BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018D09 608 bp,:Filtered

Length=587
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763164.1|  PREDICTED: uncharacterized protein LOC104215116  99.8    1e-23   Nicotiana sylvestris
ref|XP_008345060.1|  PREDICTED: uncharacterized protein LOC103407964  99.4    2e-23   Malus domestica [apple tree]
gb|EYU36681.1|  hypothetical protein MIMGU_mgv1a017543mg              98.2    6e-23   Erythranthe guttata [common monkey flower]
ref|XP_003569142.1|  PREDICTED: uncharacterized protein LOC100838997  97.8    7e-23   Brachypodium distachyon [annual false brome]
ref|XP_006371513.1|  hypothetical protein POPTR_0019s12640g           98.2    8e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009622576.1|  PREDICTED: uncharacterized protein LOC104113957  97.8    8e-23   Nicotiana tomentosiformis
ref|XP_006350700.1|  PREDICTED: uncharacterized protein LOC102598957  97.4    1e-22   Solanum tuberosum [potatoes]
ref|XP_004241003.1|  PREDICTED: uncharacterized protein LOC101247433  97.1    1e-22   Solanum lycopersicum
ref|XP_007033727.1|  Uncharacterized protein TCM_019853               97.1    2e-22   Theobroma cacao [chocolate]
ref|XP_006371514.1|  hypothetical protein POPTR_0019s12660g           97.4    2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007212340.1|  hypothetical protein PRUPE_ppa014467mg           96.3    3e-22   Prunus persica
ref|XP_008244362.1|  PREDICTED: uncharacterized protein LOC103342505  95.9    5e-22   Prunus mume [ume]
ref|XP_011073978.1|  PREDICTED: uncharacterized protein LOC105158803  95.5    5e-22   Sesamum indicum [beniseed]
ref|XP_009403291.1|  PREDICTED: uncharacterized protein LOC103986877  95.1    8e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABC41690.1|  unknown                                               95.1    1e-21   Musa acuminata [banana]
ref|XP_006442160.1|  hypothetical protein CICLE_v10023247mg           92.4    7e-21   Citrus clementina
gb|EMS64794.1|  hypothetical protein TRIUR3_12008                     95.1    8e-21   Triticum urartu
ref|XP_008800738.1|  PREDICTED: uncharacterized protein LOC103715013  92.4    1e-20   
ref|XP_010101371.1|  hypothetical protein L484_020386                 93.2    2e-20   Morus notabilis
ref|XP_010672441.1|  PREDICTED: uncharacterized protein LOC104889013  90.5    4e-20   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003625112.1|  hypothetical protein MTR_7g091060                90.5    6e-20   
ref|XP_011467158.1|  PREDICTED: uncharacterized protein LOC101315450  90.1    6e-20   Fragaria vesca subsp. vesca
gb|KGN51660.1|  hypothetical protein Csa_5G589280                     89.7    7e-20   Cucumis sativus [cucumbers]
ref|XP_002881931.1|  hypothetical protein ARALYDRAFT_903781           89.7    8e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_008446026.1|  PREDICTED: uncharacterized protein LOC103488878  89.7    8e-20   
ref|XP_004500007.1|  PREDICTED: uncharacterized protein LOC101511132  89.7    9e-20   Cicer arietinum [garbanzo]
gb|AFK39184.1|  unknown                                               89.4    1e-19   Medicago truncatula
gb|ACG24737.1|  hypothetical protein                                  89.0    2e-19   Zea mays [maize]
gb|EEE53594.1|  hypothetical protein OsJ_36841                        89.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010025143.1|  PREDICTED: uncharacterized protein LOC104415519  88.6    2e-19   Eucalyptus grandis [rose gum]
gb|EAY96212.1|  hypothetical protein OsI_18101                        88.2    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004493466.1|  PREDICTED: uncharacterized protein LOC101497044  88.6    3e-19   
ref|XP_006295375.1|  hypothetical protein CARUB_v10024467mg           88.2    3e-19   Capsella rubella
gb|KHG00051.1|  Cytochrome oxidase assembly 3, mitochondrial          88.2    3e-19   Gossypium arboreum [tree cotton]
