BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018G01 619 bp,

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010922296.1|  PREDICTED: uncharacterized protein At2g37660...    330   7e-111   Elaeis guineensis
ref|XP_011094871.1|  PREDICTED: uncharacterized protein At5g02240       326   1e-108   Sesamum indicum [beniseed]
ref|XP_008785605.1|  PREDICTED: uncharacterized protein At5g02240...    325   2e-108   Phoenix dactylifera
gb|KHN40295.1|  Hypothetical protein glysoja_000793                     325   5e-108   Glycine soja [wild soybean]
ref|NP_001241503.1|  uncharacterized protein LOC100794855               325   5e-108   Glycine max [soybeans]
ref|XP_010262541.1|  PREDICTED: uncharacterized protein At5g02240...    322   2e-107   Nelumbo nucifera [Indian lotus]
gb|ACJ84528.1|  unknown                                                 320   3e-107   Medicago truncatula
gb|KHN13994.1|  Hypothetical protein glysoja_025011                     320   4e-107   Glycine soja [wild soybean]
ref|XP_003552177.1|  PREDICTED: uncharacterized protein At2g37660...    320   6e-107   Glycine max [soybeans]
gb|KDP35646.1|  hypothetical protein JCGZ_09084                         319   7e-107   Jatropha curcas
gb|KEH29065.1|  NAD(P)-binding rossmann-fold protein                    319   8e-107   Medicago truncatula
emb|CBI30539.3|  unnamed protein product                                318   2e-106   Vitis vinifera
gb|AGT17323.1|  NAD-dependent epimerase/dehydratase                     318   2e-106   Saccharum hybrid cultivar R570
ref|XP_009758868.1|  PREDICTED: uncharacterized protein At5g02240       320   3e-106   Nicotiana sylvestris
ref|XP_003563550.1|  PREDICTED: uncharacterized protein At5g02240...    318   3e-106   Brachypodium distachyon [annual false brome]
ref|XP_004246424.1|  PREDICTED: uncharacterized protein At5g02240       318   8e-106   Solanum lycopersicum
ref|XP_006341016.1|  PREDICTED: uncharacterized protein At2g37660...    318   8e-106   Solanum tuberosum [potatoes]
ref|XP_010654260.1|  PREDICTED: uncharacterized protein At5g02240       319   1e-105   Vitis vinifera
ref|XP_004516489.1|  PREDICTED: uncharacterized protein At2g37660...    315   4e-105   Cicer arietinum [garbanzo]
tpg|DAA52226.1|  TPA: NAD-dependent epimerase/dehydratase               315   4e-105   Zea mays [maize]
ref|XP_004302740.1|  PREDICTED: uncharacterized protein At5g02240       317   4e-105   Fragaria vesca subsp. vesca
ref|NP_001051733.1|  Os03g0822200                                       315   5e-105   
ref|XP_004981238.1|  PREDICTED: uncharacterized protein At2g37660...    315   6e-105   Setaria italica
ref|NP_001148959.1|  NAD-dependent epimerase/dehydratase                315   6e-105   Zea mays [maize]
ref|XP_004142064.1|  PREDICTED: uncharacterized protein At2g37660...    316   1e-104   Cucumis sativus [cucumbers]
ref|XP_009587189.1|  PREDICTED: uncharacterized protein At5g02240...    315   2e-104   Nicotiana tomentosiformis
ref|XP_008448031.1|  PREDICTED: uncharacterized protein At5g02240       315   3e-104   Cucumis melo [Oriental melon]
gb|EMT23678.1|  hypothetical protein F775_31621                         313   4e-104   Aegilops tauschii
ref|XP_002530987.1|  conserved hypothetical protein                     315   5e-104   Ricinus communis
ref|XP_006480841.1|  PREDICTED: uncharacterized protein At2g37660...    315   5e-104   Citrus sinensis [apfelsine]
ref|XP_006429112.1|  hypothetical protein CICLE_v10012166mg             314   1e-103   Citrus clementina
gb|KHG19677.1|  hypothetical protein F383_06456                         314   1e-103   Gossypium arboreum [tree cotton]
gb|AFM52663.1|  putative NAD-dependent dehydrogenase 2                  311   1e-103   Erythroxylum coca [coca]
ref|XP_011019848.1|  PREDICTED: uncharacterized protein At5g02240       313   2e-103   Populus euphratica
ref|XP_009404595.1|  PREDICTED: uncharacterized protein At5g02240       311   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36701.1|  hypothetical protein B456_006G171900                    311   4e-103   Gossypium raimondii
gb|KJB36699.1|  hypothetical protein B456_006G171900                    313   4e-103   Gossypium raimondii
ref|XP_010920552.1|  PREDICTED: uncharacterized protein At5g02240...    311   6e-103   Elaeis guineensis
ref|XP_006294589.1|  hypothetical protein CARUB_v10023624mg             311   7e-103   Capsella rubella
ref|XP_007026993.1|  NAD(P)-binding Rossmann-fold superfamily pro...    311   2e-102   Theobroma cacao [chocolate]
ref|XP_006650811.1|  PREDICTED: uncharacterized protein At2g37660...    308   3e-102   Oryza brachyantha
ref|XP_007134007.1|  hypothetical protein PHAVU_010G011300g             307   3e-102   Phaseolus vulgaris [French bean]
ref|XP_009122796.1|  PREDICTED: uncharacterized protein At5g02240       307   4e-102   Brassica rapa
emb|CDX93359.1|  BnaC04g45370D                                          309   6e-102   Brassica napus [oilseed rape]
emb|CDY40342.1|  BnaA10g27260D                                          306   8e-102   Brassica napus [oilseed rape]
emb|CDY65254.1|  BnaA04g29010D                                          308   1e-101   Brassica napus [oilseed rape]
ref|XP_009345400.1|  PREDICTED: uncharacterized protein At5g02240...    308   1e-101   Pyrus x bretschneideri [bai li]
gb|EYU41733.1|  hypothetical protein MIMGU_mgv1a010429mg                308   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_008369910.1|  PREDICTED: uncharacterized protein At5g02240...    308   1e-101   Malus domestica [apple tree]
ref|XP_008387781.1|  PREDICTED: uncharacterized protein At5g02240...    308   2e-101   Malus domestica [apple tree]
ref|XP_002309064.2|  hypothetical protein POPTR_0006s08710g             308   2e-101   Populus trichocarpa [western balsam poplar]
gb|AFK49538.1|  unknown                                                 308   2e-101   Medicago truncatula
ref|XP_009141679.1|  PREDICTED: uncharacterized protein At2g37660...    308   3e-101   Brassica rapa
ref|XP_007205763.1|  hypothetical protein PRUPE_ppa010325mg             305   4e-101   Prunus persica
ref|XP_008240773.1|  PREDICTED: uncharacterized protein At5g02240       307   4e-101   Prunus mume [ume]
ref|XP_009341745.1|  PREDICTED: uncharacterized protein At5g02240...    307   5e-101   Pyrus x bretschneideri [bai li]
ref|XP_010111446.1|  hypothetical protein L484_021269                   307   5e-101   Morus notabilis
gb|AFK40676.1|  unknown                                                 306   5e-101   Lotus japonicus
ref|NP_565868.1|  NAD(P)-binding Rossmann-fold-containing protein       307   5e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36667.1|  hypothetical protein AALP_AA4G154200                    307   5e-101   Arabis alpina [alpine rockcress]
ref|XP_006846253.1|  hypothetical protein AMTR_s00012p00241210          304   7e-101   
ref|XP_008784609.1|  PREDICTED: uncharacterized protein At5g02240...    306   8e-101   Phoenix dactylifera
emb|CDY10458.1|  BnaCnng03590D                                          303   1e-100   Brassica napus [oilseed rape]
gb|EPS62696.1|  hypothetical protein M569_12093                         303   1e-100   Genlisea aurea
gb|KFK36666.1|  hypothetical protein AALP_AA4G154200                    307   1e-100   Arabis alpina [alpine rockcress]
ref|XP_009143466.1|  PREDICTED: uncharacterized protein At2g37660...    306   1e-100   Brassica rapa
ref|XP_004492363.1|  PREDICTED: uncharacterized protein At2g37660...    305   4e-100   Cicer arietinum [garbanzo]
gb|EAY96261.1|  hypothetical protein OsI_18159                          303   5e-100   Oryza sativa Indica Group [Indian rice]
gb|KFK24707.1|  hypothetical protein AALP_AA8G014100                    301   6e-100   Arabis alpina [alpine rockcress]
ref|XP_002439133.1|  hypothetical protein SORBIDRAFT_09g001130          303   7e-100   Sorghum bicolor [broomcorn]
ref|XP_010553281.1|  PREDICTED: uncharacterized protein At5g02240       304   8e-100   Tarenaya hassleriana [spider flower]
ref|XP_010509296.1|  PREDICTED: uncharacterized protein At2g37660...    303   1e-99    Camelina sativa [gold-of-pleasure]
ref|NP_001054439.1|  Os05g0110300                                       302   1e-99    
ref|XP_010517038.1|  PREDICTED: uncharacterized protein At2g37660...    302   3e-99    Camelina sativa [gold-of-pleasure]
ref|NP_568098.1|  ABA modulated tyrosine-phosphorylated protein         299   7e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543294.1|  PREDICTED: uncharacterized protein At5g02240       299   8e-99    Tarenaya hassleriana [spider flower]
pdb|1XQ6|A  Chain A, X-ray Structure Of Gene Product From Arabido...    299   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505358.1|  PREDICTED: uncharacterized protein At2g37660...    301   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006410956.1|  hypothetical protein EUTSA_v10016917mg             301   2e-98    Eutrema salsugineum
gb|AFK33771.1|  unknown                                                 298   2e-98    Lotus japonicus
ref|XP_004960531.1|  PREDICTED: uncharacterized protein At2g37660...    300   2e-98    Setaria italica
ref|XP_010490641.1|  PREDICTED: uncharacterized protein At5g02240...    298   2e-98    Camelina sativa [gold-of-pleasure]
gb|ABK22551.1|  unknown                                                 297   3e-98    Picea sitchensis
ref|XP_006653962.1|  PREDICTED: uncharacterized protein At2g37660...    299   3e-98    Oryza brachyantha
ref|XP_010452056.1|  PREDICTED: uncharacterized protein At5g02240       297   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006398688.1|  hypothetical protein EUTSA_v10014474mg             296   5e-98    Eutrema salsugineum
ref|XP_002870963.1|  catalytic/ coenzyme binding protein                296   1e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_010423884.1|  PREDICTED: uncharacterized protein At5g02240...    295   2e-97    Camelina sativa [gold-of-pleasure]
ref|NP_001132564.1|  uncharacterized protein LOC100194029               296   2e-97    Zea mays [maize]
ref|XP_010047753.1|  PREDICTED: uncharacterized protein At5g02240...    298   3e-97    Eucalyptus grandis [rose gum]
emb|CAB82997.1|  putative protein                                       298   9e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86066.1|  predicted protein                                      296   1e-96    Hordeum vulgare subsp. vulgare [barley]
ref|XP_004167131.1|  PREDICTED: uncharacterized protein At2g37660...    292   1e-96    
gb|KDO51169.1|  hypothetical protein CISIN_1g0462972mg                  287   2e-94    Citrus sinensis [apfelsine]
dbj|BAH57079.1|  AT2G37660                                              287   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569100.1|  PREDICTED: uncharacterized protein At5g02240...    286   2e-93    Brachypodium distachyon [annual false brome]
ref|XP_010678098.1|  PREDICTED: uncharacterized protein At5g02240...    285   4e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001757861.1|  predicted protein                                  277   2e-90    Physcomitrella patens
ref|XP_001778983.1|  predicted protein                                  271   4e-88    Physcomitrella patens
ref|XP_002988949.1|  hypothetical protein SELMODRAFT_184267             267   5e-86    Selaginella moellendorffii
ref|XP_002974930.1|  hypothetical protein SELMODRAFT_174568             266   1e-85    Selaginella moellendorffii
gb|KJB36702.1|  hypothetical protein B456_006G171900                    264   3e-85    Gossypium raimondii
ref|XP_002968769.1|  hypothetical protein SELMODRAFT_170290             263   5e-85    Selaginella moellendorffii
ref|XP_007140520.1|  hypothetical protein PHAVU_008G1196001g            263   8e-85    Phaseolus vulgaris [French bean]
gb|EMT06006.1|  hypothetical protein F775_17756                         265   2e-84    Aegilops tauschii
ref|XP_002992894.1|  hypothetical protein SELMODRAFT_272296             261   7e-84    Selaginella moellendorffii
ref|XP_001770526.1|  predicted protein                                  259   2e-83    Physcomitrella patens
emb|CDP06601.1|  unnamed protein product                                256   3e-82    Coffea canephora [robusta coffee]
sp|D5JWB3.1|SARED_ESCCA  RecName: Full=Sanguinarine reductase           248   7e-79    Eschscholzia californica
ref|XP_007026994.1|  NAD(P)-binding Rossmann-fold superfamily pro...    225   2e-70    Theobroma cacao [chocolate]
ref|WP_012595226.1|  MULTISPECIES: oxidoreductase                       224   2e-69    Cyanothece
gb|EPS64191.1|  hypothetical protein M569_10591                         219   6e-69    Genlisea aurea
ref|WP_009547288.1|  MULTISPECIES: oxidoreductase                       221   3e-68    Cyanothece
ref|WP_037217028.1|  oxidoreductase                                     220   5e-68    
emb|CDN10891.1|  FIG00557133: hypothetical protein                      221   5e-68    Richelia intracellularis
ref|WP_007311164.1|  oxidoreductase                                     216   2e-66    Crocosphaera watsonii
emb|CDX91377.1|  BnaC04g07730D                                          216   4e-66    Brassica napus [oilseed rape]
ref|WP_035988067.1|  oxidoreductase                                     215   5e-66    Leptolyngbya sp. KIOST-1
ref|WP_015194351.1|  hypothetical protein                               215   5e-66    Stanieria cyanosphaera
ref|WP_008275107.1|  oxidoreductase                                     215   6e-66    Cyanothece sp. CCY0110
ref|WP_007305960.1|  oxidoreductase                                     213   3e-65    Crocosphaera watsonii
ref|WP_019504148.1|  hypothetical protein                               213   4e-65    Pleurocapsa sp. PCC 7319
ref|WP_015955597.1|  oxidoreductase                                     212   8e-65    Cyanothece sp. PCC 7424
gb|ELR99517.1|  putative nucleoside-diphosphate sugar epimerase         211   2e-64    Gloeocapsa sp. PCC 73106
ref|WP_034935338.1|  oxidoreductase                                     211   2e-64    Gloeocapsa sp. PCC 73106
ref|WP_017301000.1|  hypothetical protein                               210   5e-64    Nodosilinea nodulosa
ref|WP_013324891.1|  oxidoreductase                                     210   5e-64    Cyanothece sp. PCC 7822
ref|XP_008784610.1|  PREDICTED: uncharacterized protein At2g37660...    209   1e-63    Phoenix dactylifera
ref|WP_040939321.1|  oxidoreductase                                     209   2e-63    
ref|WP_040944459.1|  oxidoreductase                                     208   2e-63    
ref|WP_017294761.1|  hypothetical protein                               208   2e-63    Geminocystis herdmanii
ref|WP_036484465.1|  oxidoreductase                                     208   3e-63    Myxosarcina sp. GI1
ref|XP_009606944.1|  PREDICTED: uncharacterized protein LOC104101207    209   3e-63    Nicotiana tomentosiformis
gb|KJB36703.1|  hypothetical protein B456_006G171900                    207   1e-62    Gossypium raimondii
ref|WP_015223672.1|  NAD-dependent epimerase/dehydratase                206   2e-62    
ref|WP_015225627.1|  NAD-dependent epimerase/dehydratase                204   1e-61    Halothece sp. PCC 7418
ref|WP_015229215.1|  nucleoside-diphosphate sugar epimerase             204   1e-61    Dactylococcopsis salina
ref|WP_006518553.1|  putative nucleoside-diphosphate sugar epimerase    202   6e-61    Leptolyngbya sp. PCC 7375
ref|WP_028946514.1|  oxidoreductase                                     202   7e-61    Synechocystis sp. PCC 6714
ref|WP_018397631.1|  hypothetical protein                               200   4e-60    filamentous cyanobacterium ESFC-1
ref|XP_009609439.1|  PREDICTED: uncharacterized protein At2g37660...    195   8e-60    Nicotiana tomentosiformis
ref|WP_006511619.1|  nucleoside-diphosphate-sugar epimerase             198   2e-59    Xenococcus sp. PCC 7305
ref|XP_005648558.1|  NAD(P)-binding protein                             197   7e-59    Coccomyxa subellipsoidea C-169
ref|WP_041764708.1|  oxidoreductase                                     195   4e-58    Leptolyngbya sp. PCC 7376
ref|WP_012160758.1|  oxidoreductase                                     195   4e-58    Acaryochloris marina
gb|AFY36871.1|  NAD-dependent epimerase/dehydratase                     194   7e-58    Leptolyngbya sp. PCC 7376
ref|WP_010477937.1|  oxidoreductase                                     194   7e-58    Acaryochloris sp. CCMEE 5410
ref|WP_027845500.1|  oxidoreductase                                     183   2e-53    Mastigocoleus testarum
emb|CDX74941.1|  BnaA05g06870D                                          181   3e-52    Brassica napus [oilseed rape]
ref|XP_002507838.1|  predicted protein                                  179   1e-51    Micromonas commoda
ref|XP_001695427.1|  isomerase                                          177   6e-51    Chlamydomonas reinhardtii
ref|XP_005847390.1|  hypothetical protein CHLNCDRAFT_134220             179   7e-50    Chlorella variabilis
ref|XP_005710888.1|  unnamed protein product                            171   2e-48    Chondrus crispus [carageen]
gb|AIE43895.1|  WRKY transcription factor 38                            178   6e-48    Gossypium hirsutum [American cotton]
gb|KIY93432.1|  Uncharacterized protein MNEG_14531                      170   8e-48    Monoraphidium neglectum
ref|XP_005786583.1|  hypothetical protein EMIHUDRAFT_429362             169   1e-47    Emiliania huxleyi CCMP1516
ref|XP_009035991.1|  hypothetical protein AURANDRAFT_5707               164   8e-46    Aureococcus anophagefferens
ref|WP_044077164.1|  oxidoreductase                                     160   9e-46    
ref|XP_002958587.1|  hypothetical protein VOLCADRAFT_84511              161   2e-44    Volvox carteri f. nagariensis
gb|EWM30532.1|  NAD(P)-binding domain protein                           160   7e-44    Nannochloropsis gaditana
ref|XP_005770740.1|  hypothetical protein EMIHUDRAFT_349981             154   5e-42    Emiliania huxleyi CCMP1516
ref|XP_005788669.1|  hypothetical protein EMIHUDRAFT_362530             153   8e-42    Emiliania huxleyi CCMP1516
ref|XP_005839875.1|  hypothetical protein GUITHDRAFT_84495              152   4e-41    Guillardia theta CCMP2712
ref|XP_003062210.1|  predicted protein                                  150   2e-40    Micromonas pusilla CCMP1545
tpg|DAA52225.1|  TPA: hypothetical protein ZEAMMB73_650028              144   5e-40    Zea mays [maize]
gb|KJB36700.1|  hypothetical protein B456_006G171900                    144   6e-39    Gossypium raimondii
ref|XP_002288380.1|  predicted protein                                  139   8e-37    Thalassiosira pseudonana CCMP1335
ref|XP_002186209.1|  predicted protein                                  137   2e-35    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002296271.1|  predicted protein                                  127   6e-32    Thalassiosira pseudonana CCMP1335
ref|XP_005705127.1|  3-beta hydroxysteroid dehydrogenase/isomerase      126   2e-31    Galdieria sulphuraria
gb|EJK60442.1|  hypothetical protein THAOC_19209                        127   4e-31    Thalassiosira oceanica
emb|CBN76881.1|  conserved unknown protein                              125   2e-30    Ectocarpus siliculosus
gb|EJK67090.1|  hypothetical protein THAOC_11921                        122   5e-30    Thalassiosira oceanica
gb|EEE62068.1|  hypothetical protein OsJ_16852                          120   1e-29    Oryza sativa Japonica Group [Japonica rice]
gb|AFW74983.1|  hypothetical protein ZEAMMB73_772170                    115   8e-29    Zea mays [maize]
ref|XP_005791215.1|  hypothetical protein EMIHUDRAFT_466780             117   5e-28    Emiliania huxleyi CCMP1516
ref|XP_005757543.1|  hypothetical protein EMIHUDRAFT_466065             117   5e-28    Emiliania huxleyi CCMP1516
ref|WP_023070463.1|  nad-dependent epimerase dehydratase                104   1e-23    Leptolyngbya sp. Heron Island J
ref|WP_006519783.1|  NmrA family protein                                101   2e-22    Leptolyngbya sp. PCC 7375
ref|WP_006456242.1|  epimerase                                        99.0    1e-21    Synechococcus sp. PCC 7335
ref|WP_028949158.1|  epimerase                                        97.4    4e-21    Synechocystis sp. PCC 6714
ref|WP_010872727.1|  epimerase                                        95.9    1e-20    Synechocystis sp. PCC 6803
ref|WP_039713160.1|  epimerase                                        95.9    2e-20    Scytonema millei
ref|WP_010471494.1|  epimerase                                        94.4    5e-20    Acaryochloris sp. CCMEE 5410
ref|WP_012164442.1|  epimerase                                        94.0    6e-20    Acaryochloris marina
ref|WP_015156952.1|  NAD-dependent epimerase/dehydratase              94.0    7e-20    Chroococcidiopsis thermalis
ref|WP_011143473.1|  hypothetical protein                             94.0    8e-20    Gloeobacter violaceus
ref|WP_024124178.1|  NAD-dependent epimerase/dehydratase family p...  94.0    8e-20    Thermosynechococcus sp. NK55a
ref|WP_017718373.1|  epimerase                                        93.6    1e-19    Oscillatoria sp. PCC 10802
ref|WP_039728337.1|  MULTISPECIES: epimerase                          93.2    1e-19    Cyanobacteria [blue-green bacteria]
ref|WP_011432166.1|  epimerase                                        92.8    2e-19    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_026072506.1|  epimerase                                        92.4    2e-19    Nodosilinea nodulosa
ref|WP_017289740.1|  epimerase                                        92.0    4e-19    Leptolyngbya boryana
ref|WP_015127276.1|  NAD-dependent epimerase/dehydratase              92.0    4e-19    Calothrix sp. PCC 7507
ref|WP_017316059.1|  epimerase                                        91.7    4e-19    Mastigocladopsis repens
ref|WP_013324345.1|  epimerase                                        91.7    5e-19    Cyanothece sp. PCC 7822
emb|CCA30158.1|  NAD-dependent epimerase/dehydratase, related         95.5    5e-19    Neospora caninum Liverpool
emb|CCH68282.1|  expressed protein                                    91.7    5e-19    Richelia intracellularis HH01
ref|WP_027842548.1|  epimerase                                        91.7    5e-19    Mastigocoleus testarum
ref|WP_044304998.1|  epimerase                                        91.7    5e-19    Richelia intracellularis
ref|WP_022604720.1|  NmrA-like family                                 91.3    6e-19    Rubidibacter lacunae
ref|WP_013192267.1|  epimerase                                        91.3    6e-19    Trichormus azollae
ref|WP_015174595.1|  NAD-dependent epimerase/dehydratase              90.9    8e-19    Oscillatoria nigro-viridis
ref|WP_035987612.1|  epimerase                                        90.9    8e-19    Leptolyngbya sp. KIOST-1
ref|WP_035155764.1|  epimerase                                        90.9    1e-18    Calothrix sp. 336/3
ref|WP_007355363.1|  MULTISPECIES: epimerase                          90.9    1e-18    Kamptonema
ref|WP_026723160.1|  epimerase                                        90.5    1e-18    Fischerella sp. PCC 9431
ref|WP_016859245.1|  epimerase                                        90.5    1e-18    Fischerella muscicola
ref|WP_011430008.1|  epimerase                                        90.5    1e-18    Synechococcus sp. JA-3-3Ab
ref|WP_016874231.1|  epimerase                                        90.5    1e-18    Chlorogloeopsis fritschii
gb|AFM92601.1|  NAD dependent epimerase/dehydratase family protein    90.5    1e-18    Acaryochloris sp. HICR111A
ref|WP_009634592.1|  NmrA-like family protein                         90.5    1e-18    Synechocystis sp. PCC 7509
ref|WP_012406916.1|  epimerase                                        90.5    1e-18    Nostoc punctiforme
ref|WP_041034656.1|  epimerase                                        90.1    1e-18    Tolypothrix campylonemoides
ref|WP_006633149.1|  epimerase                                        90.1    2e-18    Microcoleus vaginatus
ref|WP_015164803.1|  NAD-dependent epimerase/dehydratase              90.1    2e-18    Pseudanabaena sp. PCC 7367
ref|WP_015213145.1|  NAD-dependent epimerase/dehydratase              90.1    2e-18    Anabaena cylindrica
ref|WP_008180003.1|  epimerase                                        89.7    2e-18    Moorea producens
ref|WP_039742689.1|  epimerase                                        89.7    2e-18    Hassallia byssoidea
ref|WP_011243331.1|  MULTISPECIES: epimerase                          89.7    3e-18    Synechococcus
ref|XP_006290196.1|  hypothetical protein CARUB_v10003881mg           87.0    3e-18    Capsella rubella
ref|WP_017312818.1|  epimerase                                        89.4    3e-18    Fischerella sp. PCC 9339
ref|WP_016517309.1|  NAD(P)H azoreductase                             89.4    3e-18    Microcystis aeruginosa
ref|WP_009555297.1|  NmrA family protein                              89.0    5e-18    Oscillatoriales cyanobacterium JSC-12
ref|WP_015194269.1|  NAD-dependent epimerase/dehydratase              89.0    5e-18    Stanieria cyanosphaera
ref|WP_002783143.1|  hypothetical protein                             89.0    5e-18    Microcystis aeruginosa
ref|WP_015203644.1|  NAD-dependent epimerase/dehydratase              88.6    6e-18    Crinalium epipsammum
ref|WP_002803673.1|  epimerase                                        88.6    6e-18    Microcystis aeruginosa
ref|WP_002771890.1|  epimerase                                        88.6    6e-18    Microcystis aeruginosa
ref|WP_015146515.1|  putative nucleoside-diphosphate sugar epimerase  88.6    6e-18    Oscillatoria acuminata
ref|WP_002740403.1|  hypothetical protein                             88.6    7e-18    Microcystis aeruginosa
ref|WP_036530800.1|  epimerase                                        88.2    7e-18    Neosynechococcus sphagnicola
gb|KIJ81213.1|  epimerase                                             88.2    7e-18    Scytonema tolypothrichoides VB-61278
ref|WP_024969194.1|  epimerase                                        88.2    8e-18    Microcystis aeruginosa
ref|WP_029632779.1|  epimerase [                                      88.2    9e-18    [Scytonema hofmanni] UTEX B 1581
ref|WP_010996904.1|  epimerase                                        88.2    9e-18    Nostoc sp. PCC 7120
ref|WP_002792219.1|  epimerase                                        88.2    9e-18    Microcystis aeruginosa
ref|WP_004158116.1|  epimerase                                        88.2    9e-18    Microcystis aeruginosa
ref|WP_009344660.1|  epimerase                                        87.8    9e-18    Raphidiopsis brookii
ref|WP_002775498.1|  epimerase                                        88.2    9e-18    Microcystis aeruginosa
ref|WP_008201892.1|  epimerase                                        87.8    1e-17    Microcystis sp. T1-4
ref|WP_012265515.1|  epimerase                                        87.8    1e-17    Microcystis aeruginosa
ref|WP_037222078.1|  epimerase                                        87.8    1e-17    
ref|WP_002761432.1|  epimerase                                        87.8    1e-17    Microcystis aeruginosa
ref|WP_002734230.1|  hypothetical protein                             87.8    1e-17    Microcystis aeruginosa
dbj|GAL93244.1|  expressed protein                                    87.8    1e-17    Microcystis aeruginosa NIES-44
ref|WP_015185335.1|  NmrA-like family protein                         87.4    1e-17    Microcoleus sp. PCC 7113
ref|WP_026785392.1|  MULTISPECIES: epimerase                          87.4    1e-17    Planktothrix
ref|WP_040940046.1|  epimerase                                        87.4    2e-17    
ref|WP_006197655.1|  epimerase                                        87.4    2e-17    Nodularia spumigena
ref|WP_011320995.1|  epimerase                                        87.4    2e-17    
ref|WP_027255354.1|  epimerase                                        87.4    2e-17    Planktothrix agardhii
ref|WP_006276071.1|  epimerase                                        87.0    2e-17    Cylindrospermopsis raciborskii
ref|WP_008313356.1|  NmrA-like family protein                         87.0    2e-17    Leptolyngbya sp. PCC 6406
gb|EPS67094.1|  hypothetical protein M569_07683                       84.3    2e-17    Genlisea aurea
ref|WP_002796754.1|  epimerase                                        86.7    3e-17    Microcystis aeruginosa
ref|WP_015221365.1|  NAD-dependent epimerase/dehydratase              86.7    3e-17    
ref|WP_016950426.1|  epimerase                                        86.7    3e-17    Anabaena sp. PCC 7108 [Anabaena PCC7108]
ref|WP_017652236.1|  epimerase                                        86.7    3e-17    Fortiea contorta
ref|WP_026796369.1|  epimerase                                        86.7    3e-17    Planktothrix prolifica
ref|WP_036476675.1|  epimerase                                        86.7    3e-17    Myxosarcina sp. GI1
ref|WP_044452465.1|  epimerase                                        85.9    3e-17    Mastigocladus laminosus
ref|WP_036006339.1|  epimerase                                        86.7    3e-17    Leptolyngbya sp. JSC-1
ref|WP_018399565.1|  epimerase                                        86.7    3e-17    filamentous cyanobacterium ESFC-1
ref|WP_011056872.1|  epimerase                                        86.7    4e-17    Thermosynechococcus elongatus
ref|WP_002789107.1|  epimerase                                        86.3    4e-17    Microcystis aeruginosa
gb|KFG58952.1|  putative NAD-dependent epimerase/dehydratase          90.1    4e-17    Toxoplasma gondii RUB
ref|WP_016868241.1|  epimerase                                        86.3    4e-17    Fischerella muscicola
ref|WP_042153950.1|  epimerase                                        86.3    4e-17    Planktothrix agardhii
ref|WP_015217932.1|  NAD-dependent epimerase/dehydratase              85.9    5e-17    Cyanobacterium aponinum
ref|WP_019509249.1|  hypothetical protein                             85.9    5e-17    Pleurocapsa sp. PCC 7319
ref|WP_015210622.1|  putative nucleoside-diphosphate sugar epimerase  85.9    6e-17    Cylindrospermum stagnale
ref|WP_015115870.1|  NAD-dependent epimerase/dehydratase              85.9    6e-17    Nostoc sp. PCC 7107
ref|WP_017320843.1|  epimerase                                        85.9    6e-17    cyanobacterium PCC 7702
ref|WP_040931956.1|  epimerase                                        85.5    7e-17    
gb|KFH13678.1|  putative NAD-dependent epimerase/dehydratase          89.0    9e-17    Toxoplasma gondii MAS
ref|WP_006103868.1|  epimerase                                        85.5    9e-17    Coleofasciculus chthonoplastes
gb|KFH01695.1|  putative NAD-dependent epimerase/dehydratase          89.0    9e-17    Toxoplasma gondii VAND
ref|WP_012599037.1|  epimerase                                        85.1    9e-17    Cyanothece sp. PCC 7424
ref|WP_017748470.1|  epimerase                                        85.1    9e-17    
ref|WP_015189983.1|  NAD-dependent epimerase/dehydratase              85.1    1e-16    
ref|WP_015173187.1|  NAD-dependent epimerase/dehydratase              85.1    1e-16    
ref|WP_015122608.1|  NmrA-like family protein                         85.1    1e-16    
gb|EPR57291.1|  hypothetical protein TGGT1_267670                     89.0    1e-16    
gb|KFG29650.1|  putative NAD-dependent epimerase/dehydratase          89.0    1e-16    
gb|ESS33426.1|  putative NAD-dependent epimerase/dehydratase          89.0    1e-16    
ref|XP_002368835.1|  hypothetical protein TGME49_067670               89.0    1e-16    
ref|WP_017295850.1|  hypothetical protein                             85.1    1e-16    
ref|XP_008887691.1|  hypothetical protein HHA_267670                  88.2    1e-16    
ref|WP_026733342.1|  epimerase                                        84.7    2e-16    
ref|WP_009782419.1|  epimerase                                        84.7    2e-16    
ref|WP_015168128.1|  NmrA-like family protein                         84.3    2e-16    
gb|KIE07866.1|  epimerase                                             84.3    2e-16    
ref|WP_023067479.1|  hypothetical protein                             84.3    2e-16    
ref|WP_009626893.1|  hypothetical protein                             84.0    2e-16    
ref|WP_015145954.1|  putative nucleoside-diphosphate sugar epimerase  83.2    4e-16    
ref|WP_015785003.1|  epimerase                                        83.2    5e-16    
ref|WP_019493109.1|  epimerase                                        83.2    6e-16    
ref|WP_006625809.1|  MULTISPECIES: epimerase                          82.8    7e-16    
ref|WP_015138550.1|  putative nucleoside-diphosphate sugar epimerase  82.8    7e-16    
ref|WP_006508726.1|  NmrA-like family protein                         82.8    8e-16    
ref|WP_019499640.1|  hypothetical protein                             82.8    8e-16    
ref|WP_006853190.1|  NADH-flavin reductase                            82.4    9e-16    
ref|WP_009457133.1|  epimerase                                        82.4    1e-15    
ref|WP_008274897.1|  epimerase                                        82.0    1e-15    
ref|WP_021829906.1|  hypothetical protein                             82.0    1e-15    
gb|AHF64616.1|  hypothetical protein Syncc8109_2290                   82.4    1e-15    
gb|ACB53043.1|  unknown                                               82.0    1e-15    
ref|WP_009545147.1|  MULTISPECIES: epimerase                          82.0    1e-15    
ref|WP_012597126.1|  epimerase                                        81.6    1e-15    
ref|WP_016871623.1|  epimerase                                        81.6    2e-15    
ref|XP_008650263.1|  PREDICTED: uncharacterized protein At2g37660...  79.3    2e-15    
ref|WP_030006582.1|  epimerase                                        81.3    2e-15    
ref|WP_011610768.1|  epimerase                                        80.9    3e-15    
ref|WP_007306491.1|  epimerase                                        80.9    3e-15    
ref|WP_011619753.1|  NADH-flavin reductase                            80.5    4e-15    
ref|WP_015162351.1|  NmrA-like family protein                         79.7    9e-15    
ref|WP_015228313.1|  NmrA-like family protein                         79.7    9e-15    
ref|WP_015197587.1|  NAD-dependent epimerase/dehydratase              79.3    1e-14    
ref|WP_028952346.1|  NADH-flavin reductase                            79.3    1e-14    
ref|WP_006619776.1|  epimerase                                        78.6    2e-14    
ref|WP_012627731.1|  epimerase                                        78.6    2e-14    
ref|WP_011932716.1|  NADH-flavin reductase                            78.6    2e-14    
ref|WP_007102097.1|  NADH-flavin reductase                            78.6    2e-14    
ref|XP_001692589.1|  dehydrogenase                                    78.6    2e-14    
ref|WP_012307004.1|  epimerase                                        78.2    2e-14    
ref|WP_024546224.1|  epimerase                                        78.2    3e-14    
ref|WP_010315726.1|  NADH-flavin reductase                            77.8    4e-14    
ref|WP_032524341.1|  NADH-flavin reductase                            77.4    5e-14    
ref|WP_025926400.1|  NADH-flavin reductase                            77.4    6e-14    
gb|ACF12330.1|  NAD-dependent epimerase/dehydratase                   77.0    7e-14    
ref|WP_011365163.1|  NADH-flavin reductase                            77.0    8e-14    
ref|WP_035831421.1|  NADH-flavin reductase                            76.6    8e-14    
ref|WP_036917548.1|  MULTISPECIES: NADH-flavin reductase              76.6    1e-13    
ref|WP_011129885.1|  NADH-flavin reductase                            76.3    1e-13    
ref|WP_023171884.1|  Ycf39                                            76.3    1e-13    
ref|WP_017326930.1|  hypothetical protein                             76.3    1e-13    
ref|WP_011823544.1|  NADH-flavin reductase                            75.5    2e-13    
ref|WP_035402602.1|  NAD-dependent epimerase                          75.9    2e-13    
ref|WP_025930241.1|  NADH-flavin reductase                            75.5    2e-13    
ref|WP_011826390.1|  NADH-flavin reductase                            75.1    3e-13    
ref|WP_011128200.1|  NADH-flavin reductase                            75.5    3e-13    
ref|WP_036907323.1|  NADH-flavin reductase                            75.1    3e-13    
ref|WP_012007608.1|  NADH-flavin reductase                            75.1    3e-13    
ref|WP_006040911.1|  NADH-flavin reductase                            74.7    4e-13    
ref|WP_011362043.1|  epimerase                                        74.7    4e-13    
ref|WP_010307774.1|  NADH-flavin reductase                            74.7    4e-13    
ref|WP_015110833.1|  NmrA-like family protein                         74.7    5e-13    
ref|XP_005647249.1|  dehydrogenase                                    74.7    5e-13    
gb|AII48495.1|  NADH-flavin reductase                                 74.7    5e-13    
ref|WP_006910493.1|  NADH-flavin reductase                            74.3    5e-13    
ref|WP_026079994.1|  epimerase                                        74.3    5e-13    
ref|WP_032521522.1|  NADH-flavin reductase                            74.3    6e-13    
ref|WP_011293743.1|  NADH-flavin reductase                            74.3    6e-13    
ref|WP_015132574.1|  NAD-dependent epimerase/dehydratase              74.3    6e-13    
ref|WP_038556850.1|  NADH-flavin reductase                            74.3    6e-13    
ref|WP_038652293.1|  NADH-flavin reductase                            73.9    7e-13    
ref|WP_043690667.1|  NADH-flavin reductase                            73.9    8e-13    
ref|WP_010933720.1|  NAD-dependent epimerase                          73.9    9e-13    
ref|WP_025931798.1|  MULTISPECIES: NADH-flavin reductase              73.6    1e-12    
ref|WP_011376364.1|  NADH-flavin reductase                            73.6    1e-12    
ref|WP_036915532.1|  MULTISPECIES: NADH-flavin reductase              73.6    1e-12    
ref|WP_032526085.1|  NADH-flavin reductase                            73.6    1e-12    
ref|WP_011125031.1|  MULTISPECIES: NADH-flavin reductase              73.2    1e-12    
ref|WP_025914494.1|  NADH-flavin reductase                            73.2    1e-12    
gb|EAU71966.1|  hypothetical protein BL107_14200                      72.8    2e-12    
ref|WP_037988933.1|  NADH-flavin reductase                            72.8    2e-12    
ref|WP_011934919.1|  NADH-flavin reductase                            72.4    2e-12    
ref|WP_025959896.1|  NADH-flavin reductase                            72.0    3e-12    
ref|WP_025923093.1|  NADH-flavin reductase                            72.0    3e-12    
ref|WP_038545343.1|  NADH-flavin reductase                            72.0    4e-12    
ref|XP_011037583.1|  PREDICTED: protein TIC 62, chloroplastic-lik...  74.3    4e-12    
ref|XP_002975082.1|  hypothetical protein SELMODRAFT_271112           72.0    4e-12    
ref|XP_011037582.1|  PREDICTED: protein TIC 62, chloroplastic-lik...  74.3    5e-12    
ref|XP_004510204.1|  PREDICTED: uncharacterized protein At2g37660...  72.8    6e-12    
ref|XP_002988973.1|  hypothetical protein SELMODRAFT_269454           71.6    6e-12    
ref|WP_011358726.1|  NAD-dependent epimerase                          71.6    6e-12    
ref|WP_032514289.1|  NADH-flavin reductase                            71.2    6e-12    
ref|WP_011820094.1|  NADH-flavin reductase                            71.2    7e-12    
gb|ADE76005.1|  unknown                                               71.2    7e-12    
ref|WP_025958346.1|  NADH-flavin reductase                            70.9    7e-12    
ref|WP_002806582.1|  NADH-flavin reductase                            70.9    8e-12    
gb|KDP46212.1|  hypothetical protein JCGZ_10052                       73.9    8e-12    
ref|WP_011862834.1|  NADH-flavin reductase                            70.9    8e-12    
ref|XP_010438027.1|  PREDICTED: uncharacterized protein At5g02240...  72.4    8e-12    
ref|WP_036920829.1|  NADH-flavin reductase                            70.9    8e-12    
ref|WP_026097739.1|  epimerase                                        70.9    9e-12    
ref|WP_011132435.1|  NADH-flavin reductase                            70.9    1e-11    
ref|WP_025929330.1|  NADH-flavin reductase                            70.5    1e-11    
ref|WP_032515182.1|  NADH-flavin reductase                            70.5    1e-11    
ref|WP_025945882.1|  MULTISPECIES: NADH-flavin reductase              70.5    1e-11    
ref|WP_025938270.1|  NADH-flavin reductase                            70.5    1e-11    
ref|WP_025955632.1|  NADH-flavin reductase                            70.5    1e-11    
ref|XP_002306080.1|  Tic62 family protein                             72.8    1e-11    
gb|KJB35731.1|  hypothetical protein B456_006G125600                  70.9    1e-11    
ref|XP_002982038.1|  hypothetical protein SELMODRAFT_445069           71.6    1e-11    
ref|WP_025890703.1|  MULTISPECIES: NADH-flavin reductase              70.1    1e-11    
ref|WP_025940056.1|  NADH-flavin reductase                            70.1    1e-11    
ref|WP_012500733.1|  NAD-dependent epimerase                          70.5    1e-11    
ref|WP_025958907.1|  NADH-flavin reductase                            70.1    2e-11    
ref|WP_025935833.1|  NADH-flavin reductase                            70.1    2e-11    
gb|KJB35730.1|  hypothetical protein B456_006G125600                  71.2    2e-11    
ref|WP_025894417.1|  MULTISPECIES: NADH-flavin reductase              70.1    2e-11    
ref|WP_025933434.1|  MULTISPECIES: NADH-flavin reductase              70.1    2e-11    
ref|WP_042850263.1|  NADH-flavin reductase                            70.1    2e-11    
ref|WP_025953772.1|  NADH-flavin reductase                            70.1    2e-11    
ref|WP_025928335.1|  NADH-flavin reductase                            70.1    2e-11    
ref|WP_025952716.1|  NADH-flavin reductase                            69.7    2e-11    
ref|WP_025944632.1|  NADH-flavin reductase                            69.7    2e-11    
ref|XP_001755254.1|  predicted protein                                70.1    2e-11    
ref|WP_015126124.1|  NmrA-like family protein                         69.7    2e-11    
gb|ADE75995.1|  unknown                                               70.1    2e-11    
ref|WP_025881231.1|  MULTISPECIES: NADH-flavin reductase              69.7    2e-11    
ref|XP_002313068.2|  Tic62 family protein                             72.4    2e-11    
ref|XP_005649511.1|  hypothetical protein COCSUDRAFT_83659            70.5    2e-11    
ref|WP_025959424.1|  NADH-flavin reductase                            69.7    2e-11    
ref|WP_036902877.1|  NADH-flavin reductase                            69.7    2e-11    
ref|XP_002957467.1|  hypothetical protein VOLCADRAFT_107678           70.5    2e-11    
ref|WP_015224209.1|  NAD-dependent epimerase/dehydratase              69.7    2e-11    
gb|AFK43374.1|  unknown                                               71.2    2e-11    
ref|XP_002966481.1|  hypothetical protein SELMODRAFT_439518           70.9    3e-11    
ref|WP_032518808.1|  NADH-flavin reductase                            69.3    3e-11    
ref|WP_025924414.1|  NADH-flavin reductase                            69.3    3e-11    
ref|XP_007015191.1|  NAD(P)-binding Rossmann-fold superfamily pro...  70.5    3e-11    
ref|WP_025961089.1|  NADH-flavin reductase                            69.3    3e-11    
ref|WP_032517006.1|  NADH-flavin reductase                            69.3    3e-11    
ref|WP_025954585.1|  NADH-flavin reductase                            69.3    3e-11    
ref|XP_007015192.1|  NAD(P)-binding Rossmann-fold superfamily pro...  70.5    4e-11    
ref|WP_012502283.1|  epimerase                                        68.9    4e-11    
ref|XP_010432852.1|  PREDICTED: uncharacterized protein At5g02240...  70.5    4e-11    
emb|CAN75677.1|  hypothetical protein VITISV_033052                   71.2    4e-11    
ref|WP_025946742.1|  NADH-flavin reductase                            68.6    5e-11    
ref|WP_011818306.1|  NADH-flavin reductase                            68.6    5e-11    
ref|XP_010065420.1|  PREDICTED: protein TIC 62, chloroplastic         71.2    5e-11    
ref|XP_002284662.1|  PREDICTED: protein TIC 62, chloroplastic         71.2    5e-11    
ref|XP_010999474.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.9    5e-11    
ref|XP_002946896.1|  hypothetical protein VOLCADRAFT_56279            68.9    6e-11    
ref|XP_010521452.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.9    7e-11    
ref|XP_006470726.1|  PREDICTED: uncharacterized protein At2g37660...  69.7    8e-11    
ref|XP_010521451.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.5    8e-11    
ref|XP_002519103.1|  NAD dependent epimerase/dehydratase, putative    70.5    8e-11    
gb|ABK24824.1|  unknown                                               69.7    8e-11    
ref|XP_006446244.1|  hypothetical protein CICLE_v10015876mg           69.3    9e-11    
ref|XP_009375301.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.5    9e-11    
ref|WP_017309877.1|  MULTISPECIES: epimerase                          68.6    9e-11    
ref|XP_006446242.1|  hypothetical protein CICLE_v10015876mg           69.3    9e-11    
ref|XP_008387345.1|  PREDICTED: protein TIC 62, chloroplastic         70.5    9e-11    
ref|XP_006470727.1|  PREDICTED: uncharacterized protein At2g37660...  69.3    9e-11    
ref|XP_009375300.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.5    9e-11    
ref|XP_010999468.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.1    1e-10    
ref|XP_006446243.1|  hypothetical protein CICLE_v10015876mg           69.3    1e-10    
ref|XP_010045042.1|  PREDICTED: uncharacterized protein At2g34460...  69.3    1e-10    
gb|KJB32202.1|  hypothetical protein B456_005G229200                  70.1    1e-10    
ref|XP_006412584.1|  hypothetical protein EUTSA_v10025684mg           68.9    1e-10    
ref|WP_025607530.1|  NAD-dependent dehydratase                        67.4    1e-10    
ref|XP_009626795.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.1    1e-10    
ref|WP_009787371.1|  epimerase                                        68.2    1e-10    
gb|KJB32203.1|  hypothetical protein B456_005G229200                  70.1    1e-10    
ref|XP_007201133.1|  hypothetical protein PRUPE_ppa017158mg           70.1    1e-10    
ref|XP_003521008.2|  PREDICTED: uncharacterized protein At5g02240...  69.3    1e-10    
gb|KHG28437.1|  Protein TIC 62, chloroplastic                         70.1    1e-10    
gb|ADE77194.1|  unknown                                               67.8    1e-10    
ref|XP_009626794.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.1    1e-10    
ref|XP_009626793.1|  PREDICTED: protein TIC 62, chloroplastic iso...  70.1    1e-10    
ref|XP_007131866.1|  hypothetical protein PHAVU_011G048000g           69.7    1e-10    
ref|XP_001702908.1|  nucleoside diphosphate sugar epimerase           68.6    2e-10    
ref|WP_025971511.1|  NADH-flavin reductase                            66.6    2e-10    
ref|XP_006284070.1|  hypothetical protein CARUB_v10005196mg           68.6    2e-10    
ref|XP_003055600.1|  predicted protein                                68.9    2e-10    
ref|XP_003636186.1|  hypothetical protein MTR_033s0001                68.6    2e-10    
ref|XP_010447507.1|  PREDICTED: uncharacterized protein At5g02240...  68.6    2e-10    
ref|XP_011088334.1|  PREDICTED: protein TIC 62, chloroplastic         69.7    2e-10    
ref|WP_011745132.1|  epimerase                                        67.4    2e-10    
ref|XP_006349647.1|  PREDICTED: protein TIC 62, chloroplastic-like    69.7    2e-10    
dbj|BAJ85854.1|  predicted protein                                    67.4    2e-10    
gb|KDO44933.1|  hypothetical protein CISIN_1g0199352mg                67.8    2e-10    
ref|XP_010254986.1|  PREDICTED: protein TIC 62, chloroplastic iso...  69.7    2e-10    
ref|WP_027419669.1|  NAD-dependent dehydratase                        67.0    2e-10    
ref|XP_010254987.1|  PREDICTED: protein TIC 62, chloroplastic iso...  69.7    2e-10    
ref|XP_007134269.1|  hypothetical protein PHAVU_010G032900g           68.6    2e-10    
ref|XP_003579313.1|  PREDICTED: uncharacterized protein At2g34460...  67.8    2e-10    
ref|XP_002869322.1|  catalytic/ coenzyme binding protein              68.2    2e-10    
ref|XP_010327446.1|  PREDICTED: protein TIC 62, chloroplastic iso...  69.3    2e-10    
ref|XP_010327445.1|  PREDICTED: protein TIC 62, chloroplastic iso...  69.3    2e-10    
ref|XP_010327443.1|  PREDICTED: protein TIC 62, chloroplastic iso...  69.3    2e-10    
gb|AFK39583.1|  unknown                                               68.2    2e-10    
gb|KCW87197.1|  hypothetical protein EUGRSUZ_B03717                   67.8    2e-10    
ref|XP_010327444.1|  PREDICTED: protein TIC 62, chloroplastic iso...  69.3    2e-10    
dbj|BAJ85999.1|  predicted protein                                    68.9    2e-10    
ref|XP_006590906.1|  PREDICTED: protein TIC 62, chloroplastic-lik...  69.3    2e-10    
ref|XP_006590908.1|  PREDICTED: protein TIC 62, chloroplastic-lik...  69.3    2e-10    
ref|XP_004248732.1|  PREDICTED: protein TIC 62, chloroplastic iso...  69.3    2e-10    
emb|CDO97093.1|  unnamed protein product                              68.9    2e-10    
ref|WP_036898475.1|  NADH-flavin reductase                            66.6    2e-10    
tpg|DAA48448.1|  TPA: hypothetical protein ZEAMMB73_353689            66.6    3e-10    
ref|XP_007042712.1|  NAD(P)-binding Rossmann-fold superfamily pro...  68.2    3e-10    
ref|XP_009337040.1|  PREDICTED: protein TIC 62, chloroplastic-like    68.2    3e-10    
ref|WP_026721298.1|  epimerase                                        67.0    3e-10    
ref|XP_009342603.1|  PREDICTED: protein TIC 62, chloroplastic-like    67.8    3e-10    
ref|NP_194881.2|  NAD(P)-binding Rossmann-fold superfamily protein    67.8    3e-10    



