARAYDRAALQFRGSKAKLN  185

Query  117  FPERV  103
            FPE V
Sbjct  186  FPENV  190



>gb|KDO57151.1| hypothetical protein CISIN_1g039390mg, partial [Citrus sinensis]
Length=263

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAEDAA AYDEAAL+F+G+KAKLNFP
Sbjct  153  RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFP  212

Query  111  ERVQ  100
            E V+
Sbjct  213  ENVK  216



>gb|EEE57097.1| hypothetical protein OsJ_06940 [Oryza sativa Japonica Group]
Length=416

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = -2

Query  315  LCFDKGNV--RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKF  142
            +C   G     RHYRGVR+RPWGKWAAEIRDP KAA VWLGTFDTAE AA AYD+AAL+F
Sbjct  109  VCLTAGAAAAERHYRGVRRRPWGKWAAEIRDPNKAARVWLGTFDTAEAAAAAYDDAALRF  168

Query  141  KGSKAKLNFPERVQGKT  91
            KG+KAKLNFPERV+G+T
Sbjct  169  KGAKAKLNFPERVRGRT  185



>ref|XP_010513072.1| PREDICTED: ethylene-responsive transcription factor ERF112-like 
[Camelina sativa]
Length=337

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  61   EQSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHK  120

Query  129  AKLNFPERVQ-GKTELRY  79
            AKLNFPE ++   T+L Y
Sbjct  121  AKLNFPENIRINSTQLIY  138


 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G KAKLNFP
Sbjct  189  QRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFP  248

Query  111  ERVQGKTELRY  79
            E ++  +   Y
Sbjct  249  ENIRINSTQLY  259



>ref|XP_002881295.1| AP2 domain-containing transcription factor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH57554.1| AP2 domain-containing transcription factor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=218

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  61   EQSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHK  120

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  121  AKLNFPEHI  129



>ref|XP_006427894.1| hypothetical protein CICLE_v10026032mg [Citrus clementina]
 gb|ESR41134.1| hypothetical protein CICLE_v10026032mg [Citrus clementina]
Length=334

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAEDAA AYDEAAL+F+G+KAKLNFP
Sbjct  153  RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFP  212

Query  111  ERVQ  100
            E V+
Sbjct  213  ENVK  216



>ref|XP_009143835.1| PREDICTED: ethylene-responsive transcription factor ERF112-like 
[Brassica rapa]
Length=216

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  60   EQTNTRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGQK  119

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  120  AKLNFPEHI  128



>ref|XP_006464539.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Citrus sinensis]
Length=356

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAEDAA AYDEAAL+F+G+KAKLNFP
Sbjct  154  RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFP  213

Query  111  ERVQ  100
            E V+
Sbjct  214  ENVK  217



>ref|XP_007137573.1| hypothetical protein PHAVU_009G137900g [Phaseolus vulgaris]
 gb|ESW09567.1| hypothetical protein PHAVU_009G137900g [Phaseolus vulgaris]
Length=296

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+G+KAKLNFP
Sbjct  123  RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFP  182

Query  111  ERV  103
            E V
Sbjct  183  ENV  185



>gb|KDP35295.1| hypothetical protein JCGZ_09454 [Jatropha curcas]
Length=284

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+GSKAKLNFP
Sbjct  91   RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGSKAKLNFP  150

Query  111  ERV  103
            E V
Sbjct  151  ENV  153



>ref|XP_006464540.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Citrus sinensis]
Length=355

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAEDAA AYDEAAL+F+G+KAKLNFP
Sbjct  153  RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEDAARAYDEAALRFRGNKAKLNFP  212

Query  111  ERVQ  100
            E V+
Sbjct  213  ENVK  216



>ref|XP_006410514.1| hypothetical protein EUTSA_v10017235mg [Eutrema salsugineum]
 gb|ESQ51967.1| hypothetical protein EUTSA_v10017235mg [Eutrema salsugineum]
Length=210

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -2

Query  306  DKGNVR-RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSK  130
            ++ N R R+YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE+AALAYD+AA +F+G K
Sbjct  60   EQSNSRQRNYRGVRQRPWGKWAAEIRDPNKAARVWLGTFDTAEEAALAYDKAAFEFRGHK  119

Query  129  AKLNFPERV  103
            AKLNFPE +
Sbjct  120  AKLNFPEHI  128



>gb|EPS73412.1| hypothetical protein M569_01357 [Genlisea aurea]
Length=276

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  300  GNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKL  121
            G  +R YRGVRQRPWGKWAAEIRDP+KAA VWLGTFDTAE AA AYDEAAL+F+G++AKL
Sbjct  144  GETQRKYRGVRQRPWGKWAAEIRDPQKAARVWLGTFDTAEAAARAYDEAALRFRGNRAKL  203

Query  120  NFPERV  103
            NFPE V
Sbjct  204  NFPESV  209



>ref|XP_010680295.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Beta 
vulgaris subsp. vulgaris]
Length=385

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA AYDEAALKF+GSKAKLNFP
Sbjct  193  RRKYRGVRQRPWGKWAAEIRDPYKAARVWLGTFETAEAAARAYDEAALKFRGSKAKLNFP  252

Query  111  ERV  103
            E V
Sbjct  253  ENV  255



>ref|XP_010025536.1| PREDICTED: ethylene-responsive transcription factor ERF110-like 
[Eucalyptus grandis]
 gb|KCW62231.1| hypothetical protein EUGRSUZ_H04892 [Eucalyptus grandis]
Length=282

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -2

Query  315  LCFDKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKG  136
            +  D+   RR YRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA AYD AALK++G
Sbjct  121  MSNDEHQPRRKYRGVRQRPWGKWAAEIRDPVKAARVWLGTFETAEGAAQAYDVAALKYRG  180