gb|KCW61744.1|  hypothetical protein EUGRSUZ_H04449                   90.9    4e-19   Eucalyptus grandis [rose gum]
ref|XP_006371510.1|  hypothetical protein POPTR_0019s12610g           88.6    4e-19   Populus trichocarpa [western balsam poplar]
gb|EMT30105.1|  hypothetical protein F775_07022                       88.2    6e-19   Aegilops tauschii
ref|XP_002535277.1|  conserved hypothetical protein                   87.4    6e-19   Ricinus communis
ref|NP_181906.1|  uncharacterized protein                             87.4    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960595.1|  PREDICTED: uncharacterized protein LOC101765916  87.0    8e-19   
ref|XP_002440101.1|  hypothetical protein SORBIDRAFT_09g026050        87.0    1e-18   Sorghum bicolor [broomcorn]
gb|EAY83864.1|  hypothetical protein OsI_39086                        89.4    1e-18   Oryza sativa Indica Group [Indian rice]
gb|KJB71629.1|  hypothetical protein B456_011G134700                  86.7    1e-18   Gossypium raimondii
ref|NP_001067254.1|  Os12g0611700                                     86.7    1e-18   
ref|NP_001054398.2|  Os05g0103800                                     89.4    2e-18   
ref|XP_003552731.1|  PREDICTED: uncharacterized protein LOC100500217  86.3    2e-18   Glycine max [soybeans]
gb|ABA99375.1|  expressed protein                                     88.2    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AFK39872.1|  unknown                                               85.1    5e-18   Lotus japonicus
ref|XP_007139144.1|  hypothetical protein PHAVU_008G005000g           84.7    7e-18   Phaseolus vulgaris [French bean]
ref|XP_003532337.1|  PREDICTED: uncharacterized protein LOC100811894  84.7    7e-18   Glycine max [soybeans]
gb|EMS64218.1|  hypothetical protein TRIUR3_13515                     84.3    3e-17   Triticum urartu
ref|XP_009142962.1|  PREDICTED: uncharacterized protein LOC103866740  82.8    4e-17   Brassica rapa
ref|XP_006397549.1|  hypothetical protein EUTSA_v10001711mg           82.8    4e-17   Eutrema salsugineum
ref|XP_004985334.1|  PREDICTED: uncharacterized protein LOC101758110  82.0    7e-17   
ref|XP_006858783.1|  hypothetical protein AMTR_s00066p00158830        86.3    8e-17   
emb|CDY44255.1|  BnaC03g24470D                                        82.4    9e-17   Brassica napus [oilseed rape]
ref|XP_009133634.1|  PREDICTED: uncharacterized protein LOC103858094  80.9    2e-16   Brassica rapa
gb|EPS62010.1|  hypothetical protein M569_12784                       79.7    5e-16   Genlisea aurea
ref|XP_010431000.1|  PREDICTED: uncharacterized protein LOC104715279  85.9    5e-16   Camelina sativa [gold-of-pleasure]
gb|EMT31212.1|  hypothetical protein F775_26572                       79.0    9e-16   Aegilops tauschii
gb|KHN40935.1|  hypothetical protein glysoja_046166                   78.6    1e-15   Glycine soja [wild soybean]
emb|CDY17912.1|  BnaC04g03070D                                        82.8    3e-15   Brassica napus [oilseed rape]
emb|CDX79802.1|  BnaA05g03540D                                        81.6    7e-15   Brassica napus [oilseed rape]
gb|EMS62869.1|  hypothetical protein TRIUR3_15614                     75.9    9e-14   Triticum urartu
emb|CAN67579.1|  hypothetical protein VITISV_022628                   73.2    1e-13   Vitis vinifera
gb|ABK25362.1|  unknown                                               73.2    1e-13   Picea sitchensis
gb|KHN48830.1|  hypothetical protein glysoja_030600                   73.2    1e-13   Glycine soja [wild soybean]
gb|ABK25618.1|  unknown                                               72.0    4e-13   Picea sitchensis
gb|AFW78824.1|  hypothetical protein ZEAMMB73_450786                  67.8    1e-11   Zea mays [maize]
gb|ACG38832.1|  hypothetical protein                                  66.6    2e-11   Zea mays [maize]
gb|KHN45780.1|  hypothetical protein glysoja_042528                   64.3    1e-10   Glycine soja [wild soybean]