>ref|XP_010922296.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic [Elaeis 
guineensis]
Length=255

 Score =   330 bits (845),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            +TVLVTGAGGRTGQIVYKKL+E +D++I RGLVR+ ESK +IGGADD+++ D+R+A SIV
Sbjct  7    KTVLVTGAGGRTGQIVYKKLKERTDQFIVRGLVRTPESKEKIGGADDVFVADVRDAASIV  66

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            PA+QGIDA+IILTSAVP+MKPGFDP+KG RPEFYFEDGL PEQVDWIGQKNQID AKAAG
Sbjct  67   PAVQGIDALIILTSAVPKMKPGFDPTKGGRPEFYFEDGLYPEQVDWIGQKNQIDAAKAAG  126

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            VKHI+LVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQDK+GG+
Sbjct  127  VKHIILVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDKDGGQ  186

Query  554  RELLVGKDDELLQTEN  601
            RELLVGKDDELLQTE 
Sbjct  187  RELLVGKDDELLQTET  202



>ref|XP_011094871.1| PREDICTED: uncharacterized protein At5g02240 [Sesamum indicum]
Length=312

 Score =   326 bits (835),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGAGGRTGQIVYKKL+E SD+YI RGLVR++ESK +IGG +D+YIGDIRN E+I
Sbjct  63   KSTVLVTGAGGRTGQIVYKKLKERSDQYIARGLVRTQESKEKIGGENDVYIGDIRNVENI  122

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
             PAIQGIDA+IILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKAA
Sbjct  123  TPAIQGIDALIILTSAVPKMKPGFDPTKGGRPEFYFEDGAFPEQVDWIGQKNQIDVAKAA  182

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVK IVLVGSMGGTNPNHPLN+LGNGNILIWKRK+E+YLADSG+PYTIIRAGGLQDK GG
Sbjct  183  GVKQIVLVGSMGGTNPNHPLNSLGNGNILIWKRKAEQYLADSGIPYTIIRAGGLQDKEGG  242

Query  551  ERELLVGKDDELLQTEN  601
             RELLVGKDDELLQTE 
Sbjct  243  VRELLVGKDDELLQTET  259



>ref|XP_008785605.1| PREDICTED: uncharacterized protein At5g02240-like [Phoenix dactylifera]
Length=306

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            + TVLVTGAGGRTGQIVYKKL+E +D++I RGLVR++ESK +IGGADDI++ DIR+A SI
Sbjct  57   RSTVLVTGAGGRTGQIVYKKLKEGTDQFIVRGLVRTQESKEKIGGADDIFVADIRDAASI  116

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            VPA+QGIDA+IILTSAVP+MKPG DPSKG RPEFYFEDGL PEQVDWIGQKNQID AKA 
Sbjct  117  VPAVQGIDALIILTSAVPKMKPGLDPSKGGRPEFYFEDGLYPEQVDWIGQKNQIDAAKAV  176

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG
Sbjct  177  GVKHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGG  236

Query  551  ERELLVGKDDELLQTEN  601
            +RELLVGKDDELLQTE 
Sbjct  237  QRELLVGKDDELLQTET  253



>gb|KHN40295.1| Hypothetical protein glysoja_000793 [Glycine soja]
Length=331

 Score =   325 bits (833),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA  181
            A+ K TVLVTGAGGRTGQIVYKKLRE  ++Y+ RGLVR++ESK  IG ADD+ +GDIR+A
Sbjct  79   AESKSTVLVTGAGGRTGQIVYKKLRERPNQYVARGLVRTDESKQNIGAADDVIVGDIRDA  138

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTA  361
            ESIVPAIQGIDA+IILTSAVP++KPGFDP+KG+RPEFYFEDG  PEQVDWIGQKNQID A
Sbjct  139  ESIVPAIQGIDALIILTSAVPQIKPGFDPTKGQRPEFYFEDGAYPEQVDWIGQKNQIDVA  198

Query  362  KAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDK  541
            KAAGVKHIVLVGSMGGT+ NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK
Sbjct  199  KAAGVKHIVLVGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDK  258

Query  542  NGGERELLVGKDDELLQTEN  601
            +GG RELLVGKDDELLQTE 
Sbjct  259  DGGLRELLVGKDDELLQTET  278



>ref|NP_001241503.1| uncharacterized protein LOC100794855 [Glycine max]
 gb|ACU21370.1| unknown [Glycine max]
Length=331

 Score =   325 bits (833),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA  181
            A+ K TVLVTGAGGRTGQIVYKKLRE  ++Y+ RGLVR++ESK  IG ADD+ +GDIR+A
Sbjct  79   AESKSTVLVTGAGGRTGQIVYKKLRERPNQYVARGLVRTDESKQNIGAADDVIVGDIRDA  138

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTA  361
            ESIVPAIQGIDA+IILTSAVP++KPGFDP+KG+RPEFYFEDG  PEQVDWIGQKNQID A
Sbjct  139  ESIVPAIQGIDALIILTSAVPQIKPGFDPTKGQRPEFYFEDGAYPEQVDWIGQKNQIDVA  198

Query  362  KAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDK  541
            KAAGVKHIVLVGSMGGT+ NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK
Sbjct  199  KAAGVKHIVLVGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDK  258

Query  542  NGGERELLVGKDDELLQTEN  601
            +GG RELLVGKDDELLQTE 
Sbjct  259  DGGLRELLVGKDDELLQTET  278



>ref|XP_010262541.1| PREDICTED: uncharacterized protein At5g02240-like [Nelumbo nucifera]
Length=310

 Score =   322 bits (826),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVY+KL+E +D+Y+ RGLVR+EESK +IGGADD+++GDIR+AESI+P
Sbjct  63   TVLVTGAGGRTGQIVYRKLKERTDQYVARGLVRTEESKEKIGGADDVFVGDIRDAESIIP  122

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IILTSAVP+MKPGFDPSKG RPEFYFEDG  PEQVDWIGQKNQID AK+ GV
Sbjct  123  AIQGIDALIILTSAVPKMKPGFDPSKGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKSVGV  182

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN+LGNGNILIWKRK+E+YLADSG+PYTI+RAGGLQDK+GG R
Sbjct  183  KQIVLVGSMGGTNPNHPLNSLGNGNILIWKRKAEQYLADSGIPYTIVRAGGLQDKDGGIR  242

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  243  ELLVGKDDELLQTET  257



>gb|ACJ84528.1| unknown [Medicago truncatula]
 gb|AFK48520.1| unknown [Medicago truncatula]
Length=255

 Score =   320 bits (820),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E  D+YI RGLVRSEESK +IGGADDI++GDIRNAESIVP
Sbjct  8    TVLVTGAGGRTGQIVYKKLKEKRDQYIARGLVRSEESKQKIGGADDIFLGDIRNAESIVP  67

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQG DA+IILTSAVP+MKPGFDP+KG RPEFYF+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  68   AIQGTDALIILTSAVPQMKPGFDPTKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKAAGV  127

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+EEYL++SGVPYTIIR GGL+DK GG R
Sbjct  128  KHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEEYLSNSGVPYTIIRPGGLRDKEGGVR  187

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQTE 
Sbjct  188  ELIVGKDDELLQTET  202



>gb|KHN13994.1| Hypothetical protein glysoja_025011 [Glycine soja]
Length=255

 Score =   320 bits (820),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGAGGRTGQIVYKKL+E  ++Y+ RGLVR++ESK  IG ADD+++GDIR+AESI
Sbjct  6    KSTVLVTGAGGRTGQIVYKKLKERPNQYVARGLVRTDESKQNIGAADDVFVGDIRDAESI  65

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            VPAIQGIDA+IILTSAVP++KPGFDP+KG+RPEFYF+DG  PEQVDWIGQKNQID AKAA
Sbjct  66   VPAIQGIDALIILTSAVPQIKPGFDPTKGQRPEFYFDDGAYPEQVDWIGQKNQIDAAKAA  125

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGGT+ NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG
Sbjct  126  GVKHIVLVGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGG  185

Query  551  ERELLVGKDDELLQTEN  601
             RELLVGKDDELLQTE 
Sbjct  186  LRELLVGKDDELLQTET  202



>ref|XP_003552177.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Glycine max]
Length=255

 Score =   320 bits (819),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGAGGRTGQIVYKKL+E  ++Y+ RGLVR++ESK  IG ADD+++GDIR+AESI
Sbjct  6    KSTVLVTGAGGRTGQIVYKKLKERPNQYVARGLVRTDESKQNIGAADDVFVGDIRHAESI  65

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            VPAIQGIDA+IILTSAVP++KPGFDP+KG+RPEFYF+DG  PEQVDWIGQKNQID AKAA
Sbjct  66   VPAIQGIDALIILTSAVPQIKPGFDPTKGQRPEFYFDDGAYPEQVDWIGQKNQIDAAKAA  125

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGGT+ NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG
Sbjct  126  GVKHIVLVGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGG  185

Query  551  ERELLVGKDDELLQTEN  601
             RELLVGKDDELLQTE 
Sbjct  186  LRELLVGKDDELLQTET  202



>gb|KDP35646.1| hypothetical protein JCGZ_09084 [Jatropha curcas]
Length=255

 Score =   319 bits (818),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVYKKL+E SD+Y+ RGLVR++ESK +IGGA+D+++GDIR  ESI P
Sbjct  8    TVLVTGAGGRTGSIVYKKLKERSDQYVARGLVRTQESKEKIGGAEDVFVGDIRQPESINP  67

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IILTSAVP+MKPGFDPSKGERPEF FEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  68   AIQGIDALIILTSAVPKMKPGFDPSKGERPEFCFEDGAYPEQVDWIGQKNQIDAAKAAGV  127

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  128  KQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGGIR  187

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQTE 
Sbjct  188  ELIVGKDDELLQTET  202



>gb|KEH29065.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=255

 Score =   319 bits (818),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            + TVLVTGAGGRTGQIVYKKL+E  D+YI RGLVRSEESK +IGGADDI++GDIRNAESI
Sbjct  6    QTTVLVTGAGGRTGQIVYKKLKEKRDQYIARGLVRSEESKQKIGGADDIFLGDIRNAESI  65

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            VPAIQG DA+IILTSAVP+MKPGFDP+KG RPEFYF+DG  PEQVDWIGQKNQID AKAA
Sbjct  66   VPAIQGTDALIILTSAVPQMKPGFDPTKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKAA  125

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+EEYL++SGVPYTIIR GGL DK GG
Sbjct  126  GVKHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEEYLSNSGVPYTIIRPGGLLDKEGG  185

Query  551  ERELLVGKDDELLQTEN  601
             REL+VGKDDELLQTE 
Sbjct  186  VRELIVGKDDELLQTET  202



>emb|CBI30539.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +D+++ RGLVR+EESK +IGGADD+ +GDIRNA+SIVP
Sbjct  6    TVLVTGAGGRTGQIVYKKLKERADQFVARGLVRTEESKEKIGGADDVLVGDIRNADSIVP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQG+DA+IILTSAVPRMKPGFDP+KG+RPEFYFE+G  PEQVDWIGQKNQID AK AGV
Sbjct  66   AIQGVDALIILTSAVPRMKPGFDPTKGQRPEFYFEEGAFPEQVDWIGQKNQIDVAKTAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGT+ NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQD+ GG R
Sbjct  126  KHIVLVGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDREGGIR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  186  ELLVGKDDELLKTET  200



>gb|AGT17323.1| NAD-dependent epimerase/dehydratase [Saccharum hybrid cultivar 
R570]
Length=257

 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA  181
            A  + TVLVTGAGGRTGQIVY KL+E S+K++ RGLVR+EESK +IGGA D+YI DIR+A
Sbjct  5    AASRPTVLVTGAGGRTGQIVYNKLKERSEKFVARGLVRTEESKQKIGGASDVYIADIRDA  64

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTA  361
            + + PA+QG+DA+IILTSAVP+MKPGFDPSKG RPEFY+EDG+ PEQVDWIGQKNQID A
Sbjct  65   DRLAPAVQGVDALIILTSAVPKMKPGFDPSKGGRPEFYYEDGMYPEQVDWIGQKNQIDAA  124

Query  362  KAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDK  541
            KAAGVKHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIR GGLQDK
Sbjct  125  KAAGVKHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRPGGLQDK  184

Query  542  NGGERELLVGKDDELLQTEN  601
            +GG REL+VGKDDELLQT+ 
Sbjct  185  DGGVRELIVGKDDELLQTDT  204



>ref|XP_009758868.1| PREDICTED: uncharacterized protein At5g02240 [Nicotiana sylvestris]
Length=307

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVYKKL+E S+KY  RGLVR+EESK +IGGADD+YIGDIR+ ESIVP
Sbjct  60   TVLVTGAGGRTGSIVYKKLKERSEKYTARGLVRTEESKQKIGGADDVYIGDIRDTESIVP  119

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA++ILTSAVP+MKPGFDP++G RPEFYFEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  120  AIQGIDALVILTSAVPKMKPGFDPTQGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGV  179

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN++GNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  180  KQIVLVGSMGGTNPNHPLNSIGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  239

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  240  ELLVGKDDELLQTET  254



>ref|XP_003563550.1| PREDICTED: uncharacterized protein At5g02240-like [Brachypodium 
distachyon]
Length=257

 Score =   318 bits (814),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            + TVLVTGAGGRTGQIV+ KL+E SD+++ RGLVR+EESK +IGGADD+Y+ DIR A+S+
Sbjct  8    RSTVLVTGAGGRTGQIVFNKLKERSDQFVARGLVRTEESKQKIGGADDVYVADIREADSV  67

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            VPA+QG+DA++ILTSA P+MKPGFDPSKG RPEFY+EDG  PEQVDWIGQKNQID AKAA
Sbjct  68   VPAVQGVDALVILTSATPKMKPGFDPSKGGRPEFYYEDGAYPEQVDWIGQKNQIDAAKAA  127

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRKSE+YLADSGVPYTI+R GGLQDK+GG
Sbjct  128  GVKHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKSEQYLADSGVPYTIVRPGGLQDKDGG  187

Query  551  ERELLVGKDDELLQTEN  601
             REL+VGKDDELLQT+ 
Sbjct  188  VRELIVGKDDELLQTDT  204



>ref|XP_004246424.1| PREDICTED: uncharacterized protein At5g02240 [Solanum lycopersicum]
Length=308

 Score =   318 bits (816),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVYKKL+E S+ Y  RGLVR+EESK ++GGADD+YIGDIRN ES+VP
Sbjct  61   TVLVTGAGGRTGSIVYKKLKERSETYTARGLVRTEESKQKVGGADDVYIGDIRNIESLVP  120

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA++ILTSAVP+MKPG+DP+KG RPEFYFEDG +PEQVDWIGQKNQID AKAAGV
Sbjct  121  AIQGIDALVILTSAVPKMKPGYDPTKGGRPEFYFEDGANPEQVDWIGQKNQIDAAKAAGV  180

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN+LGNGNILIWKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  181  KRIVLVGSMGGTNPNHPLNSLGNGNILIWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  240

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  241  ELLVGKDDELLETET  255



>ref|XP_006341016.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Solanum tuberosum]
Length=298

 Score =   318 bits (815),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVYKKL+E S+ Y  RGLVR+EESK +IGGADD+YIGDIRN ES++P
Sbjct  51   TVLVTGAGGRTGSIVYKKLKERSENYTARGLVRTEESKQKIGGADDVYIGDIRNTESLIP  110

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA++ILTSAVP+MKPGFDP+KG RPEFYFEDG +PEQVDWIGQKNQID AKAAGV
Sbjct  111  AIQGIDALVILTSAVPKMKPGFDPTKGGRPEFYFEDGANPEQVDWIGQKNQIDAAKAAGV  170

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN+LGNGNILIWKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  171  KQIVLVGSMGGTNPNHPLNSLGNGNILIWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  230

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+T+ 
Sbjct  231  ELLVGKDDELLETDT  245



>ref|XP_010654260.1| PREDICTED: uncharacterized protein At5g02240 [Vitis vinifera]
Length=329

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +D+++ RGLVR+EESK +IGGADD+ +GDIRNA+SIVP
Sbjct  82   TVLVTGAGGRTGQIVYKKLKERADQFVARGLVRTEESKEKIGGADDVLVGDIRNADSIVP  141

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQG+DA+IILTSAVPRMKPGFDP+KG+RPEFYFE+G  PEQVDWIGQKNQID AK AGV
Sbjct  142  AIQGVDALIILTSAVPRMKPGFDPTKGQRPEFYFEEGAFPEQVDWIGQKNQIDVAKTAGV  201

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGT+ NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQD+ GG R
Sbjct  202  KHIVLVGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDREGGIR  261

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  262  ELLVGKDDELLKTET  276



>ref|XP_004516489.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Cicer arietinum]
Length=256

 Score =   315 bits (807),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E  D+YI RGLVR+EESK +IGGADDI+IGDI++AESIVP
Sbjct  9    TVLVTGAGGRTGQIVYKKLKEKRDQYIARGLVRTEESKQKIGGADDIFIGDIKDAESIVP  68

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IIL+SAVP+MKPGFDP+KG RPEFYF+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  69   AIQGIDALIILSSAVPQMKPGFDPTKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKAAGV  128

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+EEYLA+SGVPYTIIR GGL DK+GG R
Sbjct  129  KHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEEYLANSGVPYTIIRPGGLLDKDGGLR  188

Query  557  ELLVGKDDELLQTEN  601
            E +VGKDDELL+TE 
Sbjct  189  EFIVGKDDELLKTET  203



>tpg|DAA52226.1| TPA: NAD-dependent epimerase/dehydratase [Zea mays]
Length=257

 Score =   315 bits (807),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA  181
            A  + TVLVTGAGGRTGQIVY KL+E S++++ RGLVR+EESK +IG A D+Y+ DIR+A
Sbjct  5    ATSRPTVLVTGAGGRTGQIVYNKLKERSEQFVARGLVRTEESKQKIGAAGDVYVADIRDA  64

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTA  361
            + + PA+QG+DA+IILTSA P+MKPGFDPSKG RPEFY+EDG+ PEQVDW+GQKNQID A
Sbjct  65   DRLAPAVQGVDALIILTSAAPKMKPGFDPSKGGRPEFYYEDGMYPEQVDWVGQKNQIDAA  124

Query  362  KAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDK  541
            KAAGVKHIVLVGSMGGTNPNHPLN++GNGNIL+WKRK+E+YLADSG+PYTIIR GGLQDK
Sbjct  125  KAAGVKHIVLVGSMGGTNPNHPLNSMGNGNILVWKRKAEQYLADSGIPYTIIRPGGLQDK  184

Query  542  NGGERELLVGKDDELLQTEN  601
            +GG RELLVGKDDELLQT+ 
Sbjct  185  DGGVRELLVGKDDELLQTDT  204



>ref|XP_004302740.1| PREDICTED: uncharacterized protein At5g02240 [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   317 bits (813),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
            G  TVLVTGAGGRTGQIVYKKL+E SD+Y+ RGLVR+EESKA+IGGADD+Y+GDI  A+S
Sbjct  79   GTSTVLVTGAGGRTGQIVYKKLKERSDQYVARGLVRTEESKAKIGGADDLYVGDITVADS  138

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            IVPAIQGIDA++ILTSAVP+MKPGFDPSKGERPEFYFEDG  PEQVDW+GQKNQID AKA
Sbjct  139  IVPAIQGIDALVILTSAVPKMKPGFDPSKGERPEFYFEDGQFPEQVDWLGQKNQIDAAKA  198

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGT+ N+PLN+LGNGNILIWKRK+E+YLADSG+PYTIIRAGGLQDK G
Sbjct  199  AGVKQIVLVGSMGGTDLNNPLNSLGNGNILIWKRKAEQYLADSGIPYTIIRAGGLQDKQG  258

Query  548  GERELLVGKDDELLQTEN  601
            G RELL+GKDDELL+TE 
Sbjct  259  GIRELLIGKDDELLKTET  276



>ref|NP_001051733.1| Os03g0822200 [Oryza sativa Japonica Group]
 gb|AAO18441.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99604.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13647.1| Os03g0822200 [Oryza sativa Japonica Group]
 dbj|BAG96456.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96506.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91419.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76430.1| hypothetical protein OsI_14111 [Oryza sativa Indica Group]
 gb|EEE60199.1| hypothetical protein OsJ_13157 [Oryza sativa Japonica Group]
Length=257

 Score =   315 bits (806),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVY KL+E SD+++ RGLVR+EESK +IGG +D+YI DIR+ + +VP
Sbjct  10   TVLVTGAGGRTGNIVYNKLKERSDQFVVRGLVRTEESKQKIGGGNDVYIADIRDRDHLVP  69

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QG+DA+IILTSAVP+MKPGFDPSKG RPEFY+EDG+ PEQVDWIGQKNQIDTAKAAGV
Sbjct  70   AVQGVDALIILTSAVPKMKPGFDPSKGGRPEFYYEDGMYPEQVDWIGQKNQIDTAKAAGV  129

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRKSE+YLADSGVPYTIIR GGLQDK+GG R
Sbjct  130  KHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKSEQYLADSGVPYTIIRPGGLQDKDGGVR  189

Query  557  ELLVGKDDELLQTEN  601
            EL+VG DDELLQT+ 
Sbjct  190  ELIVGNDDELLQTDT  204



>ref|XP_004981238.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Setaria italica]
Length=257

 Score =   315 bits (806),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVY KL+E S+++I RGLVR+EESK +IGGADD+YI DIR+A+ +VP
Sbjct  10   TVLVTGAGGRTGHIVYNKLKERSEQFIARGLVRTEESKQKIGGADDVYIADIRDADHLVP  69

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QG DA+IILTSAVP+MKPGFDPSKG RPEFY+EDG+ PEQVDWIGQKNQID AKAAGV
Sbjct  70   AVQGADALIILTSAVPKMKPGFDPSKGGRPEFYYEDGMYPEQVDWIGQKNQIDAAKAAGV  129

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIR GGLQDK+GG R
Sbjct  130  KHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRPGGLQDKDGGVR  189

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQT+ 
Sbjct  190  ELVVGKDDELLQTDT  204



>ref|NP_001148959.1| NAD-dependent epimerase/dehydratase [Zea mays]
 gb|ACG33645.1| NAD-dependent epimerase/dehydratase [Zea mays]
Length=257

 Score =   315 bits (806),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA  181
            A  + TVLVTGAGGRTGQIVY KL+E S++++ RGLVR+EESK +IG A D+Y+ DIR+A
Sbjct  5    ATSRPTVLVTGAGGRTGQIVYNKLKERSEQFVARGLVRTEESKQKIGAAGDVYVADIRDA  64