Query  135  SKAKLNFPERVQGKTEL  85
            +KAKLNFPE V  +  L
Sbjct  181  NKAKLNFPENVVARLSL  197



>dbj|BAG50064.1| transcription factor AP2-EREBP [Lotus japonicus]
Length=422

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D G  RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+G++A
Sbjct  187  DTGERRRKYRGVRQRPWGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRA  246

Query  126  KLNFPE  109
            KLNFPE
Sbjct  247  KLNFPE  252



>gb|KHN09568.1| Ethylene-responsive transcription factor ERF114 [Glycine soja]
Length=322

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+G  RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+G+KA
Sbjct  131  DEG--RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEAAARAYDEAALRFRGNKA  188

Query  126  KLNFPERV  103
            KLNFPE V
Sbjct  189  KLNFPENV  196



>ref|XP_011464560.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=325

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  294  VRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNF  115
             RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYD AAL+F+G+KAKLNF
Sbjct  125  TRRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAEAAAQAYDTAALRFRGNKAKLNF  184

Query  114  PERV  103
            PE V
Sbjct  185  PENV  188



>ref|XP_011025557.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Populus euphratica]
Length=322

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +R YRGVRQRPWGKWAAEIRDP KAA VWLGTFDT E AA AYDEAAL+F+GSKAKLNFP
Sbjct  122  QRKYRGVRQRPWGKWAAEIRDPMKAARVWLGTFDTPEAAARAYDEAALRFRGSKAKLNFP  181

Query  111  ERVQ  100
            E V+
Sbjct  182  ENVK  185



>ref|XP_010096464.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXB64474.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=335

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            R YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+G+KAKLNFPE
Sbjct  157  RKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFDTAESAARAYDEAALRFRGNKAKLNFPE  216

Query  108  RV  103
             V
Sbjct  217  NV  218



>ref|XP_006581744.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X2 [Glycine max]
Length=254

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+G  RR YRGVRQRPWGKWAAEIRDP +AA VWLGTFDTAE AA AYDEAAL+F+G+KA
Sbjct  63   DEG--RRKYRGVRQRPWGKWAAEIRDPVEAARVWLGTFDTAEAAARAYDEAALRFRGNKA  120

Query  126  KLNFPERV  103
            KLNFPE V
Sbjct  121  KLNFPENV  128



>ref|XP_003523249.1| PREDICTED: ethylene-responsive transcription factor ABR1 [Glycine 
max]
Length=281

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            RR YRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA AYDEAAL+F+GSKAKLNFP
Sbjct  133  RRKYRGVRQRPWGKWAAEIRDPFKAARVWLGTFETAEAAARAYDEAALRFRGSKAKLNFP  192

Query  111  ERV  103
            E V
Sbjct  193  ENV  195



>ref|XP_003528031.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
isoform X1 [Glycine max]
Length=322

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            D+G  RR YRGVRQRPWGKWAAEIRDP +AA VWLGTFDTAE AA AYDEAAL+F+G+KA
Sbjct  131  DEG--RRKYRGVRQRPWGKWAAEIRDPVEAARVWLGTFDTAEAAARAYDEAALRFRGNKA  188

Query  126  KLNFPERV  103
            KLNFPE V
Sbjct  189  KLNFPENV  196



>ref|XP_011101230.1| PREDICTED: ethylene-responsive transcription factor ABR1-like 
[Sesamum indicum]
Length=417

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            + G  RR YRGVRQRPWGKWAAEIRDP KAA VWLGTFDTAE AA AYDEAAL+F+G++A
Sbjct  205  ETGERRRKYRGVRQRPWGKWAAEIRDPHKAARVWLGTFDTAEAAARAYDEAALRFRGNRA  264

Query  126  KLNFPERV  103
            KLNFPE V
Sbjct  265  KLNFPENV  272



>ref|XP_001764298.1| predicted protein [Physcomitrella patens]
 gb|EDQ70852.1| predicted protein, partial [Physcomitrella patens]
Length=61

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -2

Query  291  RRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFP  112
            +R YRGVRQRPWGKWAAEIRDPKKAA VWLGTFDTAE+AA+AYD +A KF+G +AKLNFP
Sbjct  2    KRRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEEAAMAYDISATKFRGLRAKLNFP  61



>gb|EAY86070.1| hypothetical protein OsI_07439 [Oryza sativa Indica Group]
Length=260

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  288  RHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKAKLNFPE  109
            RHYRGVR+RPWGKWAAEIRDP KAA VWLGTFDTAE AA AYD+AAL+FKG+KAKLNFPE
Sbjct  85   RHYRGVRRRPWGKWAAEIRDPNKAARVWLGTFDTAEAAAAAYDDAALRFKGAKAKLNFPE  144

Query  108  RVQGKT  91
            RV+G+T
Sbjct  145  RVRGRT  150



>ref|XP_009408302.1| PREDICTED: ethylene-responsive transcription factor ERF113-like 
[Musa acuminata subsp. malaccensis]
Length=225

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  306  DKGNVRRHYRGVRQRPWGKWAAEIRDPKKAAGVWLGTFDTaedaalaydeaaLKFKGSKA  127
            ++   +R YRGVRQRPWGKWAAEIRDP KAA VWLGTF+TAE AA AYDEAAL+F+GS+A
Sbjct  20   EEAAAQRKYRGVRQRPWGKWAAEIRDPHKAARVWLGTFETAEQAARAYDEAALRFRGSRA  79

Query  126  KLNFPERV  103
            KLNFPE V
Sbjct  80   KLNFPENV  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090