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTA  361
            + + PA+QG+DA+IILTSA P+MKPGFDPSKG RPEFY+EDG+ PEQVDW+GQKNQID A
Sbjct  65   DRLAPAVQGVDALIILTSAAPKMKPGFDPSKGGRPEFYYEDGMYPEQVDWLGQKNQIDAA  124

Query  362  KAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDK  541
            KAAGVKHIVLVGSMGGTNPNHPLN++GNGNIL+WKRK+E+YLADSG+PYTIIR GGLQDK
Sbjct  125  KAAGVKHIVLVGSMGGTNPNHPLNSMGNGNILVWKRKAEQYLADSGIPYTIIRPGGLQDK  184

Query  542  NGGERELLVGKDDELLQTEN  601
            +GG RELLVGKDDELLQT+ 
Sbjct  185  DGGVRELLVGKDDELLQTDT  204



>ref|XP_004142064.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Cucumis sativus]
 gb|KGN54259.1| hypothetical protein Csa_4G296130 [Cucumis sativus]
Length=326

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD Y  RGLVR+EESK  IGGADD+++GDIR+A+S+ P
Sbjct  79   TVLVTGAGGRTGQIVYKKLKERSDHYAARGLVRTEESKQSIGGADDLFVGDIRDADSLGP  138

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  139  AIQGIDALIILTSAVPKMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGV  198

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  199  KQIVLVGSMGGTNINHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGGIR  258

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  259  ELLVGKDDELLQTET  273



>ref|XP_009587189.1| PREDICTED: uncharacterized protein At5g02240-like [Nicotiana 
tomentosiformis]
Length=308

 Score =   315 bits (807),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVYKKL+E S+KY  RGLVR+EESK +IGGADD+YIGDIR+ ESI+P
Sbjct  61   TVLVTGAGGRTGSIVYKKLKERSEKYTARGLVRTEESKQKIGGADDVYIGDIRDTESIIP  120

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGI A++ILTSAVP+MKPGFDP++G RPEFYFEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  121  AIQGIYALVILTSAVPKMKPGFDPTQGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGV  180

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN++GNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  181  KQIVLVGSMGGTNPNHPLNSIGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  240

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  241  ELLVGKDDELLQTET  255



>ref|XP_008448031.1| PREDICTED: uncharacterized protein At5g02240 [Cucumis melo]
Length=326

 Score =   315 bits (807),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+Y  RGLVR+EESK  IGGADD+++GDIR+A+S+ P
Sbjct  79   TVLVTGAGGRTGQIVYKKLKERSDQYAARGLVRTEESKQGIGGADDLFVGDIRDADSLGP  138

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  139  AIQGIDALIILTSAVPKMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGV  198

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  199  KQIVLVGSMGGTNINHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGGIR  258

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  259  ELLVGKDDELLQTET  273



>gb|EMT23678.1| hypothetical protein F775_31621 [Aegilops tauschii]
Length=269

 Score =   313 bits (801),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIV+ KLRE SD++  RGLVRSEESK +IGGADD+Y+ DIR AE + P
Sbjct  7    TVLVTGAGGRTGQIVFSKLRERSDQFAARGLVRSEESKQKIGGADDVYVADIREAEHLAP  66

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QG DA++ILTSA P+MKPGFDP+KG RPEFY+EDG  PEQVDWIGQKNQID AKAAGV
Sbjct  67   AVQGADALVILTSASPKMKPGFDPTKGGRPEFYYEDGAYPEQVDWIGQKNQIDAAKAAGV  126

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN+LGNGNIL+WKRKSE+YLADSGVPYTIIR GGLQDK+GG R
Sbjct  127  KHIVLVGSMGGTNPNHPLNSLGNGNILVWKRKSEQYLADSGVPYTIIRPGGLQDKDGGVR  186

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQT+ 
Sbjct  187  ELIVGKDDELLQTDT  201



>ref|XP_002530987.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31399.1| conserved hypothetical protein [Ricinus communis]
Length=323

 Score =   315 bits (806),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVYKKL+E S +Y+ RGLVR++ESK +I GA+D++IGDIR  ESIVP
Sbjct  76   TVLVTGAGGRTGSIVYKKLKERSGQYVARGLVRTQESKDKISGAEDVFIGDIRETESIVP  135

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDW GQKNQID AKAAGV
Sbjct  136  AIQGIDALIILTSAVPKMKPGFDPTKGGRPEFYFEDGAYPEQVDWTGQKNQIDAAKAAGV  195

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  196  KQIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGVR  255

Query  557  ELLVGKDDELLQTEN  601
            ELL+GKDDELLQTE 
Sbjct  256  ELLIGKDDELLQTET  270



>ref|XP_006480841.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Citrus sinensis]
Length=331

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
             K TVLVTGAGGRTGQIVYKKL+E S++Y  RGLVR+EESK +IGGADD++IGDIR++ S
Sbjct  81   AKSTVLVTGAGGRTGQIVYKKLKERSEQYAARGLVRTEESKQKIGGADDLFIGDIRDSNS  140

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA+IILTSAVP+MKP FDP+KG RPEFYFE+G  PEQVDWIGQKNQID AKA
Sbjct  141  IIPAIQGIDALIILTSAVPKMKPDFDPAKGGRPEFYFEEGAYPEQVDWIGQKNQIDAAKA  200

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK G
Sbjct  201  AGVKQIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEG  260

Query  548  GERELLVGKDDELLQTEN  601
            G RELLVGKDDELLQTE 
Sbjct  261  GIRELLVGKDDELLQTET  278



>ref|XP_006429112.1| hypothetical protein CICLE_v10012166mg [Citrus clementina]
 gb|ESR42352.1| hypothetical protein CICLE_v10012166mg [Citrus clementina]
Length=331

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 181/198 (91%), Gaps = 0/198 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
             K TVLVTGAGGRTGQIVYKKL+E S++Y  RGLVR+EESK +IGGADD++IGDIR++ S
Sbjct  81   AKSTVLVTGAGGRTGQIVYKKLKERSEQYAARGLVRTEESKQKIGGADDLFIGDIRDSNS  140

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA++ILTSAVP+MKP FDP+KG RPEFYFE+G  PEQVDWIGQKNQID AKA
Sbjct  141  IIPAIQGIDALLILTSAVPKMKPDFDPAKGGRPEFYFEEGAYPEQVDWIGQKNQIDAAKA  200

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK G
Sbjct  201  AGVKQIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEG  260

Query  548  GERELLVGKDDELLQTEN  601
            G RELLVGKDDELLQTE 
Sbjct  261  GIRELLVGKDDELLQTET  278



>gb|KHG19677.1| hypothetical protein F383_06456 [Gossypium arboreum]
Length=332

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SD+++ RGLVR+ ESK  IGGADD+++GDIR+  ++VP
Sbjct  85   TVLVTGAAGRTGQIVYKKLKERSDQFVVRGLVRTPESKETIGGADDVFVGDIRDTTTLVP  144

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTSAVPRMKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AK AGV
Sbjct  145  AMQGIDALIILTSAVPRMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDVAKEAGV  204

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQD++GG R
Sbjct  205  KQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDRDGGIR  264

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  265  ELLVGKDDELLQTET  279



>gb|AFM52663.1| putative NAD-dependent dehydrogenase 2 [Erythroxylum coca]
Length=253

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVYKKL+E SD+Y+ RGLVR++ESK +IGGA+D+++GDIR+AESI+P
Sbjct  6    TVLVTGAGGRTGSIVYKKLKERSDQYVARGLVRTQESKEKIGGAEDVFVGDIRDAESIIP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGID +IILTSAVP+MKPGFDPS+G RPEFY+EDG  PEQVDW+GQKNQID A A+GV
Sbjct  66   AVQGIDTLIILTSAVPKMKPGFDPSQGGRPEFYYEDGAFPEQVDWVGQKNQIDAATASGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN LGNGNILIWKRK+E+YLADSGVPYTIIRAGGL DK+GG R
Sbjct  126  KQIVLVGSMGGTNPNHPLNRLGNGNILIWKRKAEQYLADSGVPYTIIRAGGLLDKDGGIR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>ref|XP_011019848.1| PREDICTED: uncharacterized protein At5g02240 [Populus euphratica]
Length=315

 Score =   313 bits (801),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 180/194 (93%), Gaps = 1/194 (1%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPA  199
            VLVTGAGGRTG IVYKKL+E S++Y+ RGLVR+EESK +IGGA+D+++GDIR +ESI+PA
Sbjct  70   VLVTGAGGRTGSIVYKKLKERSEQYVARGLVRTEESKEKIGGAEDVFVGDIRESESIIPA  129

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            IQGID++IILTSAVP+MKPGFDPSKG RPEFYFEDG  PEQVDWIGQKNQID AKAAGVK
Sbjct  130  IQGIDSLIILTSAVPKMKPGFDPSKG-RPEFYFEDGAFPEQVDWIGQKNQIDAAKAAGVK  188

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
             IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQDK GG RE
Sbjct  189  QIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDKEGGVRE  248

Query  560  LLVGKDDELLQTEN  601
            LLVGKDDELLQTE 
Sbjct  249  LLVGKDDELLQTET  262



>ref|XP_009404595.1| PREDICTED: uncharacterized protein At5g02240 [Musa acuminata 
subsp. malaccensis]
Length=299

 Score =   311 bits (798),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    ADGKR-TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRN  178
            ADG    VLVTGAGGRTGQIVYKKL+E SD+++ RGLVR+ ESK +IGGADD+++GDIRN
Sbjct  46   ADGPAPVVLVTGAGGRTGQIVYKKLKERSDQFVARGLVRTAESKEKIGGADDVFVGDIRN  105

Query  179  AESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDT  358
            AESI+PA+QGI A+IILTSAVP+MKPGFDPSKGERPEFYFEDG  PEQVDWIGQKNQID 
Sbjct  106  AESIIPAVQGIHALIILTSAVPKMKPGFDPSKGERPEFYFEDGSYPEQVDWIGQKNQIDA  165

Query  359  AKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQD  538
            A+A GVK IVLVGSMGGT+ NHPLN +GNG ILIWKRK+E+YLADSG+PYTIIRAGGLQD
Sbjct  166  ARAVGVKQIVLVGSMGGTDINHPLNNIGNGKILIWKRKAEQYLADSGIPYTIIRAGGLQD  225

Query  539  KNGGERELLVGKDDELLQTEN  601
            K+GG RELLVGKDDELL+TE 
Sbjct  226  KDGGVRELLVGKDDELLKTET  246



>gb|KJB36701.1| hypothetical protein B456_006G171900 [Gossypium raimondii]
Length=300

 Score =   311 bits (798),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SD+++ RG VR+ ESK  IGGADD+++GDIR+  S+VP
Sbjct  85   TVLVTGAAGRTGQIVYKKLKERSDQFVVRGFVRTPESKETIGGADDVFVGDIRDTTSLVP  144

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTSAVPRMKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID A+ AGV
Sbjct  145  AMQGIDALIILTSAVPRMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDVAEEAGV  204

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQD++GG R
Sbjct  205  KQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDRDGGIR  264

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  265  ELLVGKDDELLQTET  279



>gb|KJB36699.1| hypothetical protein B456_006G171900 [Gossypium raimondii]
Length=332

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SD+++ RG VR+ ESK  IGGADD+++GDIR+  S+VP
Sbjct  85   TVLVTGAAGRTGQIVYKKLKERSDQFVVRGFVRTPESKETIGGADDVFVGDIRDTTSLVP  144

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTSAVPRMKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID A+ AGV
Sbjct  145  AMQGIDALIILTSAVPRMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDVAEEAGV  204

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQD++GG R
Sbjct  205  KQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDRDGGIR  264

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  265  ELLVGKDDELLQTET  279



>ref|XP_010920552.1| PREDICTED: uncharacterized protein At5g02240-like [Elaeis guineensis]
Length=306

 Score =   311 bits (797),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +D++I RGLVR+E+SK +IGGA+D+++GDIR+AESIVP
Sbjct  59   TVLVTGAGGRTGQIVYKKLKERTDQFIARGLVRTEDSKNKIGGANDVFVGDIRDAESIVP  118

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTSAVP+MKPGFDPSKGERPEFYFEDG  PEQVDWIGQKNQID AKA GV
Sbjct  119  AVQGIDALIILTSAVPKMKPGFDPSKGERPEFYFEDGSYPEQVDWIGQKNQIDAAKAVGV  178

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGT+ N+PLN +GNGNIL+WKRK+E+YLA+SG PYTIIRAGGLQDK+GG R
Sbjct  179  KQIVLVGSMGGTDVNNPLNNIGNGNILVWKRKAEQYLAESGTPYTIIRAGGLQDKDGGLR  238

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  239  ELLVGKDDELLKTET  253



>ref|XP_006294589.1| hypothetical protein CARUB_v10023624mg [Capsella rubella]
 gb|EOA27487.1| hypothetical protein CARUB_v10023624mg [Capsella rubella]
Length=326

 Score =   311 bits (798),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ RGLVR++ESK +I G D+++IGDIR+ E+I P
Sbjct  79   TVLVTGAGGRTGQIVYKKLKERSDQFVARGLVRTKESKEKINGEDEVFIGDIRDPEAIAP  138

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++GIDA++ILTSAVP+MKPGFDPSKG RPEFYFEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  139  AVEGIDALVILTSAVPQMKPGFDPSKGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGV  198

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  199  KQIVLVGSMGGTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  258

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  259  ELLVGKDDELLETET  273



>ref|XP_007026993.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY07495.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=333

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQI+YKKL+E SD+++TRGLVR+ ESK +IGGADD+++GDIR+  ++VP
Sbjct  86   TVLVTGAGGRTGQILYKKLKERSDQFVTRGLVRTPESKEKIGGADDVFVGDIRDPSTLVP  145

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQG+DA+IILTSAVPRMKPGFDP+KG RPEFYF+DG  PEQVDWIGQKNQID AK AGV
Sbjct  146  AIQGVDALIILTSAVPRMKPGFDPTKGGRPEFYFDDGAYPEQVDWIGQKNQIDVAKEAGV  205

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQD++GG R
Sbjct  206  KRIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDRDGGIR  265

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  266  ELLVGKDDELLQTET  280



>ref|XP_006650811.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Oryza brachyantha]
Length=257

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTG IVY KL+E S++++ RGLVR+EESK ++GG  D+YI DIR+   +VP
Sbjct  10   TVLVTGAGGRTGNIVYNKLQERSEQFVARGLVRTEESKQKVGGGVDVYIADIRDPTHLVP  69

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A QG+D +IILTSAVP+MKPGFDPSKG RPEFY+EDG+ PEQVDWIGQKNQID AKA+GV
Sbjct  70   AFQGVDVLIILTSAVPKMKPGFDPSKGGRPEFYYEDGMYPEQVDWIGQKNQIDAAKASGV  129

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN LGNGNIL+WKRKSE+YLADSGVPYTIIR GGLQDK+GG R
Sbjct  130  KHIVLVGSMGGTNPNHPLNNLGNGNILVWKRKSEQYLADSGVPYTIIRPGGLQDKDGGLR  189

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQT+ 
Sbjct  190  ELIVGKDDELLQTDT  204



>ref|XP_007134007.1| hypothetical protein PHAVU_010G011300g [Phaseolus vulgaris]
 gb|ESW06001.1| hypothetical protein PHAVU_010G011300g [Phaseolus vulgaris]
Length=255

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            RTVLVTG+GGRTGQIVYKKL+E  ++Y+ RGLVR+EESK +IGGADD+++GDIR+A SI 
Sbjct  7    RTVLVTGSGGRTGQIVYKKLKEKPNQYVARGLVRTEESKQKIGGADDVFVGDIRDAGSIT  66

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            PA +GID++IILTSAVP+MKPGFDP+KGERPEFYF +G  PEQVDWIGQKNQID AKAAG
Sbjct  67   PAFEGIDSLIILTSAVPQMKPGFDPTKGERPEFYFSEGAYPEQVDWIGQKNQIDAAKAAG  126

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            VKH+VLVGSMGGTN NHPLN+LG GNILIWKRK+E+YLADSGVPYTIIR GGL DK GG 
Sbjct  127  VKHVVLVGSMGGTNTNHPLNSLGKGNILIWKRKAEQYLADSGVPYTIIRPGGLLDKEGGI  186

Query  554  RELLVGKDDELLQTEN  601
            REL+VGKDDELLQTEN
Sbjct  187  RELIVGKDDELLQTEN  202



>ref|XP_009122796.1| PREDICTED: uncharacterized protein At5g02240 [Brassica rapa]
Length=253

 Score =   307 bits (787),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SDK++ +GLVR+ E K +IGG DD++IGDIR+AESI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKERSDKFVAKGLVRTPEGKEKIGGEDDVFIGDIRDAESITP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA++ILTSAVP+MKPGFDP+KG RPEF F+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  66   AIQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFDDGQYPEQVDWIGQKNQIDAAKAAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNP+HPLN LGNGNILIWKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVLVGSMGGTNPDHPLNKLGNGNILIWKRKAEQYLADSGTPYTIIRAGGLLDKEGGAR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>emb|CDX93359.1| BnaC04g45370D [Brassica napus]
Length=329

 Score =   309 bits (792),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ RGLVR++ESK +IGG D++++GDIR+ ESI P
Sbjct  81   TVLVTGAGGRTGQIVYKKLKERSDQFVARGLVRTKESKEKIGGEDEVFVGDIRDPESIAP  140

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKGERPEFYFE+G  PEQVDWIGQKNQID AKAAG+
Sbjct  141  AVQGIDALVILTSAVPKMKPGFDPSKGERPEFYFEEGAYPEQVDWIGQKNQIDAAKAAGI  200

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN N+PLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  201  KQIVLVGSMGGTNINNPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  260

Query  557  ELLVGKDDELLQTE  598
            EL+VGKDDE+L+TE
Sbjct  261  ELIVGKDDEILETE  274



>emb|CDY40342.1| BnaA10g27260D [Brassica napus]
Length=253

 Score =   306 bits (784),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TV+VTGA GRTGQIVYKKL+E SDK++ +GLVR+ E K +IGG DD++IGDIR+AESI P
Sbjct  6    TVIVTGASGRTGQIVYKKLKERSDKFVAKGLVRTPEGKEKIGGEDDVFIGDIRDAESITP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA++ILTSAVP+MKPGFDP+KG RPEF F+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  66   AIQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFDDGQYPEQVDWIGQKNQIDAAKAAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNP+HPLN LGNGNILIWKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVLVGSMGGTNPDHPLNKLGNGNILIWKRKAEQYLADSGTPYTIIRAGGLLDKEGGAR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>emb|CDY65254.1| BnaA04g29010D [Brassica napus]
Length=324

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ RGLVR++ESK +IGG D++++GDIR+ E+I P
Sbjct  76   TVLVTGAGGRTGQIVYKKLKERSDQFVARGLVRTKESKEKIGGEDEVFVGDIRDPEAIAP  135

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKGERPEFYFE+G  PEQVDWIGQKNQID AKAAGV
Sbjct  136  AVQGIDALVILTSAVPKMKPGFDPSKGERPEFYFEEGAYPEQVDWIGQKNQIDAAKAAGV  195

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN N+PLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  196  KQIVLVGSMGGTNINNPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  255

Query  557  ELLVGKDDELLQTE  598
            EL+VGKDDE+L+TE
Sbjct  256  ELIVGKDDEILETE  269



>ref|XP_009345400.1| PREDICTED: uncharacterized protein At5g02240-like [Pyrus x bretschneideri]
Length=322

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
            G  TVLVTGAGGRTG++VYKKL+E SD+++ RGLVRSEESK  IGGADD+YIGDIR+A+S
Sbjct  72   GASTVLVTGAGGRTGKLVYKKLKETSDQFVARGLVRSEESKQSIGGADDLYIGDIRDADS  131

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA++ILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKA
Sbjct  132  ILPAIQGIDALVILTSAVPKMKPGFDPTKGGRPEFYFEDGSYPEQVDWIGQKNQIDAAKA  191

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGT+ N+PLN LG+GNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK G
Sbjct  192  AGVKQIVLVGSMGGTDLNNPLNKLGDGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEG  251

Query  548  GERELLVGKDDELLQTEN  601
            G RELL+GKDDELL+TE 
Sbjct  252  GIRELLIGKDDELLKTET  269



>gb|EYU41733.1| hypothetical protein MIMGU_mgv1a010429mg [Erythranthe guttata]
Length=312

 Score =   308 bits (789),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGAGGRTGQIVYKKL+E SD++  RGLVR++ESK +I G D +YIGDIRN E++
Sbjct  63   KSTVLVTGAGGRTGQIVYKKLKERSDQFNARGLVRTQESKEKINGDDSVYIGDIRNTETL  122

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
               IQGIDA+IILTS VP+MKPGFDP+KG RPEFYFEDG +PEQVDWIGQKNQID AKAA
Sbjct  123  ASPIQGIDALIILTSGVPKMKPGFDPAKGGRPEFYFEDGANPEQVDWIGQKNQIDAAKAA  182

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVK IV+VGSMGGTN +HPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG
Sbjct  183  GVKQIVVVGSMGGTNLDHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGG  242

Query  551  ERELLVGKDDELLQTEN  601
             RELLVGKDDELLQTE 
Sbjct  243  IRELLVGKDDELLQTET  259



>ref|XP_008369910.1| PREDICTED: uncharacterized protein At5g02240-like [Malus domestica]
Length=322

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
            G  TVLVTGAGGRTG++VY+KL+E SD+Y+ RGLVRSEESK  IGGADD+YIGDIR+A+S
Sbjct  72   GASTVLVTGAGGRTGKLVYEKLKERSDQYVARGLVRSEESKQSIGGADDLYIGDIRDADS  131

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA++ILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKA
Sbjct  132  ILPAIQGIDALVILTSAVPKMKPGFDPTKGGRPEFYFEDGSYPEQVDWIGQKNQIDAAKA  191

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGT+ N+PLN LG+GNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK G
Sbjct  192  AGVKQIVLVGSMGGTDLNNPLNKLGDGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEG  251

Query  548  GERELLVGKDDELLQTEN  601
            G RELL+GKDDELL+TE 
Sbjct  252  GIRELLIGKDDELLKTET  269



>ref|XP_008387781.1| PREDICTED: uncharacterized protein At5g02240-like [Malus domestica]
Length=323

 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
            G   VLVTGAGGRTG++VYKKL+E SD+Y+ RGLVR+EESK  IGG DD+Y+GDIR+A+S
Sbjct  73   GASIVLVTGAGGRTGKLVYKKLKERSDQYVARGLVRTEESKQSIGGXDDLYVGDIRDADS  132

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA+IILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKA
Sbjct  133  ILPAIQGIDALIILTSAVPKMKPGFDPTKGGRPEFYFEDGSYPEQVDWIGQKNQIDAAKA  192

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AG K IVLVGSMGGT+ N+PLN LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK G
Sbjct  193  AGAKQIVLVGSMGGTDLNNPLNKLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEG  252

Query  548  GERELLVGKDDELLQTEN  601
            G RELL+GKDDELL+TE 
Sbjct  253  GNRELLIGKDDELLKTET  270



>ref|XP_002309064.2| hypothetical protein POPTR_0006s08710g [Populus trichocarpa]
 gb|EEE92587.2| hypothetical protein POPTR_0006s08710g [Populus trichocarpa]
Length=323

 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 179/194 (92%), Gaps = 1/194 (1%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPA  199
            VLVTGAGGRTG IVYKKL+E S++Y+ RGLVR+EESK +IGGA+D+++GDIR ++SIVPA
Sbjct  78   VLVTGAGGRTGSIVYKKLKERSEQYVARGLVRTEESKEKIGGAEDVFVGDIRESKSIVPA  137

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            IQGID++IILTSAVP+MKPG DPSKG RPEFYFEDG  PEQVDWIGQKNQID AKAAGVK
Sbjct  138  IQGIDSLIILTSAVPKMKPGSDPSKG-RPEFYFEDGAFPEQVDWIGQKNQIDAAKAAGVK  196

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
             IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSGVPYTI+RAGGLQDK GG RE
Sbjct  197  QIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGVPYTILRAGGLQDKEGGVRE  256

Query  560  LLVGKDDELLQTEN  601
            LLVGKDDELLQTE 
Sbjct  257  LLVGKDDELLQTET  270



>gb|AFK49538.1| unknown [Medicago truncatula]
 gb|KEH22902.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=329

 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGAGGRTGQIVYKKL+E  ++YI RGLVRSEESK +IG ADD++IGDIR+ ES+
Sbjct  80   KSTVLVTGAGGRTGQIVYKKLKERPNEYIARGLVRSEESKQKIGAADDVFIGDIRDTESL  139

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
             PAIQGIDA+IILTS VP MKPGFDP++G+RPEFYFEDG  PEQVDWIGQKNQID AKAA
Sbjct  140  APAIQGIDALIILTSGVPLMKPGFDPTQGKRPEFYFEDGAYPEQVDWIGQKNQIDAAKAA  199

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVK IVLVGSMGGT+ NHPLN+LG+GNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG
Sbjct  200  GVKQIVLVGSMGGTDLNHPLNSLGDGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGG  259

Query  551  ERELLVGKDDELLQTE  598
             REL++GKDDELL+T+
Sbjct  260  IRELVIGKDDELLKTD  275



>ref|XP_009141679.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic [Brassica 
rapa]
Length=328

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +D+++ RGLVR++ESK +IGG D++++GDIR+ E+I P
Sbjct  81   TVLVTGAGGRTGQIVYKKLKERADQFVARGLVRTKESKEKIGGEDEVFVGDIRDPEAIAP  140

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKGERPEFYFE+G  PEQVDWIGQKNQID AKAAGV
Sbjct  141  AVQGIDALVILTSAVPKMKPGFDPSKGERPEFYFEEGAYPEQVDWIGQKNQIDAAKAAGV  200

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN N+PLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  201  KQIVLVGSMGGTNINNPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  260

Query  557  ELLVGKDDELLQTE  598
            EL+VGKDDE+L+TE
Sbjct  261  ELIVGKDDEILETE  274



>ref|XP_007205763.1| hypothetical protein PRUPE_ppa010325mg [Prunus persica]
 gb|EMJ06962.1| hypothetical protein PRUPE_ppa010325mg [Prunus persica]
Length=254

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
            G  TVLVTGAGGRTG+IVYKKLRE +D+Y+ RGLVR+EESK  IGGADDI+IGDIR+A S
Sbjct  5    GPSTVLVTGAGGRTGKIVYKKLRE-ADQYVARGLVRTEESKESIGGADDIFIGDIRDANS  63

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA++ILTSAVP+MKPGFDP+KG RPEFYF+DG  PEQVDWIGQKNQID AKA
Sbjct  64   ILPAIQGIDALVILTSAVPKMKPGFDPTKGGRPEFYFDDGSYPEQVDWIGQKNQIDAAKA  123

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGT+ N+PLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQDK G
Sbjct  124  AGVKQIVLVGSMGGTDINNPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDKEG  183

Query  548  GERELLVGKDDELLQTEN  601
            G RELL+GKDDELL+TE 
Sbjct  184  GIRELLIGKDDELLKTET  201



>ref|XP_008240773.1| PREDICTED: uncharacterized protein At5g02240 [Prunus mume]
Length=330

 Score =   307 bits (787),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
            G  TVLVTGAGGRTG+IVYKKL+E +D+Y+ RGLVR+EESK  IGGADDI+IGDIR+A S
Sbjct  81   GPSTVLVTGAGGRTGKIVYKKLKE-ADQYVARGLVRTEESKESIGGADDIFIGDIRDANS  139

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA++ILTSAVPRMKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKA
Sbjct  140  ILPAIQGIDALVILTSAVPRMKPGFDPTKGGRPEFYFEDGSYPEQVDWIGQKNQIDAAKA  199

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGT+ N+PLN+LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQDK G
Sbjct  200  AGVKQIVLVGSMGGTDINNPLNSLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDKEG  259

Query  548  GERELLVGKDDELLQTEN  601
            G RELL+GKDDELL+TE 
Sbjct  260  GIRELLIGKDDELLKTET  277



>ref|XP_009341745.1| PREDICTED: uncharacterized protein At5g02240-like [Pyrus x bretschneideri]
Length=322

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
            G  TVLVTGAGGRTG++VY+KL+E SD+++ RGLVRSEESK  IGGADDIYIGDIR+A+S
Sbjct  72   GASTVLVTGAGGRTGKLVYEKLKETSDQFVARGLVRSEESKQSIGGADDIYIGDIRDADS  131

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGIDA++ILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKA
Sbjct  132  ILPAIQGIDALVILTSAVPKMKPGFDPTKGGRPEFYFEDGSYPEQVDWIGQKNQIDAAKA  191

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGVK IVLVGSMGGT+ N+PLN LG+GNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK G
Sbjct  192  AGVKQIVLVGSMGGTDLNNPLNKLGDGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEG  251

Query  548  GERELLVGKDDELLQTEN  601
            G RELL+GKDDELL+TE 
Sbjct  252  GIRELLIGKDDELLKTET  269



>ref|XP_010111446.1| hypothetical protein L484_021269 [Morus notabilis]
 gb|EXC30969.1| hypothetical protein L484_021269 [Morus notabilis]
Length=323

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E S +Y+ RGLVR++ESK ++GGADD+Y+GDIR+A SI P
Sbjct  76   TVLVTGAGGRTGQIVYKKLKERSGQYVARGLVRTDESKEKLGGADDLYVGDIRDANSIAP  135

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IILTSAVP+MK GFDP++G RPEFYF++G  PEQVDWIGQK QID AKAAGV
Sbjct  136  AIQGIDALIILTSAVPKMKTGFDPTQGGRPEFYFDEGAYPEQVDWIGQKIQIDAAKAAGV  195

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVL+GSMGGT+PNHPLN+LGNGNILIWKRK+E+YLADSGVPYTIIRAGGLQDK GG R
Sbjct  196  KQIVLIGSMGGTDPNHPLNSLGNGNILIWKRKAEQYLADSGVPYTIIRAGGLQDKEGGAR  255

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  256  ELLVGKDDELLKTET  270



>gb|AFK40676.1| unknown [Lotus japonicus]
Length=313

 Score =   306 bits (785),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 180/201 (90%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    ADGKR-TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRN  178
            AD  R TVLVTGAGGRTG+IVYKKL+E S +YI RGLVR+EESK  IG +DD+Y+GDIR+
Sbjct  60   ADSSRSTVLVTGAGGRTGKIVYKKLQERSSQYIARGLVRTEESKQTIGASDDVYVGDIRD  119

Query  179  AESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDT  358
              SI PAIQGIDA+IILTSAVP MKPGF+P+KGERPEFYFEDG  PEQVDWIGQKNQID 
Sbjct  120  TGSIAPAIQGIDALIILTSAVPLMKPGFNPTKGERPEFYFEDGAYPEQVDWIGQKNQIDA  179

Query  359  AKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQD  538
            AKAAGVK IVLVGSMGGT+ N+PLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQD
Sbjct  180  AKAAGVKQIVLVGSMGGTDLNNPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQD  239

Query  539  KNGGERELLVGKDDELLQTEN  601
            K GG REL++GKDDE+L+TE 
Sbjct  240  KEGGVRELIIGKDDEILKTET  260



>ref|NP_565868.1| NAD(P)-binding Rossmann-fold-containing protein [Arabidopsis 
thaliana]
 sp|O80934.2|Y2766_ARATH RecName: Full=Uncharacterized protein At2g37660, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK68767.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10018.1| unknown protein [Arabidopsis thaliana]
 gb|AAC23636.2| expressed protein [Arabidopsis thaliana]
 gb|AAM61751.1| putative 3-beta hydroxysteroid dehydrogenase/isomerase protein 
[Arabidopsis thaliana]
 gb|AEC09431.1| NAD(P)-binding Rossmann-fold-containing protein [Arabidopsis 
thaliana]
Length=325

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E S++++ RGLVR++ESK +I G D+++IGDIR+  SI P
Sbjct  78   TVLVTGAGGRTGQIVYKKLKERSEQFVARGLVRTKESKEKINGEDEVFIGDIRDTASIAP  137

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++GIDA++ILTSAVP+MKPGFDPSKG RPEF+F+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  138  AVEGIDALVILTSAVPQMKPGFDPSKGGRPEFFFDDGAYPEQVDWIGQKNQIDAAKAAGV  197

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  198  KQIVLVGSMGGTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGGIR  257

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  258  ELLVGKDDELLETET  272



>gb|KFK36667.1| hypothetical protein AALP_AA4G154200 [Arabis alpina]
Length=329

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ RGLVR++ESK +IGG D+++IGDIR++E+I  
Sbjct  82   TVLVTGAGGRTGQIVYKKLKERSDQFVARGLVRTQESKEKIGGEDEVFIGDIRDSEAIAS  141

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKG RPEF+FEDG  PEQVDW+GQKNQID AKAAGV
Sbjct  142  AVQGIDALVILTSAVPQMKPGFDPSKGGRPEFFFEDGSYPEQVDWLGQKNQIDAAKAAGV  201

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  202  KQIVLVGSMGGTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  261

Query  557  ELLVGKDDELLQTE  598
            EL+VGKDDELL+TE
Sbjct  262  ELVVGKDDELLETE  275



>ref|XP_006846253.1| hypothetical protein AMTR_s00012p00241210 [Amborella trichopoda]
 gb|ERN07928.1| hypothetical protein AMTR_s00012p00241210 [Amborella trichopoda]
Length=254

 Score =   304 bits (778),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTG +VY+KL++ SD+++ RGLVRSEESKA+IGG+DD++IGDIRN E+IVP
Sbjct  6    TVLVTGASGRTGHLVYEKLKQGSDQFVARGLVRSEESKAKIGGSDDVFIGDIRNCEAIVP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI GIDA+IILTSA P+MKPG+DPSKG  PEFY+E+G  PEQVDWIGQKNQID AK AGV
Sbjct  66   AIHGIDALIILTSAAPKMKPGYDPSKGGPPEFYYEEGSYPEQVDWIGQKNQIDAAKEAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN +GNGNIL+WKRKSE+YLADSGVPYTIIRAGGL DK GG+R
Sbjct  126  KHIVLVGSMGGTNPNHPLNRMGNGNILVWKRKSEQYLADSGVPYTIIRAGGLLDKEGGKR  185

Query  557  ELLVGKDDELLQT  595
            ELLVGKDDELL T
Sbjct  186  ELLVGKDDELLAT  198



>ref|XP_008784609.1| PREDICTED: uncharacterized protein At5g02240-like isoform X1 
[Phoenix dactylifera]
Length=306

 Score =   306 bits (783),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVY KL+E +D+++ RGLVR+E+SK +IGG DD+ +GDIR+AESIVP
Sbjct  59   TVLVTGAGGRTGQIVYNKLKERTDQFLARGLVRTEDSKNKIGGHDDVLVGDIRDAESIVP  118

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTS+VP+MKPGFDPSKGERPEFYFEDG  PEQVDWIGQKNQID AKA GV
Sbjct  119  AVQGIDALIILTSSVPKMKPGFDPSKGERPEFYFEDGSYPEQVDWIGQKNQIDAAKAVGV  178

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGT+ N+PLN +GNGNIL+WKRK+E+YL +SG+PYTIIRAGGLQDK+GG R
Sbjct  179  KQIVLVGSMGGTDVNNPLNNIGNGNILVWKRKAEQYLTESGIPYTIIRAGGLQDKDGGLR  238

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  239  ELLVGKDDELLKTET  253



>emb|CDY10458.1| BnaCnng03590D [Brassica napus]
Length=253

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA G+TGQIVYKKL+E SDK++ +GLVR+ + K +IGG DD++IGDIR+A+SI P
Sbjct  6    TVLVTGASGKTGQIVYKKLKERSDKFVAKGLVRTPQGKEKIGGEDDVFIGDIRDADSITP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA++ILTSAVP+MKPGFDP+KG RPEF F+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  66   AIQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFDDGQYPEQVDWIGQKNQIDAAKAAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNP+HPLN LGNGNILIWKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVLVGSMGGTNPDHPLNKLGNGNILIWKRKAEQYLADSGTPYTIIRAGGLLDKEGGAR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>gb|EPS62696.1| hypothetical protein M569_12093, partial [Genlisea aurea]
Length=258

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K +VL+TGAGGRTGQIVYKKL+E SD+Y TR LVRS+ESK ++GG D +Y+GDIR+ +SI
Sbjct  9    KVSVLLTGAGGRTGQIVYKKLKERSDRYDTRALVRSQESKDKLGGGDHVYVGDIRDIDSI  68

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            VPA+QG+DA+IILTSAVP+M+PGFD +KG RP FYFEDGL PEQVDW GQKNQID AKAA
Sbjct  69   VPAVQGVDAVIILTSAVPKMEPGFDVAKGGRPNFYFEDGLYPEQVDWHGQKNQIDAAKAA  128

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGGTN +HPLN+LGNGNIL+WKRK+EEYL++SGVPYTIIRAGGLQDK GG
Sbjct  129  GVKHIVLVGSMGGTNTSHPLNSLGNGNILVWKRKAEEYLSESGVPYTIIRAGGLQDKEGG  188

Query  551  ERELLVGKDDELLQTEN  601
             RELLVGKDDELL+T+ 
Sbjct  189  VRELLVGKDDELLKTDT  205



>gb|KFK36666.1| hypothetical protein AALP_AA4G154200 [Arabis alpina]
Length=354

 Score =   307 bits (786),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ RGLVR++ESK +IGG D+++IGDIR++E+I  
Sbjct  107  TVLVTGAGGRTGQIVYKKLKERSDQFVARGLVRTQESKEKIGGEDEVFIGDIRDSEAIAS  166

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKG RPEF+FEDG  PEQVDW+GQKNQID AKAAGV
Sbjct  167  AVQGIDALVILTSAVPQMKPGFDPSKGGRPEFFFEDGSYPEQVDWLGQKNQIDAAKAAGV  226

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  227  KQIVLVGSMGGTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  286

Query  557  ELLVGKDDELLQTE  598
            EL+VGKDDELL+TE
Sbjct  287  ELVVGKDDELLETE  300



>ref|XP_009143466.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Brassica rapa]
Length=322

 Score =   306 bits (783),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ RGLVR++ESK +IGG D+++IGDIR+  +I P
Sbjct  75   TVLVTGAGGRTGQIVYKKLKERSDEFVARGLVRTKESKEKIGGEDEVFIGDIRDPSAIAP  134

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKG RPEFYF++G  PEQVDWIGQKNQID AKAAGV
Sbjct  135  AVQGIDALVILTSAVPQMKPGFDPSKGGRPEFYFDEGAYPEQVDWIGQKNQIDAAKAAGV  194

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  195  KQIVLVGSMGGTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  254

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  255  ELLVGKDDELLETET  269



>ref|XP_004492363.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Cicer arietinum]
Length=325

 Score =   305 bits (780),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 180/199 (90%), Gaps = 0/199 (0%)
 Frame = +2

Query  5    DGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAE  184
            + K +VLVTGAGGRTGQIVY+KL+E  ++Y  RG VR+EESK +IG ADD++IGDIR+ E
Sbjct  74   NSKSSVLVTGAGGRTGQIVYQKLKERPNQYAARGFVRTEESKQKIGDADDVFIGDIRDTE  133

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            S++PAIQGIDA+IILTSAVP MKPGFDP++G+RPEFYF++G  PEQVDWIGQKNQID AK
Sbjct  134  SLIPAIQGIDALIILTSAVPLMKPGFDPTQGKRPEFYFDEGAYPEQVDWIGQKNQIDAAK  193

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            AAGVK IVL+GSMGGT+ NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK 
Sbjct  194  AAGVKQIVLIGSMGGTDLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKE  253

Query  545  GGERELLVGKDDELLQTEN  601
            GG REL++GKDDELLQTE 
Sbjct  254  GGIRELIIGKDDELLQTET  272



>gb|EAY96261.1| hypothetical protein OsI_18159 [Oryza sativa Indica Group]
Length=293

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +D+++ RGLVR+EESKA+IGGA D+++GDIR+  SI P
Sbjct  46   TVLVTGAGGRTGQIVYKKLKERADQFVGRGLVRTEESKAKIGGAADVFVGDIRDPASIAP  105

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI GIDA+IILTSAVP+MKPGFDPSKG RPEFYFEDG  PEQVDWIGQKNQID AK+ GV
Sbjct  106  AIDGIDALIILTSAVPKMKPGFDPSKGGRPEFYFEDGSYPEQVDWIGQKNQIDAAKSIGV  165

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K +VLVGSMGGT+ NHPLN LGN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  166  KQVVLVGSMGGTDVNHPLNKLGNANILVWKRKAEQYLADSGLPYTIIRAGGLQDKDGGVR  225

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDE+L+TE 
Sbjct  226  ELLVGKDDEILKTET  240



>gb|KFK24707.1| hypothetical protein AALP_AA8G014100 [Arabis alpina]
Length=253

 Score =   301 bits (772),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SDK++ RGL R+ E K +IGG DD++IGDIR+ +SI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKEGSDKFVARGLARTVEGKEKIGGEDDVFIGDIRDVDSISP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  66   AIQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKAAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNP+HPLN  GNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVLVGSMGGTNPDHPLNKFGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGAR  185

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQT+ 
Sbjct  186  ELIVGKDDELLQTDT  200



>ref|XP_002439133.1| hypothetical protein SORBIDRAFT_09g001130 [Sorghum bicolor]
 gb|EES17563.1| hypothetical protein SORBIDRAFT_09g001130 [Sorghum bicolor]
Length=299

 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            RTVLVTGAGGRTGQIVYKKL+E + +++ RGLV +EESK +IGG DD+++GDIR+ ESI 
Sbjct  51   RTVLVTGAGGRTGQIVYKKLKERAGEFVGRGLVTTEESKGKIGGGDDVFVGDIRDPESIA  110

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            PAI+GIDA+IILTSAVP+MKPGFDPSKGERPEFYFE+G  PEQVDWIGQKNQID AK+ G
Sbjct  111  PAIEGIDALIILTSAVPKMKPGFDPSKGERPEFYFEEGSYPEQVDWIGQKNQIDAAKSIG  170

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
             KHIVLVGSMGGT+ NHPLN LGN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG 
Sbjct  171  AKHIVLVGSMGGTDTNHPLNKLGNANILVWKRKAEQYLADSGLPYTIIRAGGLQDKDGGL  230

Query  554  RELLVGKDDELLQTEN  601
            REL+VGKDDE+L+TE 
Sbjct  231  RELIVGKDDEILKTET  246



>ref|XP_010553281.1| PREDICTED: uncharacterized protein At5g02240 [Tarenaya hassleriana]
Length=328

 Score =   304 bits (778),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            RTVLVTGAGGRTGQIVY KL+E  D+++ RGLVR++ESK +IGG DD+Y+GDIR+A +I 
Sbjct  80   RTVLVTGAGGRTGQIVYTKLKERPDQFVARGLVRTDESKEKIGGEDDVYVGDIRDAAAIA  139

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            PA+QGIDA+IILTSAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID A AAG
Sbjct  140  PAVQGIDALIILTSAVPKMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDAAMAAG  199

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            VK IVLVGSMGGTN N+PLN++GNGNIL+WKRK+E+YLADSGVPYTI+RAGGLQDK GG 
Sbjct  200  VKQIVLVGSMGGTNLNNPLNSIGNGNILVWKRKAEQYLADSGVPYTIVRAGGLQDKEGGI  259

Query  554  RELLVGKDDELLQTEN  601
            RELLVGKDDELL+T+ 
Sbjct  260  RELLVGKDDELLETDT  275



>ref|XP_010509296.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic [Camelina 
sativa]
Length=327

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIV+KKL+E SD+++ RGLVR++ESK +I G D+++IGDIR+  ++  
Sbjct  80   TVLVTGAGGRTGQIVFKKLKERSDQFVARGLVRTKESKEKISGEDEVFIGDIRDPAAVAS  139

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++GIDA++ILTSAVP+MKPGFDPSKG RPEFYF+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  140  AVEGIDALVILTSAVPKMKPGFDPSKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKAAGV  199

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  200  KQIVLVGSMGGTNLNHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  259

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  260  ELLVGKDDELLETET  274



>ref|NP_001054439.1| Os05g0110300 [Oryza sativa Japonica Group]
 gb|AAK73149.1|AC079022_22 putative 3-beta hydroxysteroid dehydrogenase/isomerase protein 
[Oryza sativa]
 gb|AAU44198.1| putative 3-beta hydroxysteroid dehydrogenase/isomerase [Oryza 
sativa Japonica Group]
 dbj|BAF16353.1| Os05g0110300 [Oryza sativa Japonica Group]
 dbj|BAG92275.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90277.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +D+++ RGLVR+EESKA+IGGA D+++GDIR+  SI P
Sbjct  46   TVLVTGAGGRTGQIVYKKLKERADQFVGRGLVRTEESKAKIGGAADVFVGDIRDPASIAP  105

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI GIDA+IILTSAVP+MKPGFDPSKG RPEFYFEDG  PEQVDWIGQ+NQID AK+ GV
Sbjct  106  AIDGIDALIILTSAVPKMKPGFDPSKGGRPEFYFEDGSYPEQVDWIGQRNQIDAAKSIGV  165

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K +VLVGSMGGT+ NHPLN LGN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  166  KQVVLVGSMGGTDVNHPLNKLGNANILVWKRKAEQYLADSGLPYTIIRAGGLQDKDGGVR  225

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDE+L+TE 
Sbjct  226  ELLVGKDDEILKTET  240



>ref|XP_010517038.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Camelina sativa]
Length=330

 Score =   302 bits (774),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 176/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIV+KKL+E SD+++ +GLVR++ESK +I G D+++IGDIR+  +I  
Sbjct  83   TVLVTGAGGRTGQIVFKKLKERSDQFVAKGLVRTKESKEKISGEDEVFIGDIRDPAAIAS  142

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++GIDA++ILTSAVP+MKPGFDPSKG RPEFYF+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  143  AVEGIDALVILTSAVPKMKPGFDPSKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKAAGV  202

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  203  KQIVLVGSMGGTNLNHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  262

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  263  ELLVGKDDELLETET  277



>ref|NP_568098.1| ABA modulated tyrosine-phosphorylated protein [Arabidopsis thaliana]
 sp|Q94EG6.1|Y5224_ARATH RecName: Full=Uncharacterized protein At5g02240 [Arabidopsis 
thaliana]
 gb|AAK95322.1|AF410336_1 AT5g02240/T7H20_290 [Arabidopsis thaliana]
 gb|AAM98309.1| At5g02240/T7H20_290 [Arabidopsis thaliana]
 gb|AAN31891.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90449.1| ABA modulated tyrosine-phosphorylated protein [Arabidopsis thaliana]
Length=253

 Score =   299 bits (765),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SDK++ +GLVRS + K +IGG  D++IGDI +A+SI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A QGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVDWIGQKNQID AK AGV
Sbjct  66   AFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>ref|XP_010543294.1| PREDICTED: uncharacterized protein At5g02240 [Tarenaya hassleriana]
Length=253

 Score =   299 bits (765),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SD+++ +GLVR+ E K +IGG DD+++GDIR+  SI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKERSDQFVAKGLVRTPEGKEKIGGKDDVFVGDIRDEHSINP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGID++IILTSAVP+MKPGFDP+ G RPEF FEDG  PEQVDWIGQKNQID AKAAGV
Sbjct  66   AIQGIDSLIILTSAVPKMKPGFDPTAGGRPEFTFEDGQYPEQVDWIGQKNQIDVAKAAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTNPNHPLN LGNGNILIWKRK+E+YLADSG+PYT++RAGGL DK GG R
Sbjct  126  KHIVLVGSMGGTNPNHPLNKLGNGNILIWKRKAEQYLADSGIPYTLLRAGGLIDKEGGAR  185

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQT+ 
Sbjct  186  ELIVGKDDELLQTDT  200



>pdb|1XQ6|A Chain A, X-ray Structure Of Gene Product From Arabidopsis Thaliana 
At5g02240
 pdb|1XQ6|B Chain B, X-ray Structure Of Gene Product From Arabidopsis Thaliana 
At5g02240
 pdb|1YBM|A Chain A, X-Ray Structure Of Selenomethionyl Gene Product From 
Arabidopsis Thaliana At5g02240 In Space Group P21212
 pdb|1YBM|B Chain B, X-Ray Structure Of Selenomethionyl Gene Product From 
Arabidopsis Thaliana At5g02240 In Space Group P21212
 pdb|2Q46|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At5g02240
 pdb|2Q46|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At5g02240
 pdb|2Q4B|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Selenomethionyl Gene Product From Arabidopsis Thaliana At5g02240 
In Space Group P21212
 pdb|2Q4B|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Selenomethionyl Gene Product From Arabidopsis Thaliana At5g02240 
In Space Group P21212
Length=253

 Score =   299 bits (765),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SDK++ +GLVRS + K +IGG  D++IGDI +A+SI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A QGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVDWIGQKNQID AK AGV
Sbjct  66   AFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>ref|XP_010505358.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Camelina sativa]
Length=327

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIV+KKL+E SD+++ +GLVR++ESK +I G D+++IGDIR+  +I  
Sbjct  80   TVLVTGAGGRTGQIVFKKLKERSDQFVAKGLVRTKESKEKISGEDEVFIGDIRDPSAIAS  139

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++GID ++ILTSAVP+MKPGFDPSKG RPEFYF+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  140  AVEGIDTLVILTSAVPKMKPGFDPSKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKAAGV  199

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  200  KQIVLVGSMGGTNLNHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  259

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  260  ELLVGKDDELLETET  274



>ref|XP_006410956.1| hypothetical protein EUTSA_v10016917mg [Eutrema salsugineum]
 gb|ESQ52409.1| hypothetical protein EUTSA_v10016917mg [Eutrema salsugineum]
Length=330

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ +GLVR++ESK +IGG D+++IGDIR+  +I  
Sbjct  83   TVLVTGAGGRTGQIVYKKLKERSDQFVAKGLVRTKESKEKIGGEDEVFIGDIRDPAAIAS  142

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKG RPEF+FE+G  PEQVDWIGQKNQID AKAAGV
Sbjct  143  AVQGIDALVILTSAVPQMKPGFDPSKGGRPEFFFEEGAYPEQVDWIGQKNQIDAAKAAGV  202

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  203  KQIVLVGSMGGTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIR  262

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+T+ 
Sbjct  263  ELLVGKDDELLETDT  277



>gb|AFK33771.1| unknown [Lotus japonicus]
Length=250

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 177/195 (91%), Gaps = 2/195 (1%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYK L+E   +Y+ RGLVR+EESK +IGGADD++IGDIR+A SIVP
Sbjct  5    TVLVTGAGGRTGQIVYKTLKER--QYVARGLVRTEESKQKIGGADDVFIGDIRDAGSIVP  62

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQGIDA+IILTSA P+MKPGFDP+KG RPEFYF+DG  PEQVDWIGQKNQID AKAAGV
Sbjct  63   AIQGIDALIILTSATPKMKPGFDPTKGGRPEFYFDDGAYPEQVDWIGQKNQIDAAKAAGV  122

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K +VLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIR GGL DK+GG R
Sbjct  123  KRVVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRPGGLLDKDGGLR  182

Query  557  ELLVGKDDELLQTEN  601
            EL++GKDDELLQTE 
Sbjct  183  ELILGKDDELLQTET  197



>ref|XP_004960531.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Setaria italica]
Length=302

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E + +++ RGLVR+EESK +IGGADD++IGDIR+ ESI  
Sbjct  55   TVLVTGAGGRTGQIVYKKLKERAGQFVGRGLVRTEESKGKIGGADDVFIGDIRDPESIAS  114

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI+GIDA+IILTSAVP+MKPGFDPSKG RPEFYFE+G  PEQVDWIGQKNQID AK+ GV
Sbjct  115  AIEGIDALIILTSAVPKMKPGFDPSKGGRPEFYFEEGSYPEQVDWIGQKNQIDAAKSIGV  174

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGT+ NHPLN LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  175  KHIVLVGSMGGTDINHPLNKLGNGNILVWKRKAEQYLADSGLPYTIIRAGGLQDKDGGLR  234

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDE+L+TE 
Sbjct  235  ELIVGKDDEILKTET  249



>ref|XP_010490641.1| PREDICTED: uncharacterized protein At5g02240-like [Camelina sativa]
Length=253

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E+SDK++ RGLVR+ + K +IGG DD++IGDI  AES+ P
Sbjct  6    TVLVTGASGRTGQIVYKKLKESSDKFVARGLVRTADGKEKIGGGDDVFIGDITVAESVKP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVDWIGQKNQID AK AGV
Sbjct  66   AVQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGAR  185

Query  557  ELLVGKDDELLQT  595
            ELLVGKDDELL+T
Sbjct  186  ELLVGKDDELLET  198



>gb|ABK22551.1| unknown [Picea sitchensis]
Length=254

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +2

Query  5    DGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAE  184
            D   TVLVTGAGGRTG++VYKKL+E   ++++RG VR+EESK +IGG DD+++GD+R  E
Sbjct  3    DSATTVLVTGAGGRTGELVYKKLKERGGQFVSRGFVRTEESKQKIGGGDDVFVGDVRQPE  62

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            ++ P  QG+DA++I+TSAVP+MKPGFDPSKG RPEFYFEDG  PEQVDWIGQKNQID AK
Sbjct  63   TLTPVFQGVDALVIVTSAVPKMKPGFDPSKGGRPEFYFEDGCYPEQVDWIGQKNQIDAAK  122

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            A G K IVLVGSMGGTNPNHPLN+LGNG ILIWKRK+E+YLADSG+PYTIIRAGGL DK 
Sbjct  123  AVGAKQIVLVGSMGGTNPNHPLNSLGNGKILIWKRKAEQYLADSGIPYTIIRAGGLVDKE  182

Query  545  GGERELLVGKDDELLQTEN  601
            GG R+LLVGKDDELL TE 
Sbjct  183  GGLRQLLVGKDDELLATET  201



>ref|XP_006653962.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
[Oryza brachyantha]
Length=296

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +++++ RGLVR+EESKA+IGGA D+++GDIR+  SI P
Sbjct  49   TVLVTGAGGRTGQIVYKKLKERAEQFVGRGLVRTEESKAKIGGAADVFVGDIRDPGSIAP  108

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI+GIDA+IILTSAVP+MKPGFDPSKG RPEFYFE+   PEQVDWIGQKNQID AK+ GV
Sbjct  109  AIEGIDALIILTSAVPKMKPGFDPSKGGRPEFYFEEASYPEQVDWIGQKNQIDAAKSIGV  168

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K +VLVGSMGGT+ NHPLN LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG R
Sbjct  169  KQVVLVGSMGGTDVNHPLNKLGNGNILVWKRKAEQYLADSGLPYTIIRAGGLQDKDGGVR  228

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDE+L+TE 
Sbjct  229  ELIVGKDDEILKTET  243



>ref|XP_010452056.1| PREDICTED: uncharacterized protein At5g02240 [Camelina sativa]
Length=253

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E+SDK++ RGLVR+ + K +IGG DD++IGDI  AES+ P
Sbjct  6    TVLVTGASGRTGQIVYKKLKESSDKFVARGLVRTADGKEKIGGGDDVFIGDITVAESVKP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVDWIGQKNQID AK AGV
Sbjct  66   AVQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVR  185

Query  557  ELLVGKDDELLQT  595
            ELLVGKDDELL+T
Sbjct  186  ELLVGKDDELLET  198



>ref|XP_006398688.1| hypothetical protein EUTSA_v10014474mg [Eutrema salsugineum]
 gb|ESQ40141.1| hypothetical protein EUTSA_v10014474mg [Eutrema salsugineum]
Length=253

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SDK++ +GLVR+ E K +IGG  D++IGDI +A+SI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKERSDKFVAKGLVRTPEGKEKIGGEADVFIGDITDADSIKP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDP+KG RPEF F++G  PEQVDW+GQKNQID AK AGV
Sbjct  66   AVQGIDALVILTSAVPKMKPGFDPTKGGRPEFMFDEGQYPEQVDWLGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>ref|XP_002870963.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47222.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SDK+I +GLVR+ E K +IGG  D++IGDI +A+SI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKEGSDKFIAKGLVRTAEGKEKIGGEADVFIGDITDADSINP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A QGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVD+IGQKNQID AK AGV
Sbjct  66   AFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDFIGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVR  185

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDELLQT+ 
Sbjct  186  ELIVGKDDELLQTDT  200



>ref|XP_010423884.1| PREDICTED: uncharacterized protein At5g02240-like [Camelina sativa]
Length=253

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E+SDK++ RGLVR+ + K +IGG DD++IGDI  AES+ P
Sbjct  6    TVLVTGASGRTGQIVYKKLKESSDKFVARGLVRTADGKEKIGGGDDVFIGDITVAESVKP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVDWIGQKNQID AK AGV
Sbjct  66   AVQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK G  R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGSVR  185

Query  557  ELLVGKDDELLQT  595
            ELLVGKDDELL+T
Sbjct  186  ELLVGKDDELLET  198



>ref|NP_001132564.1| uncharacterized protein LOC100194029 [Zea mays]
 gb|ACF81455.1| unknown [Zea mays]
 gb|ACG31416.1| NAD-dependent epimerase/dehydratase [Zea mays]
 gb|AFW82875.1| NAD-dependent epimerase/dehydratase isoform 1 [Zea mays]
 gb|AFW82876.1| NAD-dependent epimerase/dehydratase isoform 2 [Zea mays]
 gb|AFW82877.1| NAD-dependent epimerase/dehydratase isoform 3 [Zea mays]
Length=298

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            RTVLVTGAGGRTGQIVYKKL+E   +++ RGLVR+ ESK +IGG DD+++GDIR+ ESI 
Sbjct  50   RTVLVTGAGGRTGQIVYKKLKEREGQFVGRGLVRTGESKGKIGGGDDVFVGDIRDPESIA  109

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            PAI+GIDA+IILTSAVP+MKPGFDPSKG RPEFYFE+G  PEQVDWIGQKNQID AK+ G
Sbjct  110  PAIEGIDALIILTSAVPKMKPGFDPSKGGRPEFYFEEGSYPEQVDWIGQKNQIDAAKSIG  169

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
             KHIVLVGSMGGT+ NHPLN LGN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG 
Sbjct  170  AKHIVLVGSMGGTDINHPLNKLGNANILVWKRKAEQYLADSGLPYTIIRAGGLQDKDGGL  229

Query  554  RELLVGKDDELLQTEN  601
            REL+VGKDDE+L+TE 
Sbjct  230  RELIVGKDDEILKTET  245



>ref|XP_010047753.1| PREDICTED: uncharacterized protein At5g02240-like [Eucalyptus 
grandis]
 gb|KCW88948.1| hypothetical protein EUGRSUZ_A01273 [Eucalyptus grandis]
Length=342

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQ+VYKKL+E  D+++ RGLVRSEESK +IGGADDIY+GDIR+A SIVP
Sbjct  95   TVLVTGAGGRTGQVVYKKLKERPDQFVARGLVRSEESKEKIGGADDIYVGDIRDASSIVP  154

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQG D +IILTSA P++K GFDP+KG RPE+Y+++G  PEQVDW+GQKNQID AKAAGV
Sbjct  155  AIQGADFLIILTSAFPKIKAGFDPTKGGRPEYYYKEGAYPEQVDWLGQKNQIDAAKAAGV  214

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGTN NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG R
Sbjct  215  KQIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGVR  274

Query  557  ELLVGKDDELLQT  595
            EL+VGKDDELLQT
Sbjct  275  ELIVGKDDELLQT  287



>emb|CAB82997.1| putative protein [Arabidopsis thaliana]
Length=376

 Score =   298 bits (762),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SDK++ +GLVRS + K +IGG  D++IGDI +A+SI P
Sbjct  6    TVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A QGIDA++ILTSAVP+MKPGFDP+KG RPEF FEDG  PEQVDWIGQKNQID AK AGV
Sbjct  66   AFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGV  125

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIV+VGSMGGTNP+HPLN LGNGNIL+WKRK+E+YLADSG PYTIIRAGGL DK GG R
Sbjct  126  KHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVR  185

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQT+ 
Sbjct  186  ELLVGKDDELLQTDT  200



>dbj|BAJ86066.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVY+KL+E +D+++ RGLVR+ +SK++I G DD++IGDIR+  SI P
Sbjct  82   TVLVTGAGGRTGQIVYRKLKERADQFVARGLVRTPDSKSKIDGGDDMFIGDIRDTGSIAP  141

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI GIDA+IILTS VP+MKPGFDPSKG RPEFYFE+G  PEQVDWIGQKNQID AK+ GV
Sbjct  142  AIDGIDALIILTSGVPKMKPGFDPSKGGRPEFYFEEGSDPEQVDWIGQKNQIDAAKSIGV  201

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            K IVLVGSMGGT+ NHPLN LGNGNIL+WKRK+E+YLADSGVPYTIIRAGGLQDK+GG R
Sbjct  202  KQIVLVGSMGGTDINHPLNKLGNGNILVWKRKAEQYLADSGVPYTIIRAGGLQDKDGGVR  261

Query  557  ELLVGKDDELLQTEN  601
            EL+VGKDDE+L+TE 
Sbjct  262  ELIVGKDDEILKTET  276



>ref|XP_004167131.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like, 
partial [Cucumis sativus]
Length=236

 Score =   292 bits (748),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = +2

Query  53   QIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPAIQGIDAIIILT  232
            QIVYKKL+E SD Y  RGLVR+EESK  IGGADD+++GDIR+A+S+ PAIQGIDA+IILT
Sbjct  1    QIVYKKLKERSDHYAARGLVRTEESKQSIGGADDLFVGDIRDADSLGPAIQGIDALIILT  60

Query  233  SAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGT  412
            SAVP+MKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID AKAAGVK IVLVGSMGGT
Sbjct  61   SAVPKMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGVKQIVLVGSMGGT  120

Query  413  NPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
            N NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG RELLVGKDDELLQ
Sbjct  121  NINHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGGIRELLVGKDDELLQ  180

Query  593  TEN  601
            TE 
Sbjct  181  TET  183



>gb|KDO51169.1| hypothetical protein CISIN_1g0462972mg, partial [Citrus sinensis]
Length=236

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +2

Query  53   QIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPAIQGIDAIIILT  232
            QIVYKKL+E S++Y  RGLVR+EESK +IGGADD++IGDIR++ SI+PAIQGIDA+IILT
Sbjct  1    QIVYKKLKERSEQYAARGLVRTEESKQKIGGADDLFIGDIRDSNSIIPAIQGIDALIILT  60

Query  233  SAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGT  412
            SAVP+MKP FDP+KG RPEFYFE+G  PEQVDWIGQKNQID AKAAG K IVLVGSMGGT
Sbjct  61   SAVPKMKPDFDPAKGGRPEFYFEEGAYPEQVDWIGQKNQIDAAKAAGAKQIVLVGSMGGT  120

Query  413  NPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
            N NHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK GG RELLVGKDDELLQ
Sbjct  121  NLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGIRELLVGKDDELLQ  180

Query  593  TEN  601
            TE 
Sbjct  181  TET  183



>dbj|BAH57079.1| AT2G37660 [Arabidopsis thaliana]
Length=242

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +2

Query  47   TGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPAIQGIDAIII  226
            TGQIVYKKL+E S++++ RGLVR++ESK +I G D+++IGDIR+  SI PA++GIDA++I
Sbjct  5    TGQIVYKKLKERSEQFVARGLVRTKESKEKINGEDEVFIGDIRDTASIAPAVEGIDALVI  64

Query  227  LTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMG  406
            LTSAVP+MKPGFDPSKG RPEF+F+DG  PEQVDWIGQKNQID AKAAGVK IVLVGSMG
Sbjct  65   LTSAVPQMKPGFDPSKGGRPEFFFDDGAYPEQVDWIGQKNQIDAAKAAGVKQIVLVGSMG  124

Query  407  GTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDEL  586
            GTN NHPLN++GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG RELLVGKDDEL
Sbjct  125  GTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKDGGIRELLVGKDDEL  184

Query  587  LQTEN  601
            L+TE 
Sbjct  185  LETET  189



>ref|XP_003569100.1| PREDICTED: uncharacterized protein At5g02240-like [Brachypodium 
distachyon]
Length=291

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIV  193
            TVLVTGAGGRTGQIVYKKL+E + ++  RGLVR++ESK +IGG D+     DIR+  S  
Sbjct  43   TVLVTGAGGRTGQIVYKKLKERAGEFAARGLVRTQESKDKIGGGDNGVFIGDIRDPASFA  102

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
             A++GIDA++ILTSAVP+MKPGFDPSKG RPEFYFEDG  PEQVDWIGQKNQID AK+ G
Sbjct  103  AAVEGIDALVILTSAVPKMKPGFDPSKGGRPEFYFEDGSDPEQVDWIGQKNQIDAAKSIG  162

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            VK IVLVGSMGGT+ NHPLN LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGLQDK+GG 
Sbjct  163  VKQIVLVGSMGGTDLNHPLNKLGNGNILVWKRKAEQYLADSGLPYTIIRAGGLQDKDGGV  222

Query  554  RELLVGKDDELLQTEN  601
            REL++GKDDE+L+TE 
Sbjct  223  RELIIGKDDEILKTET  238



>ref|XP_010678098.1| PREDICTED: uncharacterized protein At5g02240-like [Beta vulgaris 
subsp. vulgaris]
Length=330

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGA GRTGQIVY KL+E S+++  RGLVR+EESK  IGGADD+++GDIR+ +S+
Sbjct  82   KPTVLVTGAAGRTGQIVYSKLKERSNQFSGRGLVRTEESKQTIGGADDVFVGDIRDPDSL  141

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
             PAIQGIDA+IILTSAVP+MKPG +P++ E+PEF F+DG  PEQVDWIGQK+QID AKAA
Sbjct  142  NPAIQGIDALIILTSAVPKMKPGSNPAR-EKPEFCFDDGAYPEQVDWIGQKHQIDAAKAA  200

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVK IVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSG+PYTIIRAGGL DK G 
Sbjct  201  GVKQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLLDKPGS  260

Query  551  ERELLVGKDDELLQTEN  601
             RELLVGKDDELLQ E 
Sbjct  261  LRELLVGKDDELLQLET  277



>ref|XP_001757861.1| predicted protein [Physcomitrella patens]
 gb|EDQ77501.1| predicted protein [Physcomitrella patens]
Length=255

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = +2

Query  5    DGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAE  184
            D  RTVLVTGAGGRTG IV+ KL++ ++K++ RGLVR+EE+KA++GG         + A+
Sbjct  6    DSTRTVLVTGAGGRTGAIVFDKLKK-TEKFVVRGLVRTEEAKAKLGGKGVFIGDVTK-AD  63

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            ++  A +GIDA+II TSAVP+MKPGFDPSKG  PEFYFE+   PEQVDWIGQKNQID AK
Sbjct  64   TLSAAFEGIDALIITTSAVPKMKPGFDPSKGAPPEFYFEENGYPEQVDWIGQKNQIDAAK  123

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            AAG KHIVLVGSMGG NPNH LN+LGNG ILIWKRK+EEYL+ SGVPYTIIRAGGLQDK+
Sbjct  124  AAGCKHIVLVGSMGGQNPNHMLNSLGNGKILIWKRKAEEYLSQSGVPYTIIRAGGLQDKD  183

Query  545  GGERELLVGKDDELLQTEN  601
            GG REL+V KDDEL+ T+ 
Sbjct  184  GGIRELIVSKDDELMNTDT  202



>ref|XP_001778983.1| predicted protein [Physcomitrella patens]
 gb|EDQ56238.1| predicted protein [Physcomitrella patens]
Length=255

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 162/196 (83%), Gaps = 2/196 (1%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            RTVLVTGAGGRTG +V+ KL++ + K++ RGLVR+EE KA++GG         +  E++ 
Sbjct  9    RTVLVTGAGGRTGSLVFDKLKK-TGKFVVRGLVRTEEVKAKLGGEGVFIGDITK-PETLS  66

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
             A++GIDA+II TSAVP+MKPGFDPSKG RPEFY+E+   PEQVDWIGQKNQID AK AG
Sbjct  67   AAVEGIDALIITTSAVPKMKPGFDPSKGGRPEFYYEENGFPEQVDWIGQKNQIDAAKDAG  126

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
             KHIV+VGSMGG NPNH LN+LGNG ILIWKRK+EEYL+ SGVPYTIIRAGGLQDK+GG 
Sbjct  127  CKHIVIVGSMGGQNPNHMLNSLGNGKILIWKRKAEEYLSKSGVPYTIIRAGGLQDKDGGI  186

Query  554  RELLVGKDDELLQTEN  601
            RELL+GKDDELL T+ 
Sbjct  187  RELLIGKDDELLNTDT  202



>ref|XP_002988949.1| hypothetical protein SELMODRAFT_184267 [Selaginella moellendorffii]
 gb|EFJ09978.1| hypothetical protein SELMODRAFT_184267 [Selaginella moellendorffii]
Length=291

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLV GAGGRTG++V+ KL++ + ++  RGLVRS ESK +I G DD++IGDI   ES+  
Sbjct  43   TVLVAGAGGRTGRLVFDKLKQRTQEFSARGLVRSVESKQKINGGDDVFIGDITKPESLSD  102

Query  197  AIQG-IDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            A  G IDA++ILTSAVP++KPGFDPSKG RPEFYFEDG  PEQVDW+GQK QIDTAK+AG
Sbjct  103  AFAGGIDALVILTSAVPKIKPGFDPSKGGRPEFYFEDGAFPEQVDWLGQKTQIDTAKSAG  162

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            VK IVLVGSMGGT+ NHPLN+LGNG ILIWKRK+EEYL++SG+PYTIIRAGGL DK GG 
Sbjct  163  VKQIVLVGSMGGTDENHPLNSLGNGKILIWKRKAEEYLSESGIPYTIIRAGGLLDKEGGV  222

Query  554  RELLVGKDDELLQTEN  601
            RELLVGK+DELL+T+ 
Sbjct  223  RELLVGKNDELLKTDT  238



>ref|XP_002974930.1| hypothetical protein SELMODRAFT_174568 [Selaginella moellendorffii]
 gb|EFJ23715.1| hypothetical protein SELMODRAFT_174568 [Selaginella moellendorffii]
Length=289

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLV GAGGRTG++V+ KL++ + ++  RGLVRS ESK +I G DD++IGDI   ES+  
Sbjct  41   TVLVAGAGGRTGRLVFDKLKQRTQEFSARGLVRSVESKQKINGGDDVFIGDITKPESLSD  100

Query  197  AIQG-IDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            A  G IDA++ILTSAVP++KPGFDPSKG RPEFYFEDG  PEQVDW+GQK QIDTAK+AG
Sbjct  101  AFAGGIDALVILTSAVPKIKPGFDPSKGGRPEFYFEDGAFPEQVDWLGQKTQIDTAKSAG  160

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            VK IVLVGSMGGT+ NHPLN+LGNG ILIWKRK+EEYL++SG+PYTIIRAGGL DK GG 
Sbjct  161  VKQIVLVGSMGGTDDNHPLNSLGNGKILIWKRKAEEYLSESGIPYTIIRAGGLLDKEGGV  220

Query  554  RELLVGKDDELLQTEN  601
            RELLVG++DELL+T+ 
Sbjct  221  RELLVGRNDELLKTDT  236



>gb|KJB36702.1| hypothetical protein B456_006G171900 [Gossypium raimondii]
Length=252

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SD+++ RG VR+ ESK  IGGADD+++GDIR+  S+VP
Sbjct  85   TVLVTGAAGRTGQIVYKKLKERSDQFVVRGFVRTPESKETIGGADDVFVGDIRDTTSLVP  144

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTSAVPRMKPGFDP+KG RPEFYFEDG  PEQVDWIGQKNQID A+ AGV
Sbjct  145  AMQGIDALIILTSAVPRMKPGFDPTKGGRPEFYFEDGAYPEQVDWIGQKNQIDVAEEAGV  204

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTII  517
            K IVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADSGVPYTII
Sbjct  205  KQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGVPYTII  251



>ref|XP_002968769.1| hypothetical protein SELMODRAFT_170290 [Selaginella moellendorffii]
 gb|EFJ29885.1| hypothetical protein SELMODRAFT_170290 [Selaginella moellendorffii]
Length=252

 Score =   263 bits (673),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig--diRNAESI  190
             VLVTGAGGRTGQ+ Y+KLR  + ++  RGLVRSE SK +I       +   DI   E++
Sbjct  3    VVLVTGAGGRTGQLAYEKLRARAGQFRARGLVRSEASKQKIDQDGSGDVRIGDITKPETL  62

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
             PA  G+D+++ILTSAVP+MKPGF+P+ G RPEFYFE+G +PE+VDWIGQKNQID AK A
Sbjct  63   PPAFDGVDSLVILTSAVPKMKPGFNPASGGRPEFYFEEGGTPEEVDWIGQKNQIDAAKDA  122

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKH+VLVGSMGGTN NHPLN LGNG ILIWKRK+E+YL++SG+PYTIIR GGL DK GG
Sbjct  123  GVKHVVLVGSMGGTNENHPLNLLGNGKILIWKRKAEKYLSESGLPYTIIRPGGLIDKEGG  182

Query  551  ERELLVGKDDELLQT  595
            +REL+VGKDDELL T
Sbjct  183  KRELIVGKDDELLNT  197



>ref|XP_007140520.1| hypothetical protein PHAVU_008G1196001g, partial [Phaseolus vulgaris]
 gb|ESW12514.1| hypothetical protein PHAVU_008G1196001g, partial [Phaseolus vulgaris]
Length=248

 Score =   263 bits (672),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES  187
             K TVLVTGAGGRTGQIVYKKL+E  ++Y+ RGLVR+EESK  IG  DD++IGDIR+AES
Sbjct  79   AKSTVLVTGAGGRTGQIVYKKLKERPNQYVARGLVRTEESKQNIGAEDDVFIGDIRDAES  138

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I+PAIQGID +IILTSAVP +KPGFDP+KG+RPEFYF+DG  PEQVDWIGQKNQID AKA
Sbjct  139  IIPAIQGIDVLIILTSAVPLIKPGFDPTKGQRPEFYFDDGAYPEQVDWIGQKNQIDAAKA  198

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTII  517
            AGVK IVLVGSMGGT+ N+PLN+LGNGNIL+WKRK+E+YLADSGVPYTII
Sbjct  199  AGVKQIVLVGSMGGTDLNNPLNSLGNGNILVWKRKAEQYLADSGVPYTII  248



>gb|EMT06006.1| hypothetical protein F775_17756 [Aegilops tauschii]
Length=344

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 165/209 (79%), Gaps = 20/209 (10%)
 Frame = +2

Query  35   AGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPAIQGID  214
              G  GQIVYKKL+E +D+++ RGLVR+ +SK +IGG DD++IGDIR+  SI PAI GID
Sbjct  83   CCGDPGQIVYKKLKERADQFVARGLVRTPDSKGKIGGGDDVFIGDIRDPGSIAPAIDGID  142

Query  215  AIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLV  394
            A+IILTS VP+MKPGFDPSKG RPEFYFE+G  PEQVDWIGQKNQID AK+ GVK IVLV
Sbjct  143  ALIILTSGVPKMKPGFDPSKGGRPEFYFEEGSDPEQVDWIGQKNQIDAAKSIGVKQIVLV  202

Query  395  GSMGGTNPNHPLNTLGNGNILI--------------------WKRKSEEYLADSGVPYTI  514
            GSMGGT+ NHPLN LGNGNILI                    WKRK+E+YLADSGVPYTI
Sbjct  203  GSMGGTDINHPLNKLGNGNILIAYVPFLNLGRSIASPTNLQVWKRKAEQYLADSGVPYTI  262

Query  515  IRAGGLQDKNGGERELLVGKDDELLQTEN  601
            IRAGGLQDK+GG REL+VGKDDE+L+TE 
Sbjct  263  IRAGGLQDKDGGVRELIVGKDDEILKTET  291



>ref|XP_002992894.1| hypothetical protein SELMODRAFT_272296 [Selaginella moellendorffii]
 gb|EFJ06085.1| hypothetical protein SELMODRAFT_272296 [Selaginella moellendorffii]
Length=252

 Score =   261 bits (666),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 157/195 (81%), Gaps = 2/195 (1%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig--diRNAESI  190
             VLVTGAGGRTGQ+ Y+KLR  + ++  RGLVRSE SK +I       +   DI   E++
Sbjct  3    VVLVTGAGGRTGQLAYEKLRARAGEFRARGLVRSEASKQKIDQDGSGDVRIGDITKPETL  62

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
             PA  G+ +++ILTSAVP+MKPGF+P+ G RPEFYFE+G +PE+VDWIGQKNQID AK A
Sbjct  63   PPAFDGVHSLVILTSAVPKMKPGFNPASGGRPEFYFEEGGTPEEVDWIGQKNQIDAAKDA  122

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKH+VLVGSMGGTN NHPLN LGNG ILIWKRK+E+YL++SG+PYTIIR GGL DK GG
Sbjct  123  GVKHVVLVGSMGGTNENHPLNLLGNGKILIWKRKAEKYLSESGLPYTIIRPGGLIDKEGG  182

Query  551  ERELLVGKDDELLQT  595
            +REL+VGKDDELL T
Sbjct  183  KRELIVGKDDELLNT  197



>ref|XP_001770526.1| predicted protein [Physcomitrella patens]
 gb|EDQ64695.1| predicted protein [Physcomitrella patens]
Length=255

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGAGGRTG++ ++KL+E   +++ RGLVR+EE K  +GG        ++  ESI
Sbjct  7    KMTVLVTGAGGRTGRLAFQKLKEKDGQFVARGLVRTEEGKEALGGDGVFVGDVVK-PESI  65

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A +GIDA+IILTSAVP+ KPGFDP++G RPEFY+ +G SPE+VDWIGQK QID A AA
Sbjct  66   GAAFEGIDALIILTSAVPKPKPGFDPTQGGRPEFYYVEGGSPEEVDWIGQKAQIDAAIAA  125

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G K IVLVGSMGGT+  +PLN+LGNGNIL+WKRK+E+YL++ GVPYTIIRAGGLQDK GG
Sbjct  126  GAKQIVLVGSMGGTDEANPLNSLGNGNILVWKRKAEKYLSECGVPYTIIRAGGLQDKEGG  185

Query  551  ERELLVGKDDELLQTEN  601
             RELL+GKDDELLQT+ 
Sbjct  186  VRELLIGKDDELLQTQT  202



>emb|CDP06601.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 158/197 (80%), Gaps = 28/197 (14%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVLVTGAGGRTGQIVYKKL+E SD+YI RGLVR++ESK +IGGADD+Y+GDIRN ++I
Sbjct  6    KSTVLVTGAGGRTGQIVYKKLKERSDQYIARGLVRTQESKEKIGGADDVYVGDIRNFDAI  65

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            VP IQGIDA+IILTSAV                            DWIGQKNQID AKAA
Sbjct  66   VPPIQGIDALIILTSAV----------------------------DWIGQKNQIDAAKAA  97

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGGTNPNHPLN+LGNGNILIWKRK+E+YLADSG+PYTIIRAGGLQDK GG
Sbjct  98   GVKHIVLVGSMGGTNPNHPLNSLGNGNILIWKRKAEQYLADSGIPYTIIRAGGLQDKEGG  157

Query  551  ERELLVGKDDELLQTEN  601
             RELL+GKDDELLQ E 
Sbjct  158  VRELLIGKDDELLQLET  174



>sp|D5JWB3.1|SARED_ESCCA RecName: Full=Sanguinarine reductase [Eschscholzia californica]
 gb|ADE41047.1| sanguinarine reductase [Eschscholzia californica]
Length=273

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 164/214 (77%), Gaps = 17/214 (8%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESI  190
            K TVL++GA G TG + +KKL+E SDK+  RGLVRSE SK ++GG D+I+IGDI + +++
Sbjct  7    KLTVLLSGASGLTGSLAFKKLKERSDKFEVRGLVRSEASKQKLGGGDEIFIGDISDPKTL  66

Query  191  VPAIQGIDAIIILTSAVPRMKPG----------------FDPS-KGERPEFYFEDGLSPE  319
             PA++GIDA+IILTSA+PRMKP                  D S  G  PEFY+++G  PE
Sbjct  67   EPAMEGIDALIILTSAIPRMKPTEEFTAEMISGGRSEDVIDASFSGPMPEFYYDEGQYPE  126

Query  320  QVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSG  499
            QVDWIGQKNQIDTAK  GVKHIVLVGSMGG +P+H LN +GNGNILIWKRK+E+YLADSG
Sbjct  127  QVDWIGQKNQIDTAKKMGVKHIVLVGSMGGCDPDHFLNHMGNGNILIWKRKAEQYLADSG  186

Query  500  VPYTIIRAGGLQDKNGGERELLVGKDDELLQTEN  601
            VPYTIIRAGGL +K GG RELLV KDD LL TEN
Sbjct  187  VPYTIIRAGGLDNKAGGVRELLVAKDDVLLPTEN  220



>ref|XP_007026994.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07496.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=234

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQI+YKKL+E SD+++TRGLVR+ ESK +IGGADD+++GDIR+  ++VP
Sbjct  86   TVLVTGAGGRTGQILYKKLKERSDQFVTRGLVRTPESKEKIGGADDVFVGDIRDPSTLVP  145

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQG+DA+IILTSAVPRMKPGFDP+KG RPEFYF+DG  PEQVDWIGQKNQID AK AGV
Sbjct  146  AIQGVDALIILTSAVPRMKPGFDPTKGGRPEFYFDDGAYPEQVDWIGQKNQIDVAKEAGV  205

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILI  460
            K IVLVGSMGGTN NHPLN+LGNGNIL+
Sbjct  206  KRIVLVGSMGGTNLNHPLNSLGNGNILV  233



>ref|WP_012595226.1| MULTISPECIES: oxidoreductase [Cyanothece]
 gb|ACK65954.1| nucleoside-diphosphate-sugar epimerase, putative [Cyanothece 
sp. PCC 8801]
 gb|ACV00833.1| binding/catalytic/coenzyme-binding protein [Cyanothece sp. PCC 
8802]
Length=257

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 146/195 (75%), Gaps = 3/195 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSE-ESKARiggaddiyigdiRNAESI  190
            R V+VTGA GRTG +V++KLR+  DK+   G+ RSE + +   G     ++G I +  ++
Sbjct  4    RKVVVTGATGRTGSLVFRKLRQCPDKFEVVGVARSEAKFQELFGSTQGCFVGSISDRLTL  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
             PA +G  A++ILTSAVP+MK    P  GERPEF FE G  PE+VDWIGQKNQID AK  
Sbjct  64   KPAFEGCQALVILTSAVPKMKS--PPQPGERPEFVFEPGGIPEEVDWIGQKNQIDLAKEV  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G+  IVLVGSMGGTNPNH LN++GNGNILIWKRK+EEYL +SG+ YTIIRAGGL D+ GG
Sbjct  122  GINQIVLVGSMGGTNPNHILNSIGNGNILIWKRKAEEYLINSGIDYTIIRAGGLLDQPGG  181

Query  551  ERELLVGKDDELLQT  595
            +REL+VGKDD LL T
Sbjct  182  KRELVVGKDDTLLTT  196



>gb|EPS64191.1| hypothetical protein M569_10591, partial [Genlisea aurea]
Length=161

 Score =   219 bits (558),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA  181
            A  K TVLVTGA GRTGQIVYKKL+E  D+Y  RGLVRS+ESK +IGG  D+YIGDIR+ 
Sbjct  9    ASSKSTVLVTGAAGRTGQIVYKKLKERPDEYTARGLVRSKESKEKIGGDHDVYIGDIRDF  68

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTA  361
            +SIVP+ +GIDA+IILTSAVP+MKP FDPSKG RPEFYFEDG  PEQVDWIGQKNQID A
Sbjct  69   DSIVPSFEGIDALIILTSAVPKMKPDFDPSKGGRPEFYFEDGEFPEQVDWIGQKNQIDAA  128

Query  362  KAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILI  460
            KA GVKH+VLVGSMGGT+ NHPLN LGN NIL+
Sbjct  129  KAVGVKHVVLVGSMGGTDLNHPLNRLGNANILV  161



>ref|WP_009547288.1| MULTISPECIES: oxidoreductase [Cyanothece]
 gb|ACB53223.1| unknown [Cyanothece sp. ATCC 51142]
Length=257

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 148/194 (76%), Gaps = 3/194 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            + VLVTGA GRTG +V KKL + SD++   G  R+EE    + G+DD +     N +S +
Sbjct  4    KKVLVTGATGRTGSLVVKKLHQLSDQFEVFGFARNEEKTKELFGSDDGFSIGNINDKSTL  63

Query  194  -PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A++G D+++ILTSAVP+MK    P +GERP F FE G +PE+VDWIGQKNQID A+  
Sbjct  64   KSALEGCDSLVILTSAVPKMKA--PPKEGERPVFEFEPGGTPEEVDWIGQKNQIDMAQEL  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G+ HIVLVGSMGGTNPNHPLN +GNGNILIWKRK+E+YL +SG+ YTIIRAGGL ++ GG
Sbjct  122  GINHIVLVGSMGGTNPNHPLNKIGNGNILIWKRKAEQYLINSGINYTIIRAGGLLNEPGG  181

Query  551  ERELLVGKDDELLQ  592
            +RELLVGK+D LL+
Sbjct  182  KRELLVGKNDTLLE  195



>ref|WP_037217028.1| oxidoreductase [Richelia intracellularis]
Length=256

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 146/193 (76%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG +V +KLR+NSD++   G  +S  + +   G  +  ++GDI++  +I
Sbjct  3    KKVLVTGATGRTGSLVLQKLRQNSDRFQAMGFAKSPTKVQEMFGSTEGFFMGDIKDKCTI  62

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A+Q   A++ILTSA+P+MK    PS GERPEF FE G +PE++D+ GQ NQID AK A
Sbjct  63   ETALQDCSALVILTSAIPKMKA--PPSPGERPEFEFEPGGTPEEIDYYGQTNQIDAAKKA  120

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G++HI+LVGSMGGTNPNHPLN LGNGNILIWKRK+E+YL DSG+ YTIIRA GL D  GG
Sbjct  121  GIEHIILVGSMGGTNPNHPLNKLGNGNILIWKRKAEQYLIDSGIDYTIIRAAGLLDTEGG  180

Query  551  ERELLVGKDDELL  589
             REL+VGKDD LL
Sbjct  181  IRELIVGKDDTLL  193



>emb|CDN10891.1| FIG00557133: hypothetical protein [Richelia intracellularis]
Length=267

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 146/193 (76%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG +V +KLR+NSD++   G  +S  + +   G  +  ++GDI++  +I
Sbjct  14   KKVLVTGATGRTGSLVLQKLRQNSDRFQAMGFAKSPTKVQEMFGSTEGFFMGDIKDKCTI  73

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A+Q   A++ILTSA+P+MK    PS GERPEF FE G +PE++D+ GQ NQID AK A
Sbjct  74   ETALQDCSALVILTSAIPKMKA--PPSPGERPEFEFEPGGTPEEIDYYGQTNQIDAAKKA  131

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G++HI+LVGSMGGTNPNHPLN LGNGNILIWKRK+E+YL DSG+ YTIIRA GL D  GG
Sbjct  132  GIEHIILVGSMGGTNPNHPLNKLGNGNILIWKRKAEQYLIDSGIDYTIIRAAGLLDTEGG  191

Query  551  ERELLVGKDDELL  589
             REL+VGKDD LL
Sbjct  192  IRELIVGKDDTLL  204



>ref|WP_007311164.1| oxidoreductase [Crocosphaera watsonii]
 gb|EHJ12248.1| Nucleoside-diphosphate-sugar epimerase-like protein [Crocosphaera 
watsonii WH 0003]
 emb|CCQ59769.1| hypothetical protein CWATWH0401_643 [Crocosphaera watsonii WH 
0401]
 emb|CCQ50244.1| similar to Nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 8502]
 emb|CCQ53915.1| similar to Nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 0005]
 emb|CCQ69659.1| hypothetical protein CWATWH0402_614 [Crocosphaera watsonii WH 
0402]
Length=257

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 146/195 (75%), Gaps = 3/195 (2%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVR-SEESKARiggaddiyigdiRNAES  187
            K+ VLVTGA GRTG  V KKLR+ SDK+   G  R +E+ K   G  +  ++GDI N  S
Sbjct  3    KKRVLVTGATGRTGLFVVKKLRQTSDKFEVFGFARDNEKVKELFGSTEGFFVGDITNKSS  62

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            + PA++G D+++I+TS+ P+MK    P +G+RPEF FE G  PE+VDWIGQKNQID AK 
Sbjct  63   LEPALKGCDSLVIVTSSFPKMKA--PPQEGQRPEFEFEPGGMPEEVDWIGQKNQIDLAKE  120

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
             G+  IVLVGSMGGTN  HPLN +GNGN+LIWKRK+EEYL DSG+ YTIIRAGGL ++ G
Sbjct  121  LGINKIVLVGSMGGTNREHPLNKMGNGNVLIWKRKAEEYLIDSGIDYTIIRAGGLINEPG  180

Query  548  GERELLVGKDDELLQ  592
            G+REL+VGK+D  L+
Sbjct  181  GKRELIVGKNDTFLE  195



>emb|CDX91377.1| BnaC04g07730D [Brassica napus]
Length=280

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  233  SAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGT  412
            + VP+MKPGFDPSKG RPEFYF++G  PEQVDWIGQKNQID AKAAGVK IVLVGSMGGT
Sbjct  105  AVVPQMKPGFDPSKGGRPEFYFDEGAYPEQVDWIGQKNQIDAAKAAGVKQIVLVGSMGGT  164

Query  413  NPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
            N NHPLN +GN NIL+WKRK+E+YLADSG+PYTIIRAGGLQDK G  RELLVGKDDELL+
Sbjct  165  NINHPLNNIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGDIRELLVGKDDELLE  224

Query  593  TEN  601
            TE 
Sbjct  225  TET  227



>ref|WP_035988067.1| oxidoreductase [Leptolyngbya sp. KIOST-1]
Length=258

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 145/191 (76%), Gaps = 3/191 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVP  196
            VLVTGA GRTG +V +KL++  +++  RG  RS +++    G A +IY+GDI   E + P
Sbjct  7    VLVTGATGRTGALVVQKLQQRPEQFTVRGFARSGQKANDLFGDAVEIYLGDITQPEKLAP  66

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+ G DA++ILTSA+P+M     P  G+RPEF + +G +PEQVD+ GQ NQID AKAAGV
Sbjct  67   ALAGCDALVILTSAIPQMV--APPEPGQRPEFVYPEGGTPEQVDYQGQLNQIDAAKAAGV  124

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            KHIVLVGSMGGTN  HPLN + NGNILIWKRK+E YL DSG+ YTIIRAGGLQD+ GG+R
Sbjct  125  KHIVLVGSMGGTNEQHPLNRMANGNILIWKRKAEAYLIDSGLDYTIIRAGGLQDQPGGQR  184

Query  557  ELLVGKDDELL  589
            ELLV KDD +L
Sbjct  185  ELLVSKDDTML  195



>ref|WP_015194351.1| hypothetical protein [Stanieria cyanosphaera]
 gb|AFZ36689.1| hypothetical protein Sta7437_3181 [Stanieria cyanosphaera PCC 
7437]
Length=256

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 148/196 (76%), Gaps = 9/196 (5%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKY----ITRGLVRSEESKARiggaddiyigdiRNA  181
            + +LVTGA GRTG +V KKLR+ S+++     TR L++ EE     G  ++ ++GDI++ 
Sbjct  3    KRILVTGATGRTGSLVLKKLRQQSEQFQAFGFTRSLLKVEE---LFGSTENFFLGDIKDQ  59

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTA  361
             S+  A++G  A++ILTSAVP+MK    P  GERP+F +E    PE VD+ GQKNQID A
Sbjct  60   SSLETALEGCSALVILTSAVPQMKA--PPQPGERPQFGYESDAMPEIVDYYGQKNQIDAA  117

Query  362  KAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDK  541
            + AGV+HIVLVGSMGGTNPNHPLN +GNGNILIWKRK+E+YL DSG+ YTIIRAGGL D+
Sbjct  118  RKAGVEHIVLVGSMGGTNPNHPLNQMGNGNILIWKRKAEQYLIDSGIDYTIIRAGGLLDQ  177

Query  542  NGGERELLVGKDDELL  589
             GG RELLVGK+D LL
Sbjct  178  EGGVRELLVGKNDTLL  193



>ref|WP_008275107.1| oxidoreductase [Cyanothece sp. CCY0110]
 gb|EAZ91787.1| hypothetical protein CY0110_07499 [Cyanothece sp. CCY0110]
Length=257

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 148/194 (76%), Gaps = 3/194 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG +V KKL + S+++   G  R+EE  K   G  D   +G+I +  ++
Sbjct  4    KKVLVTGATGRTGSLVVKKLHQLSEQFEVFGFARNEEKIKELFGSDDGFVMGNINDKATL  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A++  D+++ILTSAVP+MK    P +GERPEF FE G +PE+VD+IGQKNQID AK  
Sbjct  64   KSALKECDSLVILTSAVPKMKA--PPKEGERPEFDFEPGGTPEEVDYIGQKNQIDIAKEL  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G+ HIVLVGSMGGTNPNHPLN +GNGNILIWKRK+E+YL +SG+ YTIIRAGGL ++ GG
Sbjct  122  GINHIVLVGSMGGTNPNHPLNKIGNGNILIWKRKAEDYLINSGINYTIIRAGGLLNEPGG  181

Query  551  ERELLVGKDDELLQ  592
            +RELLVGK+D LL+
Sbjct  182  KRELLVGKNDTLLE  195



>ref|WP_007305960.1| oxidoreductase [Crocosphaera watsonii]
 gb|EAM50341.1| similar to Nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 8501]
Length=257

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 145/195 (74%), Gaps = 3/195 (2%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVR-SEESKARiggaddiyigdiRNAES  187
            K+ VLVTGA GRTG  V KKLR+ SDK+   G  R +E+ K   G  +  ++GDI N  S
Sbjct  3    KKRVLVTGATGRTGLFVVKKLRQTSDKFEVFGFARDNEKVKELFGSTEGFFVGDITNKSS  62

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            + PA++G D+++I+TS+ P+MK      +G+RPEF FE G  PE+VDWIGQKNQID AK 
Sbjct  63   LEPALKGCDSLVIVTSSFPKMKA--PAQEGQRPEFEFEPGGMPEEVDWIGQKNQIDLAKE  120

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
             G+  IVLVGSMGGTN  HPLN +GNGN+LIWKRK+EEYL DSG+ YTIIRAGGL ++ G
Sbjct  121  LGINKIVLVGSMGGTNREHPLNKMGNGNVLIWKRKAEEYLIDSGIDYTIIRAGGLINEPG  180

Query  548  GERELLVGKDDELLQ  592
            G+REL+VGK+D  L+
Sbjct  181  GKRELIVGKNDTFLE  195



>ref|WP_019504148.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=256

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 144/193 (75%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG +V KKLR+ SD +   G  RS+   +   G  +  +IGDI++  S+
Sbjct  3    KQVLVTGATGRTGSLVLKKLRQQSDYFQAIGFARSQSKVEELFGSTEGFFIGDIKDKFSL  62

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A++G  A++ILTSAVP+MK    PS GERP+F +E   +PE VD+ GQKNQID AK A
Sbjct  63   ESALKGCSALVILTSAVPKMKT--PPSPGERPQFEYEPDATPETVDYNGQKNQIDAAKRA  120

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GV+H+VLVGSMGGTNPNHPLN +GNG ILIWKRK+E+YL DSG+ YTI+RAGGL D  GG
Sbjct  121  GVEHVVLVGSMGGTNPNHPLNQMGNGKILIWKRKAEQYLIDSGIDYTIVRAGGLLDLEGG  180

Query  551  ERELLVGKDDELL  589
             R+LLVGK+D LL
Sbjct  181  VRQLLVGKNDTLL  193



>ref|WP_015955597.1| oxidoreductase [Cyanothece sp. PCC 7424]
 gb|ACK72004.1| nucleoside-diphosphate-sugar epimerase, putative [Cyanothece 
sp. PCC 7424]
Length=257

 Score =   212 bits (540),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 141/192 (73%), Gaps = 3/192 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSE-ESKARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG IV +K+R+   ++   G  RSE + K   G  D   +G+I +  S+
Sbjct  4    QKVLVTGATGRTGSIVVEKIRQYPQEFEVIGFARSETKVKDLFGSTDGFILGEITDKSSL  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
               +QG  A++ILTSA+P+MK    P+ GE+PEF FE G +PE++DWIGQKNQID AK A
Sbjct  64   EQGMQGCQALVILTSAIPKMKAA--PAPGEQPEFEFEPGQTPEEIDWIGQKNQIDAAKEA  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G+ HIVLVGSMGG NPNHPLN +GNGNILIWKRK+E YL DSG+ YTII  GGL D+ GG
Sbjct  122  GINHIVLVGSMGGENPNHPLNRMGNGNILIWKRKAEYYLIDSGIDYTIIHPGGLLDQPGG  181

Query  551  ERELLVGKDDEL  586
            +RELLVGK+D L
Sbjct  182  KRELLVGKNDSL  193



>gb|ELR99517.1| putative nucleoside-diphosphate sugar epimerase [Gloeocapsa sp. 
PCC 73106]
Length=255

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESI  190
            R +LV+GA GRTG IV +KLRE   ++I  GL RS E+++ +     + + GD+   +S+
Sbjct  2    RKILVSGATGRTGAIVLQKLRELKTEFIPLGLARSAEKAQEQFATTAEFFFGDVTQPDSV  61

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A+ G   ++ILTSA P++K    P  GERPEF F    +PE VDW+GQKNQID AKAA
Sbjct  62   KLALLGCQGLVILTSATPKIKG--QPIPGERPEFEFSANGTPEIVDWLGQKNQIDAAKAA  119

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G++HIVLVGSMGGTN NHPLN LGNGNILIWKRK+EEYL +SG+ YTII  GGL D  GG
Sbjct  120  GIEHIVLVGSMGGTNENHPLNRLGNGNILIWKRKAEEYLINSGIDYTIIHPGGLLDAPGG  179

Query  551  ERELLVGKDDELL  589
             RELLVGK+D+LL
Sbjct  180  VRELLVGKNDQLL  192



>ref|WP_034935338.1| oxidoreductase [Gloeocapsa sp. PCC 73106]
Length=257

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESI  190
            R +LV+GA GRTG IV +KLRE   ++I  GL RS E+++ +     + + GD+   +S+
Sbjct  4    RKILVSGATGRTGAIVLQKLRELKTEFIPLGLARSAEKAQEQFATTAEFFFGDVTQPDSV  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A+ G   ++ILTSA P++K    P  GERPEF F    +PE VDW+GQKNQID AKAA
Sbjct  64   KLALLGCQGLVILTSATPKIKG--QPIPGERPEFEFSANGTPEIVDWLGQKNQIDAAKAA  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G++HIVLVGSMGGTN NHPLN LGNGNILIWKRK+EEYL +SG+ YTII  GGL D  GG
Sbjct  122  GIEHIVLVGSMGGTNENHPLNRLGNGNILIWKRKAEEYLINSGIDYTIIHPGGLLDAPGG  181

Query  551  ERELLVGKDDELL  589
             RELLVGK+D+LL
Sbjct  182  VRELLVGKNDQLL  194



>ref|WP_017301000.1| hypothetical protein [Nodosilinea nodulosa]
Length=258

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 147/191 (77%), Gaps = 3/191 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSE-ESKARiggaddiyigdiRNAESIVP  196
            VLVTGA GRTG IV +KL++  +++  +G  RSE + K   G AD  Y+GDI + + +  
Sbjct  7    VLVTGATGRTGAIVIQKLQQQPEQFNPKGFARSEAKVKELFGTADGFYLGDISDPDRLKA  66

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++G DA++ILTSA+P+MK    P  G+RPEF + +G +PEQVD+ GQ NQI+ AKAAGV
Sbjct  67   ALEGCDALVILTSAIPQMK--APPEPGQRPEFIYPEGGTPEQVDYQGQINQIEAAKAAGV  124

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +HIVLVGSMGGTN  HPLN + NGNILIWKR++E YL  SG+ YTIIRAGGLQD+ GG+R
Sbjct  125  QHIVLVGSMGGTNEQHPLNRMANGNILIWKRRAEAYLIASGLDYTIIRAGGLQDQPGGQR  184

Query  557  ELLVGKDDELL  589
            EL+VGKDDELL
Sbjct  185  ELIVGKDDELL  195



>ref|WP_013324891.1| oxidoreductase [Cyanothece sp. PCC 7822]
 gb|ADN16853.1| binding/catalytic/coenzyme-binding protein [Cyanothece sp. PCC 
7822]
Length=257

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 142/193 (74%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSE-ESKARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG IV ++LR+   ++   G  RSE + K   G  +    G+I++  S+
Sbjct  4    KKVLVTGATGRTGSIVIQELRQYPQEFEVIGFARSEAKVKDLFGSTEGFVFGEIKDKSSL  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              AI+   A++IL+SA+P+MK    P+ GERPEF +E G +PE++DWIGQKNQID A  A
Sbjct  64   DQAIKDCQALVILSSAIPKMKA--PPAPGERPEFDYEAGQTPEEIDWIGQKNQIDAALEA  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIVLVGSMGG N NHPLN +GNGNILIWKRK+E+YL DSG+ YTII  GGL D+ GG
Sbjct  122  GVKHIVLVGSMGGENKNHPLNRIGNGNILIWKRKAEQYLIDSGIDYTIIHPGGLLDQTGG  181

Query  551  ERELLVGKDDELL  589
            +REL+VGK DELL
Sbjct  182  KRELIVGKKDELL  194



>ref|XP_008784610.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=261

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 139/195 (71%), Gaps = 45/195 (23%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVY KL+E +D+++ RGLVR+E+SK +IGG DD+ +GDIR+AESIVP
Sbjct  59   TVLVTGAGGRTGQIVYNKLKERTDQFLARGLVRTEDSKNKIGGHDDVLVGDIRDAESIVP  118

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTS+VP+MKPGFDPSKGERPEFYFEDG  PEQV                 
Sbjct  119  AVQGIDALIILTSSVPKMKPGFDPSKGERPEFYFEDGSYPEQV-----------------  161

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
                                        WKRK+E+YL +SG+PYTIIRAGGLQDK+GG R
Sbjct  162  ----------------------------WKRKAEQYLTESGIPYTIIRAGGLQDKDGGLR  193

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELL+TE 
Sbjct  194  ELLVGKDDELLKTET  208



>ref|WP_040939321.1| oxidoreductase [Prochloron didemni]
Length=255

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 142/195 (73%), Gaps = 5/195 (3%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigd--iRNAE  184
            ++ VL+TGA GRTG +V +KLR+++ ++ + G  RSE SKA+             I++  
Sbjct  3    RKKVLLTGATGRTGSLVLEKLRQHTAEFESIGFARSE-SKAKEIFGSTEGFMFGDIKDKS  61

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            +I  AI G +A+IILTSA+P+MK    P+ G+RPEF++  G  PE+VD+ GQKNQID AK
Sbjct  62   TIDNAIVGCEALIILTSAIPQMKA--PPAPGQRPEFHYPPGGMPEEVDYYGQKNQIDAAK  119

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
             AGVK +VLVGSMGGTNP+HPLN +GNGNILIWKRK+EEYL DSG+ YTII AGGL D+ 
Sbjct  120  KAGVKQVVLVGSMGGTNPHHPLNKMGNGNILIWKRKAEEYLIDSGIDYTIIHAGGLVDEP  179

Query  545  GGERELLVGKDDELL  589
             GERE +V K D LL
Sbjct  180  SGEREFVVDKGDRLL  194



>ref|WP_040944459.1| oxidoreductase [Prochloron didemni]
Length=255

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 142/195 (73%), Gaps = 5/195 (3%)
 Frame = +2

Query  11   KRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigd--iRNAE  184
            ++ VL+TGA GRTG +V +KLR+++ ++ + G  RSE SKA+             I++  
Sbjct  3    RKKVLLTGATGRTGSLVLEKLRQHTAEFESIGFARSE-SKAKEIFGSTEGFMFGDIKDKS  61

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            +I  AI G +A+IILTSA+P+MK    P+ G+RPEF++  G  PE+VD+ GQKNQID AK
Sbjct  62   TIDNAIVGCEALIILTSAIPQMKA--PPAPGQRPEFHYPPGGMPEEVDYYGQKNQIDAAK  119

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
             AGVK +VLVGSMGGTNP+HPLN +GNGNILIWKRK+EEYL DSG+ YTII AGGL D+ 
Sbjct  120  KAGVKQVVLVGSMGGTNPHHPLNKMGNGNILIWKRKAEEYLIDSGIDYTIIHAGGLVDEP  179

Query  545  GGERELLVGKDDELL  589
             GERE +V K D LL
Sbjct  180  SGEREFVVDKGDCLL  194



>ref|WP_017294761.1| hypothetical protein [Geminocystis herdmanii]
Length=251

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 142/195 (73%), Gaps = 3/195 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSE-ESKARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG +V KKL+ N   +      RS  +++   G  D+   GDI + E +
Sbjct  3    KKVLVTGATGRTGSLVVKKLQSNDYGWQVVPFARSSRKAQEIFGNTDNFIFGDILSLEDV  62

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A++G + +IILTSAVP+M     PS+G+ PEF FE    PEQVDW+GQKNQID+AK A
Sbjct  63   SIALEGCEKLIILTSAVPKMIT--PPSEGKPPEFDFETNGKPEQVDWLGQKNQIDSAKKA  120

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G+KHI+LVGSMGGTN NHPLN LGNGNILIWKRK+E+YL DS + YTIIRAGGL DK  G
Sbjct  121  GIKHIILVGSMGGTNENHPLNRLGNGNILIWKRKAEQYLMDSAINYTIIRAGGLLDKPDG  180

Query  551  ERELLVGKDDELLQT  595
            +RELLVGKDDE L +
Sbjct  181  KRELLVGKDDEFLAS  195



>ref|WP_036484465.1| oxidoreductase [Myxosarcina sp. GI1]
Length=254

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 144/193 (75%), Gaps = 4/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG +V KKLR+  +++   GL RS ++ K   G  +D   GDI++  S+
Sbjct  2    KRVLVTGATGRTGSLVVKKLRQR-EEFQAIGLARSPDKVKEMFGSTEDFVWGDIKDYSSL  60

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A++   A++ILTSAVP  +P   P  G+RPEF F  G +PE++DWIGQKNQID AK A
Sbjct  61   EAAVRDCQALVILTSAVP--QPKGTPQPGKRPEFEFASGETPEEIDWIGQKNQIDAAKKA  118

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GV+HIVLVGSMGGTNP+HPLN LGNGNILIWKRK+E+YL DS + YTIIRAGGL ++ GG
Sbjct  119  GVEHIVLVGSMGGTNPDHPLNRLGNGNILIWKRKAEQYLIDSEIDYTIIRAGGLLNERGG  178

Query  551  ERELLVGKDDELL  589
             RELLV KDD LL
Sbjct  179  VRELLVDKDDTLL  191



>ref|XP_009606944.1| PREDICTED: uncharacterized protein LOC104101207 [Nicotiana tomentosiformis]
Length=289

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  47   TGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPAIQGIDAIII  226
             G IVYKKL+E S+KY  RGLVR+EESK +IGGADD+YIGDIR+ ESI+PAIQGI A++I
Sbjct  143  VGSIVYKKLKERSEKYTARGLVRTEESKQKIGGADDVYIGDIRDTESIIPAIQGIYALVI  202

Query  227  LTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMG  406
            LTSAVP+MKPGFDP++G RPEFYFEDG  PEQVDWIGQKNQID AKAAGVK IVLVGSMG
Sbjct  203  LTSAVPKMKPGFDPTQGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGVKQIVLVGSMG  262

Query  407  GTNPNHPLNTLGNGNILI  460
            GTNPNHPLN++GNGNIL+
Sbjct  263  GTNPNHPLNSIGNGNILV  280



>gb|KJB36703.1| hypothetical protein B456_006G171900 [Gossypium raimondii]
Length=287

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 136/195 (70%), Gaps = 45/195 (23%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SD+++ RG VR+ ESK  IGGADD+++GDIR+  S+VP
Sbjct  85   TVLVTGAAGRTGQIVYKKLKERSDQFVVRGFVRTPESKETIGGADDVFVGDIRDTTSLVP  144

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA+IILTSAVPRMKPGFDP+KG RPEFYFEDG  PEQV                 
Sbjct  145  AMQGIDALIILTSAVPRMKPGFDPTKGGRPEFYFEDGAYPEQV-----------------  187

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
                                        WKRK+E+YLADSGVPYTIIRAGGLQD++GG R
Sbjct  188  ----------------------------WKRKAEQYLADSGVPYTIIRAGGLQDRDGGIR  219

Query  557  ELLVGKDDELLQTEN  601
            ELLVGKDDELLQTE 
Sbjct  220  ELLVGKDDELLQTET  234



>ref|WP_015223672.1| NAD-dependent epimerase/dehydratase [Cyanobacterium stanieri]
 gb|AFZ48357.1| NAD-dependent epimerase/dehydratase [Cyanobacterium stanieri 
PCC 7202]
Length=255

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVP  196
            VLVTGA GRTG +V KKL+  ++ +   G  RS +    I G+ + +   DI N + +  
Sbjct  4    VLVTGATGRTGSLVVKKLQTQTNNFQVIGFGRSPQKITEIFGSTEGFFVGDILNKDDLKK  63

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++G   +IILTSA P+MK G  P +G+RPEF F +   PE VDW GQKNQID AKA GV
Sbjct  64   AMEGCQILIILTSATPKMK-GI-PEEGKRPEFEFPENGMPEIVDWQGQKNQIDVAKAVGV  121

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +HI+LVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YL DSG+ YTIIRAGGL DK  G R
Sbjct  122  QHIILVGSMGGTNPNHPLNSLGNGNILLWKRKAEQYLIDSGIDYTIIRAGGLLDKPDGRR  181

Query  557  ELLVGKDDELLQT  595
            ELLVGKDD  L +
Sbjct  182  ELLVGKDDYFLTS  194



>ref|WP_015225627.1| NAD-dependent epimerase/dehydratase [Halothece sp. PCC 7418]
 gb|AFZ43751.1| NAD-dependent epimerase/dehydratase [Halothece sp. PCC 7418]
Length=250

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 143/195 (73%), Gaps = 4/195 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESIVP  196
            VLVTGA GRTG IV KKLR+N D     G  RSE   K   G ++ +YIGDIR+  S+ P
Sbjct  6    VLVTGATGRTGSIVLKKLRQNPDLN-AFGFARSEAKIKEIFGSSEGVYIGDIRDKNSLEP  64

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AIQ    +II+TSAVP+MK    P +GERPEF + +  +PE +D+ GQ NQID A+ AGV
Sbjct  65   AIQNCHVLIIVTSAVPQMKE--PPKEGERPEFMYPEDATPEIIDYQGQVNQIDLAQEAGV  122

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
             HI+L+GSMGGTN NHPLN LGNGNILIWKR +EEYL DSG+ YTI+RAGGL ++ GG+R
Sbjct  123  DHIILMGSMGGTNENHPLNKLGNGNILIWKRTAEEYLIDSGIDYTIVRAGGLINEPGGQR  182

Query  557  ELLVGKDDELLQTEN  601
            +LLVGK D LL  E+
Sbjct  183  KLLVGKHDTLLNRES  197



>ref|WP_015229215.1| nucleoside-diphosphate sugar epimerase [Dactylococcopsis salina]
 gb|AFZ50216.1| putative nucleoside-diphosphate sugar epimerase [Dactylococcopsis 
salina PCC 8305]
Length=253

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESIVP  196
            +LVTGA GRTG IV  KL E  + +   G  RS+E  K   G  +  Y+GDIR+ +S+ P
Sbjct  6    ILVTGATGRTGSIVIGKLWEQKNNFQAFGFARSKEKIKEIFGSTEGFYLGDIRDQDSLKP  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++  +A+II TSAVP+MK    P +GERPEF + +  +PE +D+ GQ NQID AK AGV
Sbjct  66   ALKDCEALIITTSAVPQMKQ--PPQEGERPEFTYPENATPEIIDYQGQINQIDLAKEAGV  123

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
             HIVL+GSMGGTN +HPLN LGNGNILIWKRK+E+YL DSG+ YTIIRAGGL ++ GG+R
Sbjct  124  NHIVLMGSMGGTNEDHPLNKLGNGNILIWKRKAEQYLIDSGIDYTIIRAGGLLNEPGGKR  183

Query  557  ELLVGKDDELLQTEN  601
            +LLVGK+D LL  E+
Sbjct  184  QLLVGKNDTLLNRES  198



>ref|WP_006518553.1| putative nucleoside-diphosphate sugar epimerase [Leptolyngbya 
sp. PCC 7375]
 gb|EKU97368.1| putative nucleoside-diphosphate sugar epimerase [Leptolyngbya 
sp. PCC 7375]
Length=258

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 143/192 (74%), Gaps = 3/192 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVP  196
            VLVTGA G+TG +V KKL+   + +  RG  RS +++K+     D+ + G+I     +VP
Sbjct  7    VLVTGATGQTGSLVVKKLQTLPESFRVRGFARSPQKAKSLFDSTDNFFFGNILQPNDLVP  66

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A++G D+++ILTSAVP+MK    P  G+RPEF F  G  PEQ+D+ GQ NQI+ AK AG+
Sbjct  67   ALEGCDSLVILTSAVPQMKA--PPQPGQRPEFTFAPGEMPEQIDYQGQTNQIEAAKRAGI  124

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            + IVLVGSMGGT+ NH LNT+GNGNILIWKRK+E++L DSG+ YTIIRAGGL D+ GG+R
Sbjct  125  QQIVLVGSMGGTDENHFLNTIGNGNILIWKRKAEQHLIDSGIDYTIIRAGGLLDQPGGKR  184

Query  557  ELLVGKDDELLQ  592
            EL+V K+D LL+
Sbjct  185  ELVVSKNDVLLK  196



>ref|WP_028946514.1| oxidoreductase [Synechocystis sp. PCC 6714]
 gb|AIE76197.1| hypothetical protein D082_50350 [Synechocystis sp. PCC 6714]
Length=261

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESI  190
            RTVLVTG  GRTG +V++KL+   + +  RGL RS E + ++ G        DIR  E++
Sbjct  8    RTVLVTGVTGRTGSLVFQKLQAQPEYFTVRGLGRSPEKQQQVLGEQSTCFVGDIRKPETL  67

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
            V  ++G D ++ILTSA+P +     P  G+RP   F  G  PE VD+ GQ NQI+ AK A
Sbjct  68   VEPLRGCDVLVILTSAIPVVV--GQPEPGQRPPLGFLTGEMPEDVDYHGQVNQIEAAKVA  125

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GV+HI+LVGSMGGTNP+H LN +G+GNIL+WKRK+E+YL DSG+ YTIIRAGGL D+ GG
Sbjct  126  GVEHIILVGSMGGTNPDHMLNKIGDGNILLWKRKAEQYLIDSGIDYTIIRAGGLLDQPGG  185

Query  551  ERELLVGKDDELL  589
            +RELLVGKDD+LL
Sbjct  186  KRELLVGKDDQLL  198



>ref|WP_018397631.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=259

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 144/193 (75%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESI  190
            + VLVTGA GRTG +V +KLR   +++   GL RS  + + R G  D  Y GDIR+  ++
Sbjct  4    KKVLVTGATGRTGALVVEKLRCFPEEFEVFGLARSPAKVEERFGNTDGFYFGDIRDRSTL  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              A++G DA++ILTSAVP+M+    P  G+RP+F FE G  PE+VD+ GQ NQID A+AA
Sbjct  64   ETALEGCDALVILTSAVPKMQ--TPPQPGQRPQFDFEPGGRPEEVDFQGQVNQIDVAQAA  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            G++ IVLVGSMGGTN NHPLN +G+GNIL+WKRK+E+YL  SG+ YTIIRAGGL D+ GG
Sbjct  122  GIEQIVLVGSMGGTNENHPLNRIGDGNILVWKRKAEDYLMQSGIDYTIIRAGGLLDQPGG  181

Query  551  ERELLVGKDDELL  589
             REL+VG +DELL
Sbjct  182  VRELIVGHNDELL  194



>ref|XP_009609439.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=134

 Score =   195 bits (495),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  47   TGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPAIQGIDAIII  226
             G IVYKKL+E S+KY  RGLVR+EESK +IGGADD+YIGDIR+ ESI+PAIQGI A++I
Sbjct  4    VGSIVYKKLKERSEKYTARGLVRTEESKQKIGGADDVYIGDIRDTESIIPAIQGIYALVI  63

Query  227  LTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMG  406
            LTSAVP+MKPGFDP++G RPEFYFEDG  PEQVDWIGQKNQID AKAAGVK IVLVGSMG
Sbjct  64   LTSAVPKMKPGFDPTQGGRPEFYFEDGAYPEQVDWIGQKNQIDAAKAAGVKQIVLVGSMG  123

Query  407  GTNPNHPLNTL  439
            GTNPNHPLN++
Sbjct  124  GTNPNHPLNSI  134



>ref|WP_006511619.1| nucleoside-diphosphate-sugar epimerase [Xenococcus sp. PCC 7305]
 gb|ELS01238.1| nucleoside-diphosphate-sugar epimerase [Xenococcus sp. PCC 7305]
Length=256

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 131/194 (68%), Gaps = 5/194 (3%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAE--S  187
            + VLVTGA GRTG +V K+LR+ SD++   G  RS  SK                 E  S
Sbjct  3    KRVLVTGATGRTGALVLKQLRQQSDQFQGIGFARSS-SKVEEIFGSTESFFLGDITEQSS  61

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            +  A+QG  +++ILTSA  +MK    P  G  P+F +E G  PE VD+ GQKNQID A+ 
Sbjct  62   LETALQGCSSLVILTSAGVKMKASSTP--GAPPQFEYEPGGMPETVDYYGQKNQIDAARK  119

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
             GV+HIVLVGSMGGTNPNHPLN +GNG ILIWKRK+E+YL DSG+ YTIIRAGGL D  G
Sbjct  120  LGVEHIVLVGSMGGTNPNHPLNQMGNGKILIWKRKAEQYLIDSGIDYTIIRAGGLIDLEG  179

Query  548  GERELLVGKDDELL  589
            G RELLVGK+D LL
Sbjct  180  GVRELLVGKNDTLL  193



>ref|XP_005648558.1| NAD(P)-binding protein, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE24014.1| NAD(P)-binding protein, partial [Coccomyxa subellipsoidea C-169]
Length=264

 Score =   197 bits (501),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 139/200 (70%), Gaps = 7/200 (4%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARig-----gaddiyigdiRNAE  184
            V VTGAGGRTG+IV +KL    DK+  RG+VR+ +S  ++               ++  E
Sbjct  1    VTVTGAGGRTGKIVLQKLLAQPDKFEARGVVRNTKSAEKLQGEGIPAEKLYVGDIVKGTE  60

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
             +  ++ G DA++I TSAVP++KP      G RP+F F++G  PEQ+DW+GQK QID AK
Sbjct  61   ELKRSLAGADALVIATSAVPQIKP-LSLLTGARPDFSFKEGQFPEQIDWLGQKAQIDAAK  119

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGV-PYTIIRAGGLQDK  541
             AGVK +VL+ SMGGT+ NHPLN LG+GNILIWKRK+EEYL +SG   YTII  GGL D+
Sbjct  120  EAGVKKVVLISSMGGTDENHPLNKLGDGNILIWKRKAEEYLINSGAFDYTIIHPGGLIDE  179

Query  542  NGGERELLVGKDDELLQTEN  601
             GG+REL++G DDELL+ ++
Sbjct  180  EGGKRELVLGVDDELLKNKS  199



>ref|WP_041764708.1| oxidoreductase [Leptolyngbya sp. PCC 7376]
Length=256

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 140/193 (73%), Gaps = 5/193 (3%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVP  196
            +LVTGA GRTG +V +KL+    ++  +   RS +    I G+ + +    I   +++  
Sbjct  7    ILVTGATGRTGSLVVQKLQALPKQFSVKCFGRSPQKATEIFGSTENFYFGSILETQALET  66

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSK-GERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            AI G DA++ILTSA P+MK    PS+ G+RPEF F DG  PEQ+D+ GQ NQI+ AK AG
Sbjct  67   AIVGCDALVILTSATPQMKA---PSQTGQRPEFAFPDGEMPEQIDYQGQLNQINAAKKAG  123

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            V+HIVL+GSMGGT+ NH LNTLGNGNILIWKRK+E+YL DSG+ YTI+RAGGL ++ GG+
Sbjct  124  VQHIVLIGSMGGTDENHFLNTLGNGNILIWKRKAEQYLVDSGIDYTIVRAGGLLNEKGGK  183

Query  554  RELLVGKDDELLQ  592
            REL+V K+D LL+
Sbjct  184  RELVVSKNDVLLK  196



>ref|WP_012160758.1| oxidoreductase [Acaryochloris marina]
 gb|ABW25137.1| nucleoside-diphosphate-sugar epimerase, putative [Acaryochloris 
marina MBIC11017]
Length=254

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSE-ESKARiggaddiyigdiRNAESI  190
            + VLVTGA G+TG IV +KLRE +D++   G  RSE +++ ++G  D + IGD+ +  SI
Sbjct  4    KKVLVTGATGQTGSIVVQKLRECADEFEVVGFARSEAKAQEKLGSLDGVVIGDVTDRASI  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              AI G DA++IL+S+V  MK    P  G+RPEF F  G  PE VD+ G +N ID A AA
Sbjct  64   DSAIAGCDALVILSSSVLVMKG--PPQPGQRPEFEFPQGGYPEDVDYNGHRNVIDAAAAA  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIV+VGSMGGT+ NH LNTLGNG +LIWKR++E+YL DSG+ YTI+RAGGL D+ GG
Sbjct  122  GVKHIVIVGSMGGTDENHYLNTLGNGKVLIWKRRTEQYLIDSGITYTIVRAGGLIDEPGG  181

Query  551  ERELLVGKDDELL  589
             RE++VGKDD   
Sbjct  182  RREIIVGKDDSFF  194



>gb|AFY36871.1| NAD-dependent epimerase/dehydratase [Leptolyngbya sp. PCC 7376]
Length=269

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 140/193 (73%), Gaps = 5/193 (3%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVP  196
            +LVTGA GRTG +V +KL+    ++  +   RS +    I G+ + +    I   +++  
Sbjct  20   ILVTGATGRTGSLVVQKLQALPKQFSVKCFGRSPQKATEIFGSTENFYFGSILETQALET  79

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSK-GERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
            AI G DA++ILTSA P+MK    PS+ G+RPEF F DG  PEQ+D+ GQ NQI+ AK AG
Sbjct  80   AIVGCDALVILTSATPQMKA---PSQTGQRPEFAFPDGEMPEQIDYQGQLNQINAAKKAG  136

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            V+HIVL+GSMGGT+ NH LNTLGNGNILIWKRK+E+YL DSG+ YTI+RAGGL ++ GG+
Sbjct  137  VQHIVLIGSMGGTDENHFLNTLGNGNILIWKRKAEQYLVDSGIDYTIVRAGGLLNEKGGK  196

Query  554  RELLVGKDDELLQ  592
            REL+V K+D LL+
Sbjct  197  RELVVSKNDVLLK  209



>ref|WP_010477937.1| oxidoreductase [Acaryochloris sp. CCMEE 5410]
Length=254

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSE-ESKARiggaddiyigdiRNAESI  190
            + VLVTGA G+TG IV  KLRE +D++   G  RSE +++ ++G  D + IGD+ +  SI
Sbjct  4    KKVLVTGATGQTGSIVVHKLRERADEFEVVGFARSEAKAQEKLGSLDGVVIGDVTDRASI  63

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
              AI G DA++IL+S+V  MK    P  G+RPEF F  G  PE VD+ G +N ID A AA
Sbjct  64   DSAIAGCDALVILSSSVLVMKG--PPQPGQRPEFEFPQGGYPEDVDYNGHRNVIDAAAAA  121

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GVKHIV+VGSMGGT+ NH LNTLGNG +LIWKR++E+YL DSG+ YTI+RAGGL D+ GG
Sbjct  122  GVKHIVIVGSMGGTDENHYLNTLGNGKVLIWKRRTEQYLIDSGITYTIVRAGGLIDEPGG  181

Query  551  ERELLVGKDDELL  589
             RE++VGKDD   
Sbjct  182  RREIIVGKDDSFF  194



>ref|WP_027845500.1| oxidoreductase [Mastigocoleus testarum]
Length=256

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 137/194 (71%), Gaps = 4/194 (2%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            + VLVTGA G TG +V KKL +  +++   G  R+E     + G+ + +       +S++
Sbjct  2    KKVLVTGATGGTGSLVMKKLLQQQNEFEAFGFARNEAKVIELFGSTEKFFLGDIKDQSVL  61

Query  194  P-AIQGIDAIIILTSAVPRMKPGFDPSK-GERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
              A+ GI+A++ILTSA+P MK    P+K GERP F +  G +PE+VD+ GQKNQID A  
Sbjct  62   EQAMVGINALVILTSAIPIMKT--PPTKEGERPVFEYAPGGTPEEVDYQGQKNQIDAAVK  119

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNG  547
            AGV+ IVLVGS GGT+ NH LNT+GNGNILIWKRK+E+YL DSG+ YTI+ AGGL ++ G
Sbjct  120  AGVEQIVLVGSGGGTDENHYLNTIGNGNILIWKRKAEQYLIDSGIDYTIVHAGGLLNETG  179

Query  548  GERELLVGKDDELL  589
            G RELLVGKDD L+
Sbjct  180  GLRELLVGKDDTLI  193



>emb|CDX74941.1| BnaA05g06870D [Brassica napus]
Length=288

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 131/184 (71%), Gaps = 10/184 (5%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E SD+++ RGLVR++ESK +IGG D+++IGDIR+  +I P
Sbjct  76   TVLVTGAGGRTGQIVYKKLKERSDEFVARGLVRTKESKEKIGGEDEVFIGDIRDPSAIAP  135

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+QGIDA++ILTSAVP+MKPGFDPSKG RPEFYF++G  PEQVDWIGQKNQID AKAAGV
Sbjct  136  AVQGIDALVILTSAVPQMKPGFDPSKGGRPEFYFDEGAYPEQVDWIGQKNQIDAAKAAGV  195

Query  377  KHIVLVGSMGGTNPNH--------PLNTLGNGNILIWKRK--SEEYLADSGVPYTIIRAG  526
            K I       G               +T  +G ++   RK   E YL++    +  ++  
Sbjct  196  KQIYWQCQHSGLEEESRAVLELIPVFHTPSSGRVVCRTRKVAFESYLSEKMTSFLRLKQE  255

Query  527  GLQD  538
             LQ+
Sbjct  256  QLQE  259



>ref|XP_002507838.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69096.1| predicted protein [Micromonas sp. RCC299]
Length=279

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 127/210 (60%), Gaps = 22/210 (10%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigd------iRNA  181
            V VTGAGGRTG +  K L ++ +    RGLVRSE+S A++                + +A
Sbjct  3    VAVTGAGGRTGSLCMKLLAQSPEFAPPRGLVRSEKSAAKVKKLLGAESDAECVIGDVSDA  62

Query  182  ESIVPAIQGIDAIIILTSAVPRMK-------------PGFDPSKGERPEFYFEDGLSPEQ  322
             S     +G D ++ILTSAVP+ K             P  D    +RPEFYF D   PE 
Sbjct  63   TSCRALCEGCDGLVILTSAVPKPKIASLVVAIVSKILPWMD---AKRPEFYFPDEGRPEL  119

Query  323  VDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGV  502
            VDW  QKNQID AKAAGVK +VLV SMGGT  ++ LNT+G+GNIL+WKRK+E YL  SG+
Sbjct  120  VDWAYQKNQIDAAKAAGVKKVVLVSSMGGTQIDNFLNTMGDGNILLWKRKAEMYLKASGL  179

Query  503  PYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
             Y I+  GGL DK GG+RELL G DD LL 
Sbjct  180  DYAIVHPGGLLDKEGGKRELLAGLDDSLLS  209



>ref|XP_001695427.1| isomerase [Chlamydomonas reinhardtii]
 gb|EDP01685.1| isomerase [Chlamydomonas reinhardtii]
Length=300

 Score =   177 bits (450),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 129/204 (63%), Gaps = 13/204 (6%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARig----gaddiyigdiRNAES  187
            V VTGA GRTG +V KKL E  D++  R +VR+  SK+++      A          A++
Sbjct  32   VAVTGAAGRTGGLVVKKLVERKDQFEARAVVRNASSKSKLAGLPDTAIFEVDLARGGADA  91

Query  188  IVPAIQGIDAIIILTSAVPRMKP---------GFDPSKGERPEFYFEDGLSPEQVDWIGQ  340
             +PA  G DA++I TS VP +KP               G  PEF +++G  PEQVDW+GQ
Sbjct  92   FLPAFSGCDAVVIATSGVPVLKPLSLIPVFWAKLTGKTGVSPEFSWKEGQFPEQVDWLGQ  151

Query  341  KNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIR  520
            K QID AK AGVK +VLV SMGGT+P++ LN LG GNIL WKRK+E+YL  SG+ YTII 
Sbjct  152  KAQIDAAKKAGVKKVVLVSSMGGTDPSNNLNKLGGGNILQWKRKAEQYLIASGLTYTIIH  211

Query  521  AGGLQDKNGGERELLVGKDDELLQ  592
             GGL D+  G+RE+ +G DD L++
Sbjct  212  PGGLIDEPDGQREIRLGVDDTLIK  235



>ref|XP_005847390.1| hypothetical protein CHLNCDRAFT_134220 [Chlorella variabilis]
 gb|EFN55288.1| hypothetical protein CHLNCDRAFT_134220 [Chlorella variabilis]
Length=465

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 135/206 (66%), Gaps = 16/206 (8%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESK-------ARiggaddiyigdiRN  178
            V VTGAGGRTG +V KKL E  D++  RG+VR+ +S        A         I     
Sbjct  184  VAVTGAGGRTGALVMKKLLERPDQFAARGVVRNGKSAEQLKGWGASEEQIVMGDILREGG  243

Query  179  AESIVPAIQGIDAIIILTSAVPRMKP-GFDP--------SKGERPEFYFEDGLSPEQVDW  331
              ++  A++G DA++I TSAVP++KP    P         +G RP+F F++   PEQ+DW
Sbjct  244  EAALQRAVEGADALVIATSAVPKIKPLSLIPVLLAKVTGKQGVRPQFSFKEDQMPEQIDW  303

Query  332  IGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYT  511
            +GQK QID AKAAGV+ +V++ SMGGT  ++ LNT+G+GNIL+WKRK+E+YL DSG+ YT
Sbjct  304  LGQKAQIDAAKAAGVRKVVVISSMGGTQKDNFLNTIGDGNILVWKRKAEKYLIDSGLTYT  363

Query  512  IIRAGGLQDKNGGERELLVGKDDELL  589
            I+  GGL D+ GG+REL++  DD L+
Sbjct  364  IVHPGGLIDEEGGKRELVIDVDDGLI  389



>ref|XP_005710888.1| unnamed protein product [Chondrus crispus]
 emb|CDF40594.1| unnamed protein product [Chondrus crispus]
Length=287

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 128/197 (65%), Gaps = 11/197 (6%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdi-------RN  178
            VLVTGAGGRTG++V + L    D Y   GLVRS+ ++A+    +     +          
Sbjct  37   VLVTGAGGRTGRLVLESLVAAGDAYEATGLVRSK-TRAKELMEETYNKVEALLTEGDITK  95

Query  179  AESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDT  358
             E++   ++G DA++ILTSAVP+M P   P +G+ P FY+E+G  PE VDW G K QID 
Sbjct  96   EETLREPLKGKDALVILTSAVPKMNP---PVEGQAPSFYYEEGGMPETVDWHGAKRQIDL  152

Query  359  AKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQD  538
            A  AGVKH+VLVGSMG T+  + LN +GNGNIL +KRK+E YL  SGV YTII   GL +
Sbjct  153  AIEAGVKHVVLVGSMGSTDDANQLNRIGNGNILRFKRKAELYLIGSGVDYTIINPAGLCN  212

Query  539  KNGGERELLVGKDDELL  589
            +  G+REL+VG +DEL 
Sbjct  213  EEPGKRELVVGHNDELF  229



>gb|AIE43895.1| WRKY transcription factor 38 [Gossypium hirsutum]
Length=953

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +2

Query  317  EQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADS  496
            E+VDWIGQKNQID AK AGVK IVLVGSMGGTNPNHPLN+LGNGNIL+WKRK+E+YLADS
Sbjct  806  EKVDWIGQKNQIDVAKEAGVKQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADS  865

Query  497  GVPYTIIRAGGLQDKNGGERELLVGKDDELLQTE  598
            GVPYTIIRAGGLQD++GG RELLVGKDDELLQTE
Sbjct  866  GVPYTIIRAGGLQDRDGGIRELLVGKDDELLQTE  899



>gb|KIY93432.1| Uncharacterized protein MNEG_14531 [Monoraphidium neglectum]
Length=320

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 135/211 (64%), Gaps = 20/211 (9%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLREN-SDKYITRGLVRSEESKARiggaddiyigdiR-------  175
            V VTGAGGRTG +V KKL E  +DK++   +VRS++S  ++     +  G  +       
Sbjct  34   VAVTGAGGRTGGLVVKKLLEGGADKFVAVPIVRSQKSADKVESTYSLAKGSAKVLDISSG  93

Query  176  NAESIVPAIQGIDAIIILTSAVPR-MKPGFDP--------SKGERPEFYFEDGLSPEQVD  328
            +  +   A+QG DA++I TSAVP  +K    P         +G RP+F +++G +PEQVD
Sbjct  94   DVAAATTALQGCDALVIATSAVPEILKLSLIPVILAKLFKKEGVRPQFRWKEGQTPEQVD  153

Query  329  WIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTL---GNGNILIWKRKSEEYLADSG  499
            W+GQK QID AKAAGVK +VLVGSMGGT+P++ LN L     G IL WKR++E+YL  SG
Sbjct  154  WLGQKVQIDAAKAAGVKQVVLVGSMGGTDPSNMLNKLVGEDGGQILQWKRRAEQYLVASG  213

Query  500  VPYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
            + YTII  GGL D+ GG+R L V  DD LL+
Sbjct  214  LTYTIIHPGGLVDEEGGKRRLAVDVDDGLLK  244



>ref|XP_005786583.1| hypothetical protein EMIHUDRAFT_429362 [Emiliania huxleyi CCMP1516]
 gb|EOD34154.1| hypothetical protein EMIHUDRAFT_429362 [Emiliania huxleyi CCMP1516]
Length=293

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 134/204 (66%), Gaps = 16/204 (8%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiR----NAE  184
            VLVTGAGGRTG++V+++L+E++  +   GLVRS+++ KA            +R    +  
Sbjct  18   VLVTGAGGRTGKLVFQQLKESA-SFAPVGLVRSKKAVKALRKVGGADDAEIVRADVTDGA  76

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            ++  A+ G D++++ TSAVP++ P F  +K  RP+F F  G +PE+VDW+G K QID AK
Sbjct  77   ALAAAMAGCDSVVLCTSAVPQILP-FSIAKPGRPKFKFAPGGTPEEVDWLGAKLQIDAAK  135

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGN---------GNILIWKRKSEEYLADSGVPYTII  517
            AAGVK  V V SMGGT P++ LN++G          G+IL+WKRK+E YL  SG+ YTII
Sbjct  136  AAGVKRFVFVSSMGGTQPDNFLNSIGERKSDEDGSGGDILLWKRKAERYLISSGLEYTII  195

Query  518  RAGGLQDKNGGERELLVGKDDELL  589
              GGL DK  G REL VG DDELL
Sbjct  196  HPGGLVDKPAGARELTVGVDDELL  219



>ref|XP_009035991.1| hypothetical protein AURANDRAFT_5707, partial [Aureococcus anophagefferens]
 gb|EGB09145.1| hypothetical protein AURANDRAFT_5707, partial [Aureococcus anophagefferens]
Length=272

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES--  187
            + VLVTGAGGRTG++V+KKL+++       GL RS ++   +  A       +    +  
Sbjct  5    KKVLVTGAGGRTGKLVFKKLKDDYADVAPLGLARSAKAAKALKAAGAAGDEVVAADVADE  64

Query  188  --IVPAIQGIDAIIILTSAVPRM-----------KPGFDPSKGERPEFYFEDGLSPEQVD  328
              +  A+ G DA+++ TSAVP +           K    P  G RPEF F  G +PE+VD
Sbjct  65   AALAEAMAGCDAVVLCTSAVPAIRKRSLVKLMVKKLLRRPDVG-RPEFSFPPGGTPEEVD  123

Query  329  WIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGN------GNILIWKRKSEEYLA  490
            W+G + QID AKAAGV H V V SMGGT P + LNT+G       G+IL+WKRK+E YL 
Sbjct  124  WLGARKQIDAAKAAGVSHFVFVSSMGGTQPENFLNTIGKQDDGSGGDILLWKRKAERYLV  183

Query  491  DSGVPYTIIRAGGLQDKNGGERELLVGKDDELL  589
            DSGVP+TI+  GGL D+  G+REL V  DD LL
Sbjct  184  DSGVPFTIVHPGGLVDEEPGKRELTVEVDDVLL  216



>ref|WP_044077164.1| oxidoreductase, partial [Prochlorothrix hollandica]
Length=170

 Score =   160 bits (405),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVP  196
            VLVTGA GRTG IV +KLR++ D++   G  RS ++ +   G  D  + GD+R+  S+  
Sbjct  6    VLVTGATGRTGAIVLQKLRQDPDRFEGIGFGRSTQKVQDLFGSLDGFFFGDVRDRASLDT  65

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+ G  ++II +S++P++K    P  G+RPEF F  G  PE +D+ GQ NQID A+AAGV
Sbjct  66   ALVGCHSLIIASSSIPQLKA--PPQAGQRPEFEFAPGEMPEAIDYQGQVNQIDAAQAAGV  123

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTII  517
             HIVL+ SMGGT  +HPLN LGNGN+L+WKRK+E+YL DSG+ YTII
Sbjct  124  SHIVLISSMGGTQADHPLNRLGNGNVLVWKRKAEQYLLDSGLTYTII  170



>ref|XP_002958587.1| hypothetical protein VOLCADRAFT_84511 [Volvox carteri f. nagariensis]
 gb|EFJ40324.1| hypothetical protein VOLCADRAFT_84511 [Volvox carteri f. nagariensis]
Length=307

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 134/212 (63%), Gaps = 15/212 (7%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARig------gaddiyi  163
            A  +  V VTG+ GRTG +V KKL E + ++ TR +VR+  SK ++        A     
Sbjct  31   AQARLKVAVTGSAGRTGALVVKKLLERAAEFETRAVVRNSSSKPKLTQLGLEESAILAAD  90

Query  164  gdiRNAESIVPAIQGIDAIIILTSAVPRMKP---------GFDPSKGERPEFYFEDGLSP  316
                +A++   A  G DA++I TSAVP +KP              KG  P+F +++G +P
Sbjct  91   ISQGDAKAFEAAFTGCDAVVIATSAVPVLKPLSLIPVFWAKLTGGKGVMPQFGWKEGQNP  150

Query  317  EQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADS  496
            EQVDW+GQK QID AKA GVK +VL+ SMGGT+ ++ LN LGNGNIL WKRK+E+YL  S
Sbjct  151  EQVDWLGQKVQIDAAKATGVKKVVLISSMGGTDKDNNLNKLGNGNILQWKRKAEQYLIAS  210

Query  497  GVPYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
            G+ YTII  GGL D+  G+R+L+VG DD LL+
Sbjct  211  GLTYTIIHPGGLIDEADGQRQLVVGVDDTLLK  242



>gb|EWM30532.1| NAD(P)-binding domain protein [Nannochloropsis gaditana]
Length=357

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 139/227 (61%), Gaps = 39/227 (17%)
 Frame = +2

Query  5    DGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-----KARiggaddiyigd  169
            D  R VLVTGAGGRTG +V++KL+  +D +   GLVRS++S     KA     + I IGD
Sbjct  48   DSPRKVLVTGAGGRTGTLVFQKLQAKTD-FQPIGLVRSKKSASKLRKAAGATDEQIVIGD  106

Query  170  iRNAESIVPAIQGIDAIIILTSAVP----------------RMKPGFDPSKGERPEFYFE  301
            + +  ++  A++G D++I+ TSA P                R  PG       RPEF F 
Sbjct  107  VMDPATLSKALEGCDSLILCTSATPKILLFSVIKILFKKLLRRAPG-------RPEFKFP  159

Query  302  DGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGN------GNILIW  463
                PE+VDW+G KNQ+D A AAGVKH V +GSMGGT P++ LN++G       G+IL+W
Sbjct  160  PRGEPEEVDWLGAKNQVDAALAAGVKHFVFLGSMGGTQPDNFLNSIGKRPDGSGGDILLW  219

Query  464  KRKSEEYL---ADS-GVPYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
            KRK+E+YL   A+S G+ YTI+  GGL DK GG++EL+   DD LLQ
Sbjct  220  KRKAEKYLIQRANSHGMSYTIVHPGGLLDKPGGQQELVFDVDDVLLQ  266



>ref|XP_005770740.1| hypothetical protein EMIHUDRAFT_349981 [Emiliania huxleyi CCMP1516]
 gb|EOD18311.1| hypothetical protein EMIHUDRAFT_349981 [Emiliania huxleyi CCMP1516]
Length=283

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 132/202 (65%), Gaps = 17/202 (8%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARigg----addiyigdiRNAES  187
            V VTGAGG+TGQ  ++KL    + +   G+VRSEESKA +      AD + + D+ +  +
Sbjct  18   VAVTGAGGQTGQHAFRKLLALPE-FEPVGIVRSEESKAALVKSGVPADAVTVADVTDGAA  76

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I  A+ G DA+II TSA P      D S G RP F F +G  PE VDW+GQK+QID AKA
Sbjct  77   IAAALAGCDALIIGTSAKPAPSGETDESTG-RPIFGFPNG-QPEAVDWLGQKSQIDGAKA  134

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLG----------NGNILIWKRKSEEYLADSGVPYTII  517
            AG  H+VL  SMGGT+P + LN LG           G+IL+WKRK+E+YL DSGVP+TI+
Sbjct  135  AGAIHVVLCSSMGGTDPGNMLNALGRESLPDGSTKGGDILLWKRKAEKYLIDSGVPFTIV  194

Query  518  RAGGLQDKNGGERELLVGKDDE  583
              GGL ++ GG+R+L++G DDE
Sbjct  195  HPGGLLNEPGGKRQLVLGVDDE  216



>ref|XP_005788669.1| hypothetical protein EMIHUDRAFT_362530 [Emiliania huxleyi CCMP1516]
 gb|EOD36240.1| hypothetical protein EMIHUDRAFT_362530 [Emiliania huxleyi CCMP1516]
Length=283

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 132/202 (65%), Gaps = 17/202 (8%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARigg----addiyigdiRNAES  187
            V VTGAGG+TGQ  ++KL    + +   G+VRSEESKA +      AD + + D+ +  +
Sbjct  18   VAVTGAGGQTGQHAFRKLLALPE-FEPVGIVRSEESKAALVKSGVPADAVTVADVTDEAA  76

Query  188  IVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKA  367
            I  A+ G DA+II TSA P      D S G RP F F +G  PE VDW+GQK+QID AKA
Sbjct  77   IAAALAGCDALIIGTSAKPAPSGETDESTG-RPIFGFPNG-QPEAVDWLGQKSQIDGAKA  134

Query  368  AGVKHIVLVGSMGGTNPNHPLNTLG----------NGNILIWKRKSEEYLADSGVPYTII  517
            AG  H+VL  SMGGT+P + LN LG           G+IL+WKRK+E+YL DSGVP+TI+
Sbjct  135  AGAIHVVLCSSMGGTDPGNMLNALGRESLPDGSTKGGDILLWKRKAEKYLIDSGVPFTIV  194

Query  518  RAGGLQDKNGGERELLVGKDDE  583
              GGL ++ GG+R+L++G DDE
Sbjct  195  HPGGLLNEPGGKRQLVLGVDDE  216



>ref|XP_005839875.1| hypothetical protein GUITHDRAFT_84495 [Guillardia theta CCMP2712]
 gb|EKX52895.1| hypothetical protein GUITHDRAFT_84495 [Guillardia theta CCMP2712]
Length=307

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 128/232 (55%), Gaps = 42/232 (18%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiR------  175
            + VLVTGA GRTG + + KLRE   ++  RGLVRS++   ++           +      
Sbjct  18   KQVLVTGASGRTGFLTFTKLRELEKEFYVRGLVRSQKGAKKLETTGASLGDSEKIKEQNA  77

Query  176  ----------------------NAESIVPAIQGIDAIIILTSAVPRM------KPGFDPS  271
                                  + +SI  A   +DA++ILTS VP++      K      
Sbjct  78   KMRAMGLPADDDEPEVFVGDIMDRDSIQEAFDDLDALVILTSGVPKLRKREIVKTVLSKL  137

Query  272  KGER--PEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGT----NPNHPLN  433
             G +  P+FY++    PE+VDW+G K QID AK  G+ H+VLV SMG +     P++ LN
Sbjct  138  IGRQRMPKFYYDQ--MPEEVDWLGCKCQIDLAKEKGIDHVVLVSSMGVSPQKNTPDNTLN  195

Query  434  TLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELL  589
             +G GNIL+WK K+E+YL +SG+ YTII  GGL +K GGEREL++G DD LL
Sbjct  196  KIGGGNILVWKAKAEDYLKESGLTYTIIHPGGLTNKPGGERELVLGTDDSLL  247



>ref|XP_003062210.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53922.1| predicted protein [Micromonas pusilla CCMP1545]
Length=290

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 132/216 (61%), Gaps = 26/216 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYIT--RGLVRSEES--KARigg------addiyigd  169
            V VTGAGGRTG IV K L  ++       RGLVRS +S  K R           D+  GD
Sbjct  3    VAVTGAGGRTGSIVMKLLASDASGAFAPPRGLVRSTKSGDKVRNLCDGGDANLCDVVEGD  62

Query  170  iRNAESIVPAIQGIDAIIILTSAVPRMKPG----------FDPSKGERPEFYFEDGLSPE  319
            I +A+++     G+DA++ILTSAVP+ K G             ++ +RP+FYF +G SP 
Sbjct  63   ISSADALRTLCDGVDALVILTSAVPKPKIGSMIAALVSKILPWAENKRPDFYFPEGGSPR  122

Query  320  QVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNG------NILIWKRKSEE  481
            +VD+  Q  QID AK AGVK +VLV SMG T  ++ LNT+G G      NIL+WKRK+E 
Sbjct  123  EVDYEWQVAQIDAAKRAGVKKVVLVSSMGVTQIDNFLNTMGGGGDVGDANILLWKRKAEM  182

Query  482  YLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELL  589
             L  SG+ Y+I+  GGL +K GG+RELLVG +DELL
Sbjct  183  ALVASGLDYSIVHPGGLLNKEGGKRELLVGVNDELL  218



>tpg|DAA52225.1| TPA: hypothetical protein ZEAMMB73_650028 [Zea mays]
Length=113

 Score =   144 bits (362),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    ADGKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA  181
            A  + TVLVTGAGGRTGQIVY KL+E S++++ RGLVR+EESK +IG A D+Y+ DIR+A
Sbjct  5    ATSRPTVLVTGAGGRTGQIVYNKLKERSEQFVARGLVRTEESKQKIGAAGDVYVADIRDA  64

Query  182  ESIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQV  325
            + + PA+QG+DA+IILTSA P+MKPGFDPSKG RPEFY+EDG+ PEQV
Sbjct  65   DRLAPAVQGVDALIILTSAAPKMKPGFDPSKGGRPEFYYEDGMYPEQV  112



>gb|KJB36700.1| hypothetical protein B456_006G171900 [Gossypium raimondii]
Length=206

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGA GRTGQIVYKKL+E SD+++ RG VR+ ESK  IGGADD+++GDIR+  S+VP
Sbjct  85   TVLVTGAAGRTGQIVYKKLKERSDQFVVRGFVRTPESKETIGGADDVFVGDIRDTTSLVP  144

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWI  334
            A+QGIDA+IILTSAVPRMKPGFDP+KG RPEFYFEDG  PEQV+  
Sbjct  145  AMQGIDALIILTSAVPRMKPGFDPTKGGRPEFYFEDGAYPEQVNHF  190



>ref|XP_002288380.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93816.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=252

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 123/208 (59%), Gaps = 15/208 (7%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESI  190
            R V+VTGAGG+TGQ V++KL      Y   G VR+ ++++     +  I      +  ++
Sbjct  3    RKVIVTGAGGQTGQHVFRKLLSKP-GYTAIGTVRAGDDTQTIPPESVAICDITNEDTSAL  61

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
               ++  DA++I TSA P    G    + +RP+F F +G  PE VDWIGQKN ID AK A
Sbjct  62   DELVKDCDAVMICTSAKP-APTGEINEETKRPKFGFPNG-QPELVDWIGQKNLIDAAKKA  119

Query  371  GVK-HIVLVGSMGGTNPNHPLNTLGN----------GNILIWKRKSEEYLADSGVPYTII  517
                H+V+  SMGGTNPN+ LN LG           G+IL WKRK+E YL +SG+ YTI+
Sbjct  120  NKDVHVVICSSMGGTNPNNSLNNLGKVTNPDGSTSGGDILKWKRKAEVYLMESGLAYTIV  179

Query  518  RAGGLQDKNGGERELLVGKDDELLQTEN  601
              GGL ++ G +REL +G DD++  T N
Sbjct  180  HPGGLLNEPGNQRELCLGVDDKIPGTSN  207



>ref|XP_002186209.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65679.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=294

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 132/229 (58%), Gaps = 34/229 (15%)
 Frame = +2

Query  8    GKRTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESK---------ARiggaddiy  160
            G   VLVTGA GRTGQ+V++ L  N + +  + LVRSE+S           R+       
Sbjct  40   GPSRVLVTGASGRTGQLVFEALLNNPE-FEPKALVRSEKSAKVLRKRIPATRLDQIVVCD  98

Query  161  igdiRNAESIVPAIQGIDAIIILTSAVPR----------MKPGFDPSKGERP------EF  292
            +    N     P  +G +A++I TSAVP+          +K  F+  +G++       +F
Sbjct  99   VTKDLNVTP-PPGQEGCEAMVICTSAVPKISKVSLLKQFLKIPFNLLRGKKAVDFRSMKF  157

Query  293  YFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLG-------NGN  451
             +++G  PE+VD+ GQ  QID AK  G+K +V+V SMGGT+P++ LN++G       NG+
Sbjct  158  VWQNGQYPEKVDYEGQVAQIDLAKKLGMKQVVVVSSMGGTDPSNFLNSVGKNPDGSGNGD  217

Query  452  ILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELLQTE  598
            IL+WKRK+E YL +SG+ YT++  GGL DK  G  E ++  DD+LL+ +
Sbjct  218  ILLWKRKAERYLVESGLFYTVLHPGGLVDKPAGGEEFVLDVDDKLLENK  266



>ref|XP_002296271.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|ACI64988.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=260

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 120/233 (52%), Gaps = 40/233 (17%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            T L     GRTG +V+K+L  +S ++   GLVRSE S  ++       + ++  ++    
Sbjct  1    TSLAYNPAGRTGSLVFKRLIGDS-RFDVVGLVRSEASAKKLIAKTKCALEEVVVSDVTQM  59

Query  197  AIQGID--------------AIIILTSAVPR-----------------MKPGFDPSKGER  283
              + +D              A++I TSAVP+                 + P         
Sbjct  60   EFENVDDNPHPWPYALDNTEAMVICTSAVPQISKLSIMKALLKIPLNILTPNKKAINFRD  119

Query  284  PEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTL--------  439
             +F +  G  PE+VD+ GQK QID AK  GVKHIVLV SMGG +P++ LN++        
Sbjct  120  LQFRYRPGQYPEKVDYWGQKKQIDFAKKLGVKHIVLVSSMGGLDPDNFLNSIGKDRMTGE  179

Query  440  GNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELLQTE  598
            GNG+ILIWKRK+E YL  SG+ YT+I  GGL D    + EL++  DD L++ E
Sbjct  180  GNGDILIWKRKAERYLRVSGLQYTVIHPGGLVDTEASQMELVLDVDDNLMKNE  232



>ref|XP_005705127.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Galdieria sulphuraria]
 gb|EME28607.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Galdieria sulphuraria]
Length=291

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 112/196 (57%), Gaps = 4/196 (2%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV-P  196
            +LVTGA GRTG +  KK       +  RGL RS+E  +++   +  +       E I+  
Sbjct  48   LLVTGASGRTGSLALKKAATLPQLFSPRGLARSKEKTSKLFDNNYTFFFGSILDEKILRE  107

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQV-DWIGQKNQIDTAKAAG  373
            A+     ++ILTSAVP M+   D +  + PEF+F+ G  PEQV     +K QI+  K   
Sbjct  108  ALDNCKKLLILTSAVPIMRLNPDGTPKQPPEFFFKQGEEPEQVFSSERKKKQIEITKHCE  167

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
             ++I ++ +   T  +HPLN LGN  IL+WK+KSE+YL   G+P+TII  GGL DK    
Sbjct  168  EENIKIISNKTVTQKDHPLNRLGN--ILMWKKKSEDYLMSCGIPFTIIHPGGLVDKAESR  225

Query  554  RELLVGKDDELLQTEN  601
            R L++G +D L+ + +
Sbjct  226  RSLVIGHNDNLVNSTH  241



>gb|EJK60442.1| hypothetical protein THAOC_19209 [Thalassiosira oceanica]
Length=364

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 129/229 (56%), Gaps = 38/229 (17%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSD-KYITRGLVRSEESKARiggaddi-----yigdiRNA  181
            ++VTGA GRTG +++ KL  N+D ++   GLVRSE S  ++            + D+ N 
Sbjct  68   IVVTGAAGRTGSLIFSKL--NADPRFDAVGLVRSETSAKKLISKTRCDLNEVVVCDVTNM  125

Query  182  E------SIVPAI-QGIDAIIILTSAVPR----------MKPGFDPSKGERP------EF  292
            E         P I  G  A++I TSAVP+          +K   +  +GE+       +F
Sbjct  126  EFGEEDDHPWPTILDGAAAMVICTSAVPQISKSSVIKAMLKAPLNVLRGEKAVNFRDFKF  185

Query  293  YFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTL-------GNGN  451
             F+ G  PE VD++GQ  QID AK  G+KH+VLV SMG  +P++ LN++       G+G+
Sbjct  186  KFKPGQYPEMVDYVGQTKQIDFAKKVGIKHVVLVSSMGVLDPDNFLNSIGKDKNGEGHGD  245

Query  452  ILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELLQTE  598
            IL+WKR++E+YL  SG+ Y+II  GGL D    + +L++  DD L++ E
Sbjct  246  ILVWKRRAEKYLCLSGLRYSIIHPGGLVDTEESKMKLVLDVDDNLMRRE  294



>emb|CBN76881.1| conserved unknown protein [Ectocarpus siliculosus]
Length=350

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 109/177 (62%), Gaps = 27/177 (15%)
 Frame = +2

Query  14   RTVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAES--  187
            R VLVTGAGGRTG IV++KL +  + Y T+G+VR+E+S   +       + D   A +  
Sbjct  68   RRVLVTGAGGRTGGIVFEKLLDK-EGYATKGMVRTEKSANNLKKKCKTEVLDSNIAIADL  126

Query  188  -----IVPAIQGIDAIIILTSAVPRMKPGFDPSKGE------------RPEFYFEDGLSP  316
                 +  A++G++A+++ TSAVP++ P F  +K              RP+FY+ +  +P
Sbjct  127  TTPGLLAAALEGMEAVVLCTSAVPKIYP-FSIAKVMFKKMILRSEDPGRPKFYWCENGTP  185

Query  317  EQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGN------GNILIWKR  469
            E+VDW+G K  ID AK+AGVKH V VGSMGGT P++ LNT+G       G+IL+WKR
Sbjct  186  EEVDWLGAKALIDAAKSAGVKHFVYVGSMGGTQPDNFLNTIGKQEDGTGGDILLWKR  242



>gb|EJK67090.1| hypothetical protein THAOC_11921 [Thalassiosira oceanica]
Length=277

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 116/211 (55%), Gaps = 26/211 (12%)
 Frame = +2

Query  35   AGGRTGQIVYKKLRENSDKYITRGLVRSEESK----------ARiggaddiyigdiRNAE  184
            AGG+TGQ+ ++ L      Y   G  R++ESK          ++    + + + DI + +
Sbjct  9    AGGQTGQLAFRSLLAKPGFYPI-GTTRNDESKKALIEGDGLGSQAIPEEQVVVLDITDRD  67

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            S+   ++G DA++I TSA P      D S G RP F F  G  PE VDW GQ+N ID AK
Sbjct  68   SVEEKMKGCDAVLICTSAKPAPTGEVDESTG-RPTFGFPRG-QPELVDWEGQRNLIDAAK  125

Query  365  AAGV-KHIVLVGSMGGT-----------NPNHPLNTLGNGNILIWKRKSEEYLADSGVPY  508
             A    H++L  SMGGT            P     T G G+IL WKRK+E+YL DSG+PY
Sbjct  126  KANPGMHVILCSSMGGTNPNNPLNNLGKTPAEGGKTTG-GDILKWKRKAEKYLMDSGLPY  184

Query  509  TIIRAGGLQDKNGGERELLVGKDDELLQTEN  601
            TI+  GGL ++ GGEREL VG DD +  T N
Sbjct  185  TIVHPGGLLNEPGGERELCVGVDDVIPGTSN  215



>gb|EEE62068.1| hypothetical protein OsJ_16852 [Oryza sativa Japonica Group]
Length=227

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
            TVLVTGAGGRTGQIVYKKL+E +D+++ RGLVR+EESKA+IGGA D+++GDIR+  SI P
Sbjct  46   TVLVTGAGGRTGQIVYKKLKERADQFVGRGLVRTEESKAKIGGAADVFVGDIRDPASIAP  105

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGE  280
            AI GIDA+IILTSAVP+MKPGFDPSKG+
Sbjct  106  AIDGIDALIILTSAVPKMKPGFDPSKGD  133


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +2

Query  518  RAGGLQDKNGGERELLVGKDDELLQTEN  601
            RAGGLQDK+GG RELLVGKDDE+L+TE 
Sbjct  147  RAGGLQDKDGGVRELLVGKDDEILKTET  174



>gb|AFW74983.1| hypothetical protein ZEAMMB73_772170 [Zea mays]
Length=123

 Score =   115 bits (287),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  392  VGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVG  571
            +GSMGGT+ NHPLN LGN N+L+WKRK+E+YLADSG+ +TIIRAG LQDK+GG REL+VG
Sbjct  1    MGSMGGTDINHPLNNLGNANVLVWKRKAEQYLADSGLLHTIIRAGSLQDKDGGLRELIVG  60

Query  572  KDDELLQTE  598
            KDDE+L+TE
Sbjct  61   KDDEILKTE  69



>ref|XP_005791215.1| hypothetical protein EMIHUDRAFT_466780 [Emiliania huxleyi CCMP1516]
 gb|EOD38786.1| hypothetical protein EMIHUDRAFT_466780 [Emiliania huxleyi CCMP1516]
Length=285

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 114/213 (54%), Gaps = 25/213 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA------  181
            V VTGA G TG +V +KL+E    +    +VRS++    +  +       + +       
Sbjct  3    VAVTGASGLTGSLVVRKLQERG--HTPLAVVRSQDKADELCASYANLDVALTDVTGPGAR  60

Query  182  ESIVPAIQGIDAIIILTSAVPRMK----PG-----FDPSKGERPEFYFEDGLSPEQVDWI  334
             S+  A+ G DA+II TSA P++     PG        +K  +P F F  G +P  VD+ 
Sbjct  61   ASLETALGGADALIICTSAKPKLDFWSLPGVIFGKMMGNKDAKPRFSFPAGAAPRDVDYE  120

Query  335  GQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTI  514
            G + QI  AKAAGV H+VL+ SM GT P H LN +    I++WKR++E  L  SG+ YT+
Sbjct  121  GTRVQIAAAKAAGVSHVVLLSSMAGTLPEHFLN-VSMDKIVLWKRRAEMELIASGLEYTV  179

Query  515  IRAGGL-------QDKNGGERELLVGKDDELLQ  592
            I  GGL       +   GG+R L+VG DD L++
Sbjct  180  IHPGGLLPHYGQKEPAPGGQRALVVGVDDALME  212



>ref|XP_005757543.1| hypothetical protein EMIHUDRAFT_466065 [Emiliania huxleyi CCMP1516]
 gb|EOD05114.1| hypothetical protein EMIHUDRAFT_466065 [Emiliania huxleyi CCMP1516]
Length=285

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 114/213 (54%), Gaps = 25/213 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNA------  181
            V VTGA G TG +V +KL+E    +    +VRS++    +  +       + +       
Sbjct  3    VAVTGASGLTGSLVVRKLQERG--HTPLAVVRSQDKADELCASYANLDVALADVTGPDAR  60

Query  182  ESIVPAIQGIDAIIILTSAVPRMK----PG-----FDPSKGERPEFYFEDGLSPEQVDWI  334
             S+  A+ G DA+II TSA P++     PG        +K  +P F F  G +P  VD+ 
Sbjct  61   ASLETALGGADALIICTSAKPKLDFWSLPGVIFGKMMGNKDAKPRFSFPAGAAPRDVDYE  120

Query  335  GQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTI  514
            G + QI  AKAAGV H+VL+ SM GT P H LN +    I++WKR++E  L  SG+ YT+
Sbjct  121  GTRVQIAAAKAAGVSHVVLLSSMAGTLPEHFLN-VSMDKIVLWKRRAEMELIASGLEYTV  179

Query  515  IRAGGL-------QDKNGGERELLVGKDDELLQ  592
            I  GGL       +   GG+R L+VG DD L++
Sbjct  180  IHPGGLLPHYGQKEPAPGGQRALVVGVDDALME  212



>ref|WP_023070463.1| nad-dependent epimerase dehydratase [Leptolyngbya sp. Heron Island 
J]
 gb|ESA38866.1| nad-dependent epimerase dehydratase [Leptolyngbya sp. Heron Island 
J]
Length=220

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 100/186 (54%), Gaps = 20/186 (11%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPA  199
            VLV GA G+TG+ V ++L  +      R LVR + +KA      ++ +GD+   E++  A
Sbjct  3    VLVVGATGKTGRHVTEQLSTDGTGKTVRALVR-DRAKADFADTVEVVVGDVLKPETLQAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            + G DAII  T A P                   D   P QVD++G KN +D AKA G++
Sbjct  62   MTGCDAIICATGAAPSF-----------------DFTGPYQVDFVGTKNLVDVAKAEGIQ  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
              V+V S+  +   HPLN      +L WK+++E+Y+  SG+ YTI+R GGL+ ++ GE  
Sbjct  105  RFVIVSSLCVSKFFHPLNLFWL--VLFWKQQAEQYIVKSGLTYTIVRPGGLRSEDAGEAI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSAAD  168



>ref|WP_006519783.1| NmrA family protein [Leptolyngbya sp. PCC 7375]
 gb|EKU98640.1| NmrA family protein [Leptolyngbya sp. PCC 7375]
Length=217

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPA  199
            VLV GA G+TG+ +  +L   SD  + + +VR + SKA    A ++ +GD+   E++  A
Sbjct  3    VLVVGATGQTGRRITNQL-SGSDMAV-KAMVR-DRSKADFSEAVEVVVGDVLKPETLAVA  59

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I G DAII  T A P                   D   P QVD++G KN +D A  AGVK
Sbjct  60   IAGCDAIICATGAAPSF-----------------DMTGPYQVDFVGTKNLVDAATLAGVK  102

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
              V+V S+  +   HPLN      +L WK+++E Y+A SG+ YTI+R GGL++++ G+  
Sbjct  103  RFVMVSSLCVSKFFHPLNLFWL--VLYWKKQAETYIAKSGLTYTIVRPGGLRNEDSGDPI  160

Query  560  LLVGKD  577
            L+   D
Sbjct  161  LMASAD  166



>ref|WP_006456242.1| epimerase [Synechococcus sp. PCC 7335]
 gb|EDX86477.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Synechococcus 
sp. PCC 7335]
Length=219

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 104/186 (56%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
            LV G+ G+TG  + K L E   +   R LVR+ +++ + +    +  IGD+ + ES+  A
Sbjct  4    LVAGSTGKTGSHIVKLLLEKGIE--VRALVRNLDKANSVLPDTVEKVIGDVMSPESLTTA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            + G DA++  T A    +P FDP+              P +VD+ G KN +D AKAAG+ 
Sbjct  62   LAGCDALLSATGA----EPSFDPT-------------GPYKVDYEGNKNLVDAAKAAGID  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
              V+V S+  +   HPLN      IL WK+++E+YL  SGVPYTI+R GGL+D++  +  
Sbjct  105  QFVMVSSLCVSKIFHPLNLFWG--ILYWKQQAEDYLKVSGVPYTIVRPGGLKDEDNAQAI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSPAD  168



>ref|WP_028949158.1| epimerase [Synechocystis sp. PCC 6714]
 gb|AIE73675.1| hypothetical protein YCF39 [Synechocystis sp. PCC 6714]
Length=219

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 102/187 (55%), Gaps = 22/187 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESIVP  196
            VLV GA G TG+ V   L +   +   R LVR+ +S KA +    +I +GD+   E+I  
Sbjct  3    VLVIGATGETGKRVVNTLIDR--QIAVRALVRNYDSAKAALPPGTEIMVGDLLALETIKA  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI G   +I               + G RP     D   P +VD++G +N +D AKA+G+
Sbjct  61   AIAGCTVVI--------------NAAGARPS---ADLTGPFKVDYLGTRNLVDVAKASGI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            + +VLV S+  +N  HPLN  G   IL+WK+  E YL  SGVPYTI+R GGL++++    
Sbjct  104  EQLVLVSSLCVSNLFHPLNLFGL--ILVWKQWGENYLRQSGVPYTIVRPGGLKNEDNNNA  161

Query  557  ELLVGKD  577
             ++ G D
Sbjct  162  VVMAGAD  168



>ref|WP_010872727.1| epimerase [Synechocystis sp. PCC 6803]
 ref|NP_441422.1| hypothetical protein sll1218 [Synechocystis sp. PCC 6803]
 dbj|BAA18102.1| ycf39 [Synechocystis sp. PCC 6803]
 dbj|BAK50275.1| hypothetical protein SYNGTS_1527 [Synechocystis sp. PCC 6803]
 dbj|BAL29274.1| hypothetical protein SYNGTI_1527 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL32443.1| hypothetical protein SYNPCCN_1526 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL35612.1| hypothetical protein SYNPCCP_1526 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM51853.1| hypothetical protein BEST7613_2922 [Bacillus subtilis BEST7613]
 gb|AGF51790.1| YCF39 protein [Synechocystis sp. PCC 6803]
Length=219

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 103/188 (55%), Gaps = 24/188 (13%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYI-TRGLVRSEES-KARiggaddiyigdiRNAESIV  193
            VLV GA G TG+ V   L   +D+ I  R LVR+ +S KA +    +I +GD+   E+I 
Sbjct  3    VLVIGATGETGKRVVNTL---TDRQIAVRALVRNYDSAKAVLPPGTEIMVGDLLEPETIK  59

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
             AI G   +I               + G RP     D   P +VD++G +N +D AKA G
Sbjct  60   AAIAGCTVVI--------------NAAGARPS---ADLTGPFKVDYLGTRNLVDIAKANG  102

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            ++ +VLV S+  +N  HPLN  G   IL+WK+  E YL  SGVPYTI+R GGL++++   
Sbjct  103  IEQLVLVSSLCVSNLFHPLNLFGL--ILVWKQWGENYLRQSGVPYTIVRPGGLKNEDNDN  160

Query  554  RELLVGKD  577
              ++ G D
Sbjct  161  AIVMAGAD  168



>ref|WP_039713160.1| epimerase [Scytonema millei]
 gb|KIF20808.1| epimerase [Scytonema millei VB511283]
Length=220

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR  ES +A +    ++  GD+    ++  A
Sbjct  4    FVAGATGETGRRIVQQLVARNIP--VRALVRDLESARAILPNTAELVQGDVLQPSTLETA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    KPGFDP+             +P +VD+ G KN +D +KA G++
Sbjct  62   IADSTVVLCATGA----KPGFDPT-------------APYKVDYEGTKNLVDVSKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+G +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  ++ 
Sbjct  105  HFVLVSSVGASQLFHPLNLF--WLILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNADKI  162

Query  560  LLVGKD  577
            +L   D
Sbjct  163  VLYSPD  168



>ref|WP_010471494.1| epimerase [Acaryochloris sp. CCMEE 5410]
Length=218

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 103/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G+TG+ +  +L E       R LVR  + +KA +  A ++ +GD+ +A S+  A
Sbjct  4    FVAGATGQTGRRIVSQLVERGIP--VRALVRDIDRAKALLPEAAELVVGDVLDASSLESA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I   + ++  T A     PGF+P              +P Q+D++G KN +D AKA  ++
Sbjct  62   IADCNVLLCATGA----APGFNP-------------FAPLQIDYLGTKNLVDVAKAKNIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      +L+WK+++E+Y+ +SG+ YTI+R GGL++++     
Sbjct  105  HFVLVSSLCTSKLLHPLNLF--FLVLVWKKQAEQYIQNSGLTYTIVRPGGLKNEDNDNSV  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSAPD  168



>ref|WP_012164442.1| epimerase [Acaryochloris marina]
 gb|ABW29099.1| NAD dependent epimerase/dehydratase family protein [Acaryochloris 
marina MBIC11017]
Length=218

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 103/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G+TG+ +  +L E       R LVR  + +KA +  A ++ +GD+ +A S+  A
Sbjct  4    FVAGATGQTGRRIVSQLVERGIP--VRALVRDMDRAKALLPEAAELVVGDVLDASSLEDA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I   + ++  T A     PGF+P              +P Q+D++G KN +D AKA  ++
Sbjct  62   IADCNVLLCATGA----APGFNP-------------FAPLQIDYLGTKNLVDVAKAKNIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      +L+WK+++E+Y+ +SG+ YTI+R GGL++++     
Sbjct  105  HFVLVSSLCTSKLLHPLNLF--FLVLVWKKQAEQYIQNSGLTYTIVRPGGLKNEDNDNSV  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSAPD  168



>ref|WP_015156952.1| NAD-dependent epimerase/dehydratase [Chroococcidiopsis thermalis]
 gb|AFY90414.1| NAD-dependent epimerase/dehydratase [Chroococcidiopsis thermalis 
PCC 7203]
Length=220

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR+ +S +A +    ++  GD+    S+  A
Sbjct  4    FVAGATGETGRRIVQQLVARNIP--VRALVRNLDSARAILPNTAELVQGDVLQPSSLEAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    KPGFDP+             +P +VD+ G KN +D +KA G++
Sbjct  62   IADSTVVLCATGA----KPGFDPT-------------APYKVDYEGTKNLVDVSKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+G +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  ++ 
Sbjct  105  HFVLVSSVGASQFFHPLNLF--WLILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNADKI  162

Query  560  LLVGKD  577
             L   D
Sbjct  163  ELYSPD  168



>ref|WP_011143473.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_926430.1| hypothetical protein gll3484 [Gloeobacter violaceus PCC 7421]
 dbj|BAC91425.1| gll3484 [Gloeobacter violaceus PCC 7421]
Length=228

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 104/194 (54%), Gaps = 25/194 (13%)
 Frame = +2

Query  17   TVLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigd--iRNAESI  190
            ++LV GA G+TGQ + KKLR  S     R L RS  +KAR    D   + +  +   +S+
Sbjct  2    SILVVGATGQTGQQIVKKLRAQS--MAPRVLARSR-AKAREVFGDGTEVVEGDVLKTDSL  58

Query  191  VPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAA  370
             PA+ G++ I   T      + GF  +               +QVD+ G +N +  A+ A
Sbjct  59   GPALNGVETIFCATGT----RTGFGAN-------------GAQQVDYEGTRNLVYAARRA  101

Query  371  GVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGG  550
            GV  ++LV S+  +   HPLN  G   +L WK+++E+YL DSG+ +TI+R GGL+D  GG
Sbjct  102  GVGRLILVSSLCVSRLIHPLNLFGG--VLFWKKRAEDYLLDSGLNFTIVRPGGLRDGAGG  159

Query  551  ERELLVGKDDELLQ  592
              E++V   D L +
Sbjct  160  A-EIVVRPADTLFE  172



>ref|WP_024124178.1| NAD-dependent epimerase/dehydratase family protein [Thermosynechococcus 
sp. NK55a]
 gb|AHB87763.1| NAD-dependent epimerase/dehydratase family protein [Thermosynechococcus 
sp. NK55a]
Length=220

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 95/186 (51%), Gaps = 21/186 (11%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPA  199
            V V GA GRTGQ +   L+ +  + I   +VR+           +I   D+   +++ PA
Sbjct  3    VAVVGATGRTGQRIVSALQSSEHQAI--AVVRNPAKAQGRWPRVEIRTADVTQPQTLPPA  60

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            ++  +A+I  T A P + P                 L P  VD++G KN +D AKAA V+
Sbjct  61   LKDCEAVICATGASPSLNP-----------------LEPLSVDYLGTKNLVDAAKAAPVQ  103

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
              +LV S+  +   HPLN      IL WK+++E YL +SG+ YTI+R GGL++ + G   
Sbjct  104  QFILVSSLCVSQFFHPLNLFWL--ILYWKQQAERYLQESGLTYTIVRPGGLKETDEGGFP  161

Query  560  LLVGKD  577
            ++   D
Sbjct  162  IIAPAD  167



>ref|WP_017718373.1| epimerase [Oscillatoria sp. PCC 10802]
Length=219

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L +   +   R LVR+ E+ +A +    ++  GD+ + +S+  A
Sbjct  4    FVAGATGETGRRIVRELVKR--QIPVRALVRNLETGRAILPEEAELVTGDVLDRDSLSAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    +P FDP+              P QVD  G KN +D AKA GV+
Sbjct  62   LGDSTVLLCATGA----RPSFDPT-------------GPYQVDLEGTKNLVDVAKAKGVE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL +++ GE  
Sbjct  105  HFVLVSSLCVSQLFHPLNLFWL--ILLWKKQAEEYLQKSGLTYTIVRPGGLLNEDTGEPV  162

Query  560  LLVGKD  577
            ++ G D
Sbjct  163  VMSGAD  168



>ref|WP_039728337.1| MULTISPECIES: epimerase [Oscillatoriophycideae]
 gb|KIF16016.1| epimerase [Aphanocapsa montana BDHKU210001]
 gb|KIF40939.1| epimerase [Lyngbya confervoides BDU141951]
Length=220

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 5/108 (5%)
 Frame = +2

Query  269  SKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNG  448
            + G RP F   D   P QVD+ G KN ID AKA  ++H V+V S+  +   HPLN     
Sbjct  71   ATGARPSF---DPTGPYQVDYEGTKNLIDVAKAHNIEHFVMVSSLCVSRFFHPLNLFWL-  126

Query  449  NILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDELLQ  592
             +L WK+++E+YL  SGVPYTI+R GGL++ +  +R L++   D L +
Sbjct  127  -VLYWKQQAEDYLVKSGVPYTIVRPGGLKNDDTDDRPLIMAPADTLFE  173



>ref|WP_011432166.1| epimerase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01507.1| 3-beta hydroxysteroid dehydrogenase/isomerase family protein 
[Synechococcus sp. JA-2-3B'a(2-13)]
Length=219

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 99/201 (49%), Gaps = 45/201 (22%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV---  193
             V GA G TG+ + K+L         R LVRS E  AR+           R AE +V   
Sbjct  4    FVAGATGETGRRIVKELVGRDIP--VRALVRSHELAARVLP---------REAEVVVGDV  52

Query  194  --PA-----IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQI  352
              PA     ++G   ++  T A    +P +DP               P +VD+ G KN +
Sbjct  53   LDPATLETGMEGCTVVLCATGA----RPSWDP-------------FQPYRVDYEGTKNLV  95

Query  353  DTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGL  532
            D AKA G++H VL+ S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL
Sbjct  96   DVAKAKGIQHFVLISSLCVSQLFHPLNLFWL--ILVWKKRAEEYLQKSGLTYTIVRPGGL  153

Query  533  --QDKNGGERELLVGKDDELL  589
              QD + G   +++ K D L 
Sbjct  154  KNQDNDDG---IVLSKADTLF  171



>ref|WP_026072506.1| epimerase [Nodosilinea nodulosa]
Length=220

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 98/196 (50%), Gaps = 32/196 (16%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRG-----LVR-SEESKARiggaddiyigdiRNAE  184
             V GA G TG  +        D+ ++RG      VR +  ++A++     +  G + + E
Sbjct  4    FVAGATGATGSRIV-------DQLVSRGVPVVAFVRDAAAARAKLPIDVTLREGSVTDKE  56

Query  185  SIVPAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAK  364
            SI  A+     ++  T A    +PGFDP+              P QVD+ G KN +D AK
Sbjct  57   SIRRAMADCTVLLSATGA----RPGFDPT-------------GPYQVDYEGNKNLVDVAK  99

Query  365  AAGVKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
              G++H+V+V S+  +   HPLN      IL WK ++E YL  SG+ YTI+R GGL+D +
Sbjct  100  EVGIEHVVMVSSLCVSRFLHPLNLFFL--ILYWKHQAEAYLQASGLTYTIVRPGGLKDDD  157

Query  545  GGERELLVGKDDELLQ  592
               R L++   D L +
Sbjct  158  SDSRALIMAPADTLFE  173



>ref|WP_017289740.1| epimerase [Leptolyngbya boryana]
Length=219

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 97/188 (52%), Gaps = 26/188 (14%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYI-TRGLVRSEESKARiggaddiyigd--iRNAESIV  193
             V GA G TG+ + ++L    D+ I  R LVR  E KAR      + +    + N   +V
Sbjct  4    FVAGATGETGRRIVQQL---VDRGIPVRALVRDPE-KARSILPTGVELVKGDVLNKADLV  59

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
             AI     +   T A    KP FDP++             P +VD  G KN +D AKA G
Sbjct  60   GAIADSTVLFCATGA----KPSFDPTQ-------------PYKVDLEGTKNLVDAAKAKG  102

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            ++H V V S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +
Sbjct  103  IEHFVFVSSLCTSQFFHPLNLFWL--ILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNQD  160

Query  554  RELLVGKD  577
            R ++   D
Sbjct  161  RIIMSSAD  168



>ref|WP_015127276.1| NAD-dependent epimerase/dehydratase [Calothrix sp. PCC 7507]
 gb|AFY31454.1| NAD-dependent epimerase/dehydratase [Calothrix sp. PCC 7507]
Length=218

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVR-SEESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR +E ++  +    ++ +GD+ N ES+  A
Sbjct  4    FVAGATGETGRRIVQELIARNIP--VRALVRDTETARGILSPEAELVVGDVLNPESLTAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDSTVLLCATGA----KPSFDPT-------------GPYKVDFEGTKNLVDVAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++     
Sbjct  105  HFVLVSSLCTSQLFHPLNLFWL--ILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNSNPI  162

Query  560  LLVGKD  577
            ++ G D
Sbjct  163  VMQGAD  168



>ref|WP_017316059.1| epimerase [Mastigocladopsis repens]
Length=219

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
            LV GA G TG+ + ++LR  +     R LVR  E++++ +G   ++  GD+  +ES+  A
Sbjct  4    LVAGATGETGRRIVQELRARNIP--VRALVRDIEQARSILGADVELVTGDVLKSESLSAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDSTVLLCATGA----KPSFDPT-------------GPYKVDYEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL WK+++EEY+  SG+ YTI+R GGL++++     
Sbjct  105  HFVLVSSLATSQFFHPLNLF--WLILYWKKQAEEYIQKSGLNYTIVRPGGLKNEDNSNSI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSAD  168



>ref|WP_013324345.1| epimerase [Cyanothece sp. PCC 7822]
 gb|ADN16282.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7822]
Length=219

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 103/191 (54%), Gaps = 23/191 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V G+ G+TGQ + K+L   S     R LVR  E +K  +    ++ +GD+ N+E +  A
Sbjct  4    FVAGSTGQTGQRIVKELL--SRNIPVRALVRDLEPAKKILPPETELVVGDVLNSEGLKGA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P FDP+              P QVD++G KN +D AKA G++
Sbjct  62   IGNSTVLLCATGA----RPSFDPT-------------GPYQVDYLGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL WK+++E YL +SG+ YTI+R GGL +++  +  
Sbjct  105  HFVLVTSLCVSQFFHPLNLF--WLILYWKKQAEIYLTNSGLTYTIVRPGGLNNEDNRD-S  161

Query  560  LLVGKDDELLQ  592
            L++   D L +
Sbjct  162  LVMSSADTLFE  172



>emb|CCA30158.1| NAD-dependent epimerase/dehydratase, related [Neospora caninum 
Liverpool]
Length=814

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 12/105 (11%)
 Frame = +2

Query  305  GLSPEQVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGN-----------GN  451
            G  P ++DW+GQKN +D AK + V H+VL   MGGT+PNH LN LG            G+
Sbjct  606  GGYPREIDWLGQKNIVDAAKESSVMHVVLCSIMGGTDPNHHLNHLGKQRSKIRRGESGGD  665

Query  452  ILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERELLVGKDDEL  586
            IL+WKR+SE YL  SG+ YT++  GGL D   G   L+VG +D L
Sbjct  666  ILLWKRRSERYLVKSGLSYTVVHPGGLSD-TPGRLALVVGVNDAL  709



>emb|CCH68282.1| expressed protein [Richelia intracellularis HH01]
Length=220

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 100/175 (57%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G+TG+++ ++LR  +     R L+R+ +++K       ++   D+ N +S+  A
Sbjct  5    FVAGATGQTGRLIVQELRRRNIP--VRALLRNIKKTKTTWPDGVELVEADLLNYKSLSTA  62

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +   D+ IIL ++  R  P F+P+              P +VD+ G KN +D AK  G+K
Sbjct  63   LG--DSTIILCASGAR--PNFNPT-------------GPYKVDYEGTKNLVDMAKVGGIK  105

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +   HPLN      +L+WK+++E+Y+  SG+ YTIIR GGL+DK+
Sbjct  106  HFVLVSSLCVSQLFHPLNLFWL--VLLWKKQAEKYIQKSGLNYTIIRPGGLKDKD  158



>ref|WP_027842548.1| epimerase [Mastigocoleus testarum]
Length=219

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 104/191 (54%), Gaps = 23/191 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR  E++K  +  + ++   D+  +++ V +
Sbjct  4    FVAGATGETGRRIVRELVARNIP--VRALVRDIEQAKTILPESTELIQADVLKSDTFVSS  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            ++G   ++  T A    +P  DPS              P +VD+ G KN ++ AK+ G++
Sbjct  62   LEGCTVLLCATGA----RPSLDPS-------------GPYKVDYEGTKNLVNAAKSQGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV SM  +   HPLN      IL WK+++EEY+  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVLVSSMCVSQFFHPLNLFWL--ILYWKKQAEEYIQKSGLTYTIVRPGGLKNEDNSD-S  161

Query  560  LLVGKDDELLQ  592
            +++ K D L +
Sbjct  162  IVMAKADTLFE  172



>ref|WP_044304998.1| epimerase [Richelia intracellularis]
Length=219

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 100/175 (57%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G+TG+++ ++LR  +     R L+R+ +++K       ++   D+ N +S+  A
Sbjct  4    FVAGATGQTGRLIVQELRRRNIP--VRALLRNIKKTKTTWPDGVELVEADLLNYKSLSTA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +   D+ IIL ++  R  P F+P+              P +VD+ G KN +D AK  G+K
Sbjct  62   LG--DSTIILCASGAR--PNFNPT-------------GPYKVDYEGTKNLVDMAKVGGIK  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +   HPLN      +L+WK+++E+Y+  SG+ YTIIR GGL+DK+
Sbjct  105  HFVLVSSLCVSQLFHPLNLFWL--VLLWKKQAEKYIQKSGLNYTIIRPGGLKDKD  157



>ref|WP_022604720.1| NmrA-like family [Rubidibacter lacunae]
 gb|ERN42588.1| NmrA-like family [Rubidibacter lacunae KORDI 51-2]
Length=219

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 100/191 (52%), Gaps = 23/191 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARig-gaddiyigdiRNAESIVP  196
            V+V GA G TG+ + ++L E      TR LVR  ++  RI   A ++ + D+ +A  +  
Sbjct  3    VVVAGATGGTGREIVRELIERGIP--TRALVRDRDAAKRILPAAVELVVVDVLDAAGVRE  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI G   ++  T A P + P                 L P QVD+ G +N +D AKA  +
Sbjct  61   AIAGSTVLLCATGARPSLNP-----------------LGPLQVDYWGTRNLVDAAKACDI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H  +V S+  +   HPLN      +L WKR++E+YL DSGV YTI+R GGL++ +  + 
Sbjct  104  EHFAIVSSLCVSQFFHPLNLFWL--VLFWKRQAEQYLVDSGVSYTIVRPGGLKNDDNSD-  160

Query  557  ELLVGKDDELL  589
             L++   D L 
Sbjct  161  PLVMSSADSLF  171



>ref|WP_013192267.1| epimerase [Trichormus azollae]
 gb|ADI65253.1| NAD-dependent epimerase/dehydratase ['Nostoc azollae' 0708]
Length=227

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 102/187 (55%), Gaps = 22/187 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVR-SEESKARiggaddiyigdiRNAESIVP  196
            + V GA G TG+ + ++L   + K   R LVR S  +KA +    ++ IGD+  AES+  
Sbjct  3    IFVAGATGETGRRIVQELVARNIK--VRALVRDSATAKAILSPEVELVIGDVLQAESLTA  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
             +     +I  T A    KP FDP+             +P +VD+ G KN ++ A+   V
Sbjct  61   VLGDSTVVICATGA----KPSFDPT-------------APYKVDFEGTKNLVEAARTKQV  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H +LV S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  + 
Sbjct  104  EHFILVSSLCVSQFFHPLNLFWL--ILVWKKQAEEYIEKSGLTYTIVRPGGLKNEDNSDA  161

Query  557  ELLVGKD  577
             ++ G D
Sbjct  162  VVMEGAD  168



>ref|WP_015174595.1| NAD-dependent epimerase/dehydratase [Oscillatoria nigro-viridis]
 gb|AFZ05265.1| NAD-dependent epimerase/dehydratase [Oscillatoria nigro-viridis 
PCC 7112]
Length=219

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G+TG+ +  +L +       R LVR+ ++  +I   +   +  D+ NA S+  A
Sbjct  4    FVAGATGQTGRRIVAELVKRGIP--VRALVRNLDTARQILPPEAELVTGDVLNATSLGNA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A P    GFDP+             +P +VD+ G KN +D AKA G++
Sbjct  62   IGDSTVLLCATGAAP----GFDPT-------------APYKVDFEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVLVTSLCVSQFFHPLNLFWL--ILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNSDAI  162

Query  560  LLVGKD  577
            ++ G D
Sbjct  163  VMTGAD  168



>ref|WP_035987612.1| epimerase [Leptolyngbya sp. KIOST-1]
Length=220

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (52%), Gaps = 22/191 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVR-SEESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG  + K+L       +    VR +  +++++     +  GD+ + +SI  A
Sbjct  4    FVAGATGATGSKIVKQLVSRGVPVV--AFVRNAAAARSQLPPEVTLAEGDVTDKDSIRRA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            + G   ++  T A    +PGFDP+             +P QVD+ G KN +D AK  G++
Sbjct  62   MAGCTVLLSATGA----RPGFDPT-------------APYQVDFEGTKNLVDVAKEIGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H+V+V S+  +   HPLN      IL WK ++E YL  SG+ YTI+R GGL++ +   R 
Sbjct  105  HVVMVSSLCVSRFFHPLNLFFL--ILYWKHQAEAYLQASGLTYTIVRPGGLKEDDTDGRA  162

Query  560  LLVGKDDELLQ  592
            L++   D L +
Sbjct  163  LIMAPADTLFE  173



>ref|WP_035155764.1| epimerase [Calothrix sp. 336/3]
 gb|KFB84985.1| epimerase [Calothrix sp. 336/3]
Length=219

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 95/187 (51%), Gaps = 24/187 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigd--iRNAESIVP  196
             V GA G TG+ + ++L   +     R +VR  E +AR        +    + N ESI  
Sbjct  4    FVAGATGETGRRIVQELI--ARDIPVRAMVRDIE-RARNILPQAAELVQGDVLNRESIAS  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI     +I  T A    KP F+P++             P QVD  G KN +D AK  G+
Sbjct  61   AISDCTVLICATGA----KPSFNPTE-------------PYQVDLEGTKNLVDIAKNKGI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H VLV S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  + 
Sbjct  104  EHFVLVSSLCVSQFFHPLNLFWL--ILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNSDS  161

Query  557  ELLVGKD  577
             ++   D
Sbjct  162  VIMQSAD  168



>ref|WP_007355363.1| MULTISPECIES: epimerase [Kamptonema]
 emb|CBN56150.1| NmrA-like [ [[Oscillatoria] sp. PCC 6506]
Length=219

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G+TG+ + ++L + +     R LVR+ E ++  +    ++  GD+ NA S+   
Sbjct  4    FVAGATGQTGRRIVEELVKRNIP--VRALVRNLETAREILPPEAELVTGDVLNAASLAEL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    KP FDP+              P +VD+ G KN +D AK  G++
Sbjct  62   IGDCTVLLCATGA----KPSFDPT-------------GPYKVDYEGTKNLVDAAKIKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +N  HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVLVTSLCVSNFFHPLNLFWL--ILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNTDAI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMESAD  168



>ref|WP_026723160.1| epimerase [Fischerella sp. PCC 9431]
Length=219

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 106/186 (57%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR  E++++ + G  ++  GD+ + +S+V A
Sbjct  4    FVAGATGETGRRIVQEL--TARNIPVRALVRDVEKARSILPGEVELVKGDVLDQQSLVTA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +   D+ ++L++     KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LG--DSTVVLSAT--GAKPSFDPT-------------GPYKVDYEGNKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V+V S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVMVSSLAASQLFHPLNLF--WLILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNTDSI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQNAD  168



>ref|WP_016859245.1| epimerase [Fischerella muscicola]
Length=219

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 102/187 (55%), Gaps = 24/187 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARigg--addiyigdiRNAESIVP  196
             V GA G TG+ + ++L   +     R LVR  E KAR       ++  GD+ N +S+  
Sbjct  4    FVAGATGETGRRIIQEL--TARNIPVRALVRDVE-KARTILPGEVELVEGDVLNQQSLAN  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+   D+ +IL++     KP FDP+              P +VD+ G KN +D AKA G+
Sbjct  61   ALG--DSTVILSAT--GAKPSFDPT-------------GPYKVDYEGNKNLVDAAKAKGI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H V+V S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  + 
Sbjct  104  EHFVMVSSLAASQFFHPLNLF--WLILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNTDS  161

Query  557  ELLVGKD  577
             ++   D
Sbjct  162  IVMQNAD  168



>ref|WP_011430008.1| epimerase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99327.1| 3-beta hydroxysteroid dehydrogenase/isomerase family protein 
[Synechococcus sp. JA-3-3Ab]
Length=219

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 101/191 (53%), Gaps = 23/191 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ + ++L         R LVRS E  AR+   +   +  D+ +  ++   
Sbjct  4    FVAGATGETGRRIVQELVGRGIP--VRALVRSRELAARVLPPEAEVVVGDVLDPATLEAG  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            ++G   ++  T A    +P +DP               P +VD+ G KN +D AKA G++
Sbjct  62   MEGCTVVLCATGA----RPSWDP-------------FLPYRVDYQGTKNLVDVAKAKGIQ  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VL+ S+  +   HPLN      IL+WK+++EEYL  SG+ YTIIR GGL++++  E  
Sbjct  105  HFVLISSLCVSQLFHPLNLFWL--ILVWKKQAEEYLQKSGLTYTIIRPGGLKNQD-NEDG  161

Query  560  LLVGKDDELLQ  592
            +++ K D L +
Sbjct  162  VVLSKADTLFE  172



>ref|WP_016874231.1| epimerase [Chlorogloeopsis fritschii]
Length=219

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 100/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   S     R LVR  +++++ +    ++  GD+ + +S+  A
Sbjct  4    FVAGATGETGRRIVEELIARSIP--VRALVRDIQKARSILPAEVELVQGDVLDRQSLTAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDCTVLLCATGA----KPSFDPT-------------GPYKVDYEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++     
Sbjct  105  HFVLVSSLAASQFFHPLNLF--WLILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNSNHI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSAD  168



>gb|AFM92601.1| NAD dependent epimerase/dehydratase family protein [Acaryochloris 
sp. HICR111A]
Length=218

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 100/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G+TG+ +  +L E       R LVR  + +KA +  A ++ +GD+ N  ++  A
Sbjct  4    FVAGATGQTGRRIVAQLVERGIP--VRALVRDIDRAKAILPEAAELVVGDVLNVSTLEAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A     PGF+P              +P Q+D++G KN +D AK   ++
Sbjct  62   IADCTVLLCATGA----APGFNP-------------FAPLQIDYLGTKNLVDVAKTKNIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      +L+WK+++E+Y+ +SG+ YTI+R GGL++++     
Sbjct  105  HFVLVSSLCTSKLLHPLNLFFL--VLVWKKQAEQYIQNSGLTYTIVRPGGLKNEDNDNSV  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSAPD  168



>ref|WP_009634592.1| NmrA-like family protein [Synechocystis sp. PCC 7509]
Length=219

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 99/186 (53%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ +  +L E +     R +VR  E+++A +  +  + +GD+   E++  A
Sbjct  4    FVAGATGETGRRIVNQLVERNIP--VRAMVRDLEQARAILPESAQLVVGDVLKPETLSEA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     I+  T A    KP FDP+             SP +VD+ G KN +D AK  G++
Sbjct  62   IGDSTVILCATGA----KPSFDPT-------------SPYKVDYEGTKNLVDVAKTKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V V S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++     
Sbjct  105  HFVFVSSLCTSKLFHPLNLFWL--ILVWKKQAEEYIQKSGLVYTIVRPGGLKNEDNNSSI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSSVD  168



>ref|WP_012406916.1| epimerase [Nostoc punctiforme]
 gb|ACC78887.1| NmrA family protein [Nostoc punctiforme PCC 73102]
Length=219

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 97/175 (55%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR  E++K  +    ++ +GD+   ESI  A
Sbjct  4    FVAGATGETGRRIVQELIARNIP--VRALVRDIEKAKGILSPEAELVVGDVLQPESITAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     +++ T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDSTVLLVATGA----KPSFDPT-------------GPYKVDFEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++
Sbjct  105  HFVLVSSLCTSQFFHPLNLF--WLILVWKKQAEEYIQKSGLTYTIVRPGGLKNED  157



>ref|WP_041034656.1| epimerase [Tolypothrix campylonemoides]
 gb|KIJ77217.1| epimerase [Tolypothrix campylonemoides VB511288]
Length=219

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 99/186 (53%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
            LV GA G TG+ + ++L   +     R LVR  +++++ +    ++  GD+   ESI  A
Sbjct  4    LVAGATGETGRRIVQELIARNIP--VRALVRDVQQARSILPQDAELVQGDVLKPESITAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDSTVLLCATGA----KPSFDPT-------------GPYKVDYEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V V S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++     
Sbjct  105  HFVFVSSLAASQLFHPLNLF--WLILVWKKQAEEYLQKSGLNYTIVRPGGLKNEDNSNSI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSAD  168



>ref|WP_006633149.1| epimerase [Microcoleus vaginatus]
 gb|EGK87594.1| NAD-dependent epimerase/dehydratase [Microcoleus vaginatus FGP-2]
Length=219

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 100/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G+TG+ +  +L +       R LVR+ ++  +I   +   +  D+ NA S+  A
Sbjct  4    FVAGATGQTGRRIVAELVKRGIP--VRALVRNLDTARQILPPEAELVTGDVLNATSLGDA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A P    GFDP+             +P +VD  G KN +D AKA G++
Sbjct  62   IGDSTVLLCATGAAP----GFDPT-------------APYKVDLEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVLVTSLCVSQFFHPLNLFWL--ILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNSDAI  162

Query  560  LLVGKD  577
            ++ G D
Sbjct  163  VMTGAD  168



>ref|WP_015164803.1| NAD-dependent epimerase/dehydratase [Pseudanabaena sp. PCC 7367]
 gb|AFY69834.1| NAD-dependent epimerase/dehydratase [Pseudanabaena sp. PCC 7367]
Length=219

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 26/180 (14%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYIT-RGLVRSEES-KARiggaddiyigdiRNAESIVP  196
            LV GA G TG  + K+L    D+ I+ R LVR E++ K  +    ++  GD+   E++  
Sbjct  4    LVAGATGGTGSRIVKEL---VDRNISVRALVRDEKTAKELLPPEAELVFGDVLQPETLEK  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI+G D ++  T A    +P F+P+              P  VD++G KN I+ AKA G+
Sbjct  61   AIEGCDVLLSATGA----RPSFNPT-------------GPLMVDYVGTKNLINVAKAKGI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQ--DKNGG  550
               V+V SM  +   HPLN      +L WK+++E Y+  SGVPYTI+R GGL+  +K GG
Sbjct  104  NQFVMVSSMCVSKFFHPLNLFWL--VLYWKKQAEGYVQQSGVPYTIVRPGGLRNDEKPGG  161



>ref|WP_015213145.1| NAD-dependent epimerase/dehydratase [Anabaena cylindrica]
 gb|AFZ56493.1| NAD-dependent epimerase/dehydratase [Anabaena cylindrica PCC 
7122]
Length=221

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 101/187 (54%), Gaps = 22/187 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEE-SKARiggaddiyigdiRNAESIVP  196
            V V GA G TG+ + ++L   S K   R LVR E+ +KA +    ++++GD+    ++  
Sbjct  3    VFVAGATGETGRRIVQELV--SKKIPVRALVRDEDKAKAILSPEVELFVGDVLQPATLTA  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+     II  T A    KP FDP+              P +VD+ G KN +D AK   +
Sbjct  61   ALGDSTVIICATGA----KPSFDPT-------------GPYKVDFEGTKNLVDIAKTKQI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H +LV S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  + 
Sbjct  104  EHFILVSSLCVSQFFHPLNLFWL--ILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNSDV  161

Query  557  ELLVGKD  577
             ++   D
Sbjct  162  IIMQSAD  168



>ref|WP_008180003.1| epimerase [Moorea producens]
 gb|EGJ34561.1| NAD dependent epimerase/dehydratase family protein [Moorea producens 
3L]
Length=219

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 105/187 (56%), Gaps = 24/187 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKL--RENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
             V GA G TG+ + ++L  R+   + + R L  ++E+   +  A ++ +GD+   ESI  
Sbjct  4    CVAGATGETGKRIVQELVLRDIPVRALVRNLEYAQET---LPPAAELVVGDVLKPESIRA  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            AI   D+ ++L ++    +P FDP+             +P +VD+ G KN +D AK  GV
Sbjct  61   AIA--DSTVVLCAS--EARPSFDPT-------------APYKVDYEGTKNLVDGAKEKGV  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H VLV S+      HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  E 
Sbjct  104  EHFVLVSSLCVPQFFHPLNLFWL--ILVWKKQAEEYIQKSGLTYTIVRPGGLRNEDNSEP  161

Query  557  ELLVGKD  577
             ++ G D
Sbjct  162  MVMSGAD  168



>ref|WP_039742689.1| epimerase [Hassallia byssoidea]
 gb|KIF35514.1| epimerase [Hassallia byssoidea VB512170]
Length=219

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 97/175 (55%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVR-SEESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR +E++K  +    ++ +GD+   ES+  A
Sbjct  4    FVAGATGETGRRIVQELI--AKNIPVRALVRDAEKAKGILPPDVELVVGDVLTPESLTTA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +DTAKA G++
Sbjct  62   LGDSTVVLCATGA----KPSFDPT-------------GPYKVDFEGTKNLVDTAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H V V S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++
Sbjct  105  HFVFVSSLCTSKLFHPLNLF--WLILVWKKQAEEYIQKSGLTYTIVRPGGLKNED  157



>ref|WP_011243331.1| MULTISPECIES: epimerase [Synechococcus]
 dbj|BAD79209.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB56533.1| Nucleoside-diphosphate-sugar epimerases-like [Synechococcus elongatus 
PCC 7942]
 gb|AJD56425.1| epimerase [Synechococcus sp. UTEX 2973]
Length=216

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 94/187 (50%), Gaps = 21/187 (11%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVPA  199
            VLV GA GRTG+ V +     +  +  R LVRS   +  +    ++ +GD+ +  S+  A
Sbjct  3    VLVVGATGRTGRCVVET--AIAAGHSVRALVRSANPQPPLPEGVELVVGDLSDRASLEAA  60

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            + G+DA+I    A P + P                 L P +VD++G    ID A AAG++
Sbjct  61   LAGMDAVISAAGATPNLDP-----------------LGPFKVDYLGTTQLIDLAGAAGIQ  103

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
              VLV S+  +   HPLN      +L WKR++E YL  SG+ YTI+R GGL+        
Sbjct  104  RFVLVSSLCVSRLLHPLNLFWL--VLFWKRRAERYLQSSGLSYTIVRPGGLRSDRTRVPL  161

Query  560  LLVGKDD  580
             L G D+
Sbjct  162  KLTGPDE  168



>ref|XP_006290196.1| hypothetical protein CARUB_v10003881mg [Capsella rubella]
 gb|EOA23094.1| hypothetical protein CARUB_v10003881mg [Capsella rubella]
Length=111

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  320  QVDWIGQKNQIDTAKAAGVKHIVLVGSMGGTNPNHPLNTLGNGNIL  457
            +VDWIGQKNQID AK AGVKHIVLVGSMGGTN +HPLN LGNGNIL
Sbjct  27   EVDWIGQKNQIDAAKVAGVKHIVLVGSMGGTNQDHPLNKLGNGNIL  72



>ref|WP_017312818.1| epimerase [Fischerella sp. PCC 9339]
Length=219

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 105/186 (56%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR  E++++ + G  ++  GD+ + +S+  A
Sbjct  4    FVAGATGETGRRIVQEL--TTRNIPVRALVRDVEKARSILPGEVELVEGDVLDQQSLATA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +   D+ +IL++     KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LG--DSTVILSAT--GAKPSFDPT-------------GPYKVDYEGNKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V+V S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVMVSSLAASQFFHPLNLF--WLILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNTDAI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQNAD  168



>ref|WP_016517309.1| NAD(P)H azoreductase [Microcystis aeruginosa]
 gb|EPF16068.1| NAD(P)H azoreductase [Microcystis aeruginosa SPC777]
Length=219

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 93/175 (53%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVRS E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRSPEKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++ +
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNDD  157



>ref|WP_009555297.1| NmrA family protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ70723.1| NmrA family protein [Oscillatoriales cyanobacterium JSC-12]
Length=222

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 103/193 (53%), Gaps = 24/193 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L     +   R LVR+ E +++ +    ++ +GD+ N  S+  A
Sbjct  4    FVAGATGETGKRIVQELVNR--QIPVRALVRNLETARSILPPQAELVVGDVLNRASLEAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +PGFDP+             +P +VD+ G KN ID AK   +K
Sbjct  62   IADCTVVLCATGA----RPGFDPT-------------APYRVDYEGTKNLIDVAKTKAIK  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE--  553
            H VLV S+  +   HPLN      IL+WK+++E+YL  SG+ YTI+R GGL+  +  E  
Sbjct  105  HFVLVTSLCVSQFFHPLNLF--FLILVWKKQAEDYLQKSGLIYTIVRPGGLKSVDVPEPP  162

Query  554  RELLVGKDDELLQ  592
              +++ + D L +
Sbjct  163  VNVVMAQADTLFE  175



>ref|WP_015194269.1| NAD-dependent epimerase/dehydratase [Stanieria cyanosphaera]
 gb|AFZ36604.1| NAD-dependent epimerase/dehydratase [Stanieria cyanosphaera PCC 
7437]
Length=219

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
            LV GA G+TG+ + K+L E +     + LVR+ E+   I   +   +  D+   ESI  A
Sbjct  4    LVVGATGQTGRAIVKQLTEKN--IAVKALVRNLETAQEILPPETELVVGDVLKPESIERA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +   + ++  T A    KP  +P+              P Q+D++G KN ++ AK  G++
Sbjct  62   LTDCNVLLCATGA----KPSLNPT-------------GPYQIDYLGTKNLVNAAKNKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V+V S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  ++ 
Sbjct  105  HFVIVSSLCVSKFFHPLNLFWL--ILVWKKQAEEYIQASGLTYTIVRPGGLKNEDNLDQI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSSAD  168



>ref|WP_002783143.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI12780.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=219

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 94/175 (54%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNREKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNED  157



>ref|WP_015203644.1| NAD-dependent epimerase/dehydratase [Crinalium epipsammum]
 gb|AFZ13530.1| NAD-dependent epimerase/dehydratase [Crinalium epipsammum PCC 
9333]
Length=218

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 100/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L +   +   R  VR+ E ++  +    ++  GD+ + +S+  A
Sbjct  4    FVAGATGETGRRIVQELVKR--QIPVRAFVRNLETAREILPPEAELVTGDLFSVDSLKSA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    KP FDP+             +P +VD+ G KN +D AKA G++
Sbjct  62   IADSTVLLCATGA----KPSFDPT-------------NPYKVDYEGTKNLVDAAKATGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V V S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVFVSSLCTSKLFHPLNLFWL--ILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNSDSV  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSSAD  168



>ref|WP_002803673.1| epimerase [Microcystis aeruginosa]
 emb|CCI37970.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=219

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 94/175 (54%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNPEKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNED  157



>ref|WP_002771890.1| epimerase [Microcystis aeruginosa]
 emb|CCI04844.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=219

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 94/175 (54%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNPEKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNED  157



>ref|WP_015146515.1| putative nucleoside-diphosphate sugar epimerase [Oscillatoria 
acuminata]
 gb|AFY79865.1| putative nucleoside-diphosphate sugar epimerase [Oscillatoria 
acuminata PCC 6304]
Length=219

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 104/190 (55%), Gaps = 23/190 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G+TG+ + ++L +   +   R LVR+ E+ +  +    ++ +GD+ N ES+  A
Sbjct  4    FVAGATGQTGRRIVEELVKR--EIPVRALVRNLEKGQQLLPPQVELVVGDVLNPESLNEA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A     P FDP+              P ++D+ G K+ +D AK  G++
Sbjct  62   IADCTVVLCATGA----TPSFDPT-------------GPYRIDYEGTKHLVDVAKVKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +N  HPLN      IL+WKR++E+Y+ +SG+ YTI+R GGL++    E  
Sbjct  105  HFVLVSSLCVSNLFHPLNLFWL--ILVWKRQAEKYIQNSGLAYTIVRPGGLKNTE-DEAA  161

Query  560  LLVGKDDELL  589
            +++   D+L 
Sbjct  162  IVMKSQDQLF  171



>ref|WP_002740403.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO90648.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS50110.1| hypothetical protein C789_35 [Microcystis aeruginosa DIANCHI905]
Length=219

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 94/175 (54%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNPEKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNED  157



>ref|WP_036530800.1| epimerase [Neosynechococcus sphagnicola]
 gb|KGF73822.1| epimerase [Neosynechococcus sphagnicola sy1]
Length=219

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 101/191 (53%), Gaps = 23/191 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
            LV GA G TG+ + + L +   +   R LVR    ++  +    ++ +G++ + +S+  A
Sbjct  4    LVAGATGETGRRIVQVLVQR--QIPVRALVRDLAPAQTILPPEAELVVGNVLDPKSLAAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    +P FDP+              P  VD+ G KN +D AK AG+ 
Sbjct  62   LTDCTVLLCATGA----RPSFDPT-------------GPYLVDYEGTKNLVDAAKTAGIV  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V V S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++     
Sbjct  105  HFVFVSSLCVSQLFHPLNLFWL--ILVWKKQAEEYLQKSGLAYTIVRPGGLKNEDSS-LP  161

Query  560  LLVGKDDELLQ  592
            L++G+ D L +
Sbjct  162  LVIGQADTLFE  172



>gb|KIJ81213.1| epimerase [Scytonema tolypothrichoides VB-61278]
Length=219

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
            LV GA G TG+ + ++L   +     R LVR  E++++ +G   ++ +GD+   ES+  A
Sbjct  4    LVAGATGETGRRIVQELIARNIP--VRALVRDVEKARSILGADAELVVGDVLRPESLSAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDSTVLLCATGA----KPSFDPT-------------GPYKVDYEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H VLV S+  +   HPLN      IL WK+++EEY+  SG+ YTI+R GGL++++   + 
Sbjct  105  HFVLVSSLAASQFFHPLNLF--WLILYWKKQAEEYIQKSGLNYTIVRPGGLKNEDNSNQI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSAD  168



>ref|WP_024969194.1| epimerase [Microcystis aeruginosa]
Length=219

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 94/175 (54%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNPEKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNED  157



>ref|WP_029632779.1| epimerase [[Scytonema hofmanni] UTEX B 1581]
Length=219

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVR-SEESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR +E++ A +    ++ +GD+   ES+  A
Sbjct  4    FVAGATGETGRRIVQELI--AKNIPVRALVRDAEKAIAILPPDVELVVGDVLTPESLSTA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +   D+ I+L +     KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LG--DSTIVLCAT--GAKPSFDPT-------------GPYKVDFEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V V S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++   R 
Sbjct  105  HFVFVSSLCTSKLFHPLNLFWL--ILVWKKQAEEYIQKSGLIYTIVRPGGLKNEDNSNRI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSAD  168



>ref|WP_010996904.1| epimerase [Nostoc sp. PCC 7120]
 dbj|BAB74450.1| alr2751 [Nostoc sp. PCC 7120]
Length=218

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEES-KARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR E++ +A +    ++ +GD+ N  S+  A
Sbjct  4    FVAGATGETGRRIVQELIARNIP--VRALVRDEQTARAILPPDAELVVGDVLNPASLTAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDSTVVLCATGA----KPSFDPT-------------GPYKVDFEGTKNLVDVAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            + VLV S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +  
Sbjct  105  NFVLVTSLCVSQFFHPLNLFWL--ILVWKKQAEEYLQKSGLTYTIVRPGGLKNEDNSDAI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSSD  168



>ref|WP_002792219.1| epimerase [Microcystis aeruginosa]
 emb|CCI21698.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=219

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 93/175 (53%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNREKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++ +
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNDD  157



>ref|WP_004158116.1| epimerase [Microcystis aeruginosa]
 emb|CCH94879.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
Length=219

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 93/175 (53%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNREKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++ +
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNDD  157



>ref|WP_009344660.1| epimerase [Raphidiopsis brookii]
 gb|EFA71584.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Raphidiopsis brookii 
D9]
Length=208

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 97/187 (52%), Gaps = 24/187 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyigd--iRNAESIVP  196
             V GA G+TGQ + ++L   S     R LVR E+ KAR      + +    I   ES++ 
Sbjct  4    FVAGATGQTGQRIVEELV--SRNIPVRALVRDEQ-KARNLLPSQVELIVGDILQPESLIA  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+     ++  T A    +P FDP+              P QVD+ G KN +  A+   +
Sbjct  61   ALGDSTVVLCATGA----RPSFDPT-------------GPYQVDFQGTKNLVKAAQDRKI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H VLV S+  +   HPLN      IL+WK+++EE++  SG+ YTI+R GGL++ +  ++
Sbjct  104  QHFVLVSSLCVSQLFHPLNLFWL--ILVWKKQAEEFIRKSGISYTIVRPGGLKNDDNSDQ  161

Query  557  ELLVGKD  577
             ++ G D
Sbjct  162  VIMQGPD  168



>ref|WP_002775498.1| epimerase [Microcystis aeruginosa]
 emb|CCI05972.1| conserved hypothetical protein [Microcystis aeruginosa PCC 7941]
Length=219

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 92/173 (53%), Gaps = 22/173 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNREKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQD  538
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKN  155



>ref|WP_008201892.1| epimerase [Microcystis sp. T1-4]
 emb|CCI32562.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=219

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 93/175 (53%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNREKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E YL +SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEAYLINSGLTYTIVRPGGLKNED  157



>ref|WP_012265515.1| epimerase [Microcystis aeruginosa]
 dbj|BAG02179.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Microcystis aeruginosa 
NIES-843]
Length=219

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 92/173 (53%), Gaps = 22/173 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNPEKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQD  538
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKN  155



>ref|WP_037222078.1| epimerase [Richelia intracellularis]
 emb|CDN14768.1| expressed protein [Richelia intracellularis]
Length=219

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 99/186 (53%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++LR  +     R LVR  +++K+ +    ++   D+ N +S+  A
Sbjct  4    FVAGATGETGRRIVQELR--AKNIPVRALVRDIQKAKSILPDEVELVEADVLNYQSLNTA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     I+  T A    KP FDPS              P +VD+ G KN +D AK  G++
Sbjct  62   LGDSTVILCATGA----KPSFDPS-------------GPYKVDYEGTKNLVDLAKTRGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
              VLV S+  +   HPLN      +L+WK+++EEY+  SG+ YTI+R GGL++++  +  
Sbjct  105  QFVLVSSLCVSQLFHPLNLFWL--VLVWKKQAEEYIQKSGLSYTIVRPGGLKNEDNSDPV  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSAD  168



>ref|WP_002761432.1| epimerase [Microcystis aeruginosa]
 emb|CCH98415.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=219

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 93/175 (53%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNREKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL  SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLIKSGLTYTIVRPGGLKNED  157



>ref|WP_002734230.1| hypothetical protein [Microcystis aeruginosa]
 gb|ELP56928.1| hypothetical protein O53_1540 [Microcystis aeruginosa TAIHU98]
Length=219

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 93/175 (53%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNPEKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E+YL +SG+ YTI+R GGL++ +
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEDYLINSGLTYTIVRPGGLKNDD  157



>dbj|GAL93244.1| expressed protein [Microcystis aeruginosa NIES-44]
Length=219

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 93/175 (53%), Gaps = 22/175 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRSEESKARiggaddiyig-diRNAESIVPA  199
             V GA G TG+ +  +L E   +   R LVR+ E  A I  A    +  D++ A+ +   
Sbjct  4    FVAGATGETGRRIVAQLVER--QIPVRALVRNREKAAEILPAGVEIVVGDVQQADKLEAL  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     ++  T A    +P F+P++             P  VD++G KN ID AK  G++
Sbjct  62   IADCSVLLCATGA----RPSFNPTE-------------PLLVDYLGTKNLIDAAKKKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKN  544
            H VLV S+  +N  HPLN      IL WK+++E YL +SG+ YTI+R GGL++++
Sbjct  105  HFVLVTSLCVSNFFHPLNLF--WLILFWKKQAEAYLINSGLTYTIVRPGGLKNED  157



>ref|WP_015185335.1| NmrA-like family protein [Microcoleus sp. PCC 7113]
 gb|AFZ21202.1| NmrA-like family protein [Microcoleus sp. PCC 7113]
Length=219

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 100/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L + +     R LVR+ E +K  +    ++ +GD+   ES+  A
Sbjct  4    FVAGATGETGRRIVQELVKRNIP--VRALVRNLETAKEILPPQAELIVGDVLKPESLSAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            I     I+  T A    KP  DP+              P +VD+ G KN +D AK+ G++
Sbjct  62   IADCTVILSATGA----KPSLDPT-------------GPYKVDYEGTKNLVDVAKSKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V+V S+  +   HPLN      IL+WK+++EEYL  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVMVSSLCVSQLFHPLNLFWL--ILVWKKQAEEYLTQSGLTYTIVRPGGLKNEDNPDPV  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMSSAD  168



>ref|WP_026785392.1| MULTISPECIES: epimerase [Planktothrix]
Length=220

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 101/192 (53%), Gaps = 25/192 (13%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKL--RENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIVP  196
             V GA G TG+ +  +L  RE   K + R +   E ++  +    ++ +GD+ N +S+  
Sbjct  4    FVAGATGETGRRIITELVKREIPVKALVRNI---ETAQQILPTEVELVVGDVLNTDSLAS  60

Query  197  AIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGV  376
            A+   D  ++L +             G RP F   D   P QVD  G KN +D AK+ G+
Sbjct  61   ALS--DCTVVLCAT------------GARPSF---DFTGPYQVDCQGTKNLVDVAKSQGI  103

Query  377  KHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGER  556
            +H VLV S+  +   HPLN      IL WK+++EEYL +SG+ YTI+R GGL++++    
Sbjct  104  EHFVLVTSLCVSQFFHPLNLFWL--ILFWKKQAEEYLQNSGLNYTIVRPGGLKNEDNN-Y  160

Query  557  ELLVGKDDELLQ  592
             L++   D L +
Sbjct  161  NLVMQSADTLFE  172



>ref|WP_040940046.1| epimerase [Prochloron didemni]
Length=220

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 95/189 (50%), Gaps = 23/189 (12%)
 Frame = +2

Query  20   VLVTGAGGRTGQIVYKKL--RENSDKYITRGLVRSEESKARiggaddiyigdiRNAESIV  193
            V V GA G+TG+ +  +L  R  S + + R L + +E          +     R+  S+ 
Sbjct  3    VFVAGATGQTGRRIVAELVQRNLSVRALVRNLEQGQEILPGRSVELVVGDVLKRS--SLQ  60

Query  194  PAIQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAG  373
             AI    A+I  T A     P FD +              P QVD+ G KN +D AKA G
Sbjct  61   EAIADCTALICATGA----SPSFDFA-------------GPYQVDYQGTKNLVDAAKAKG  103

Query  374  VKHIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGE  553
            ++H VLV S+  +   HPLN      +L WK+++E+YL  SG+ YTI+R GGL++++  +
Sbjct  104  IEHFVLVSSLCVSQFFHPLNLF--WLVLYWKKQAEQYLQGSGLKYTIVRPGGLKNEDNPD  161

Query  554  RELLVGKDD  580
              L+ G D 
Sbjct  162  PILMKGADS  170



>ref|WP_006197655.1| epimerase [Nodularia spumigena]
 gb|EAW44200.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Nodularia spumigena 
CCY9414]
 gb|AHJ30753.1| hypothetical protein NSP_44560 [Nodularia spumigena CCY9414]
Length=219

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  23   LVTGAGGRTGQIVYKKLRENSDKYITRGLVRS-EESKARiggaddiyigdiRNAESIVPA  199
             V GA G TG+ + ++L   +     R LVR  E+++A +    ++ +GD+  A+S+  A
Sbjct  4    FVAGATGETGRRIVQELIARNIP--VRALVRDVEKARAILPPDVELVLGDVLEAQSLNAA  61

Query  200  IQGIDAIIILTSAVPRMKPGFDPSKGERPEFYFEDGLSPEQVDWIGQKNQIDTAKAAGVK  379
            +     ++  T A    KP FDP+              P +VD+ G KN +D AKA G++
Sbjct  62   LGDSTVLLCATGA----KPSFDPT-------------GPYKVDFEGTKNLVDAAKAKGIE  104

Query  380  HIVLVGSMGGTNPNHPLNTLGNGNILIWKRKSEEYLADSGVPYTIIRAGGLQDKNGGERE  559
            H V V S+  +   HPLN      IL+WK+++EEY+  SG+ YTI+R GGL++++  +  
Sbjct  105  HFVFVSSLCVSQLFHPLNLFWL--ILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNSDAI  162

Query  560  LLVGKD  577
            ++   D
Sbjct  163  VMQSAD  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940