>ref|XP_009763164.1| PREDICTED: uncharacterized protein LOC104215116 [Nicotiana sylvestris]
Length=68

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M  F  +  LAPKTKNLV+AGGLS FVFGVY+YTMRAVGG+DELQ+AIDKF++ K N ++
Sbjct  1    MAGFPGYGALAPKTKNLVMAGGLSAFVFGVYYYTMRAVGGSDELQVAIDKFEEAKHNSES  60

Query  341  KASLASNT  364
            +ASLA  +
Sbjct  61   EASLAPKS  68



>ref|XP_008345060.1| PREDICTED: uncharacterized protein LOC103407964 [Malus domestica]
 ref|XP_009345201.1| PREDICTED: uncharacterized protein LOC103937019 [Pyrus x bretschneideri]
Length=68

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M   + F  LAPKTKN +VAGGLS FVFGVYFYTMRAVGGTDELQ+AI+KF++EK  K+ 
Sbjct  1    MAGMSGFRSLAPKTKNAIVAGGLSAFVFGVYFYTMRAVGGTDELQVAINKFEEEKGQKEA  60

Query  341  KASLAS  358
            +ASL+S
Sbjct  61   EASLSS  66



>gb|EYU36681.1| hypothetical protein MIMGU_mgv1a017543mg [Erythranthe guttata]
 gb|EYU36682.1| hypothetical protein MIMGU_mgv1a017543mg [Erythranthe guttata]
Length=68

 Score = 98.2 bits (243),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     F  LAPKTKNLVVAGGL+GFVFGVYFYTMRAVGGTDELQIAIDKF+ +K   + 
Sbjct  1    MSGLIGFRSLAPKTKNLVVAGGLTGFVFGVYFYTMRAVGGTDELQIAIDKFEDQKHTTEP  60

Query  341  KASLA  355
            +A+LA
Sbjct  61   EATLA  65



>ref|XP_003569142.1| PREDICTED: uncharacterized protein LOC100838997 [Brachypodium 
distachyon]
Length=70

 Score = 97.8 bits (242),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F  LAPKTKNLVVAGGL+GFVFGVY+YTMRAVGGTDELQ+AIDKF+  K+ KDT AS A+
Sbjct  4    FRALAPKTKNLVVAGGLTGFVFGVYYYTMRAVGGTDELQVAIDKFEDLKK-KDTAASAAT  62

Query  359  NT  364
            N+
Sbjct  63   NS  64



>ref|XP_006371513.1| hypothetical protein POPTR_0019s12640g, partial [Populus trichocarpa]
 gb|ERP49310.1| hypothetical protein POPTR_0019s12640g, partial [Populus trichocarpa]
Length=77

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F+ LAPKTKNLVVAGGLS FVFGVYFYTMRAVGGTDELQ AIDKF+Q+K  ++++A++ S
Sbjct  16   FSSLAPKTKNLVVAGGLSAFVFGVYFYTMRAVGGTDELQTAIDKFEQQKSKEESEATIPS  75



>ref|XP_009622576.1| PREDICTED: uncharacterized protein LOC104113957 [Nicotiana tomentosiformis]
Length=68

 Score = 97.8 bits (242),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M  F  +  LAPKTKNLV+AGGLS FVFGVY+YTMRAVGG+DELQ+AIDKF++ K N ++
Sbjct  1    MAGFPGYGTLAPKTKNLVMAGGLSAFVFGVYYYTMRAVGGSDELQVAIDKFEEAKHNSES  60

Query  341  KASLA  355
            +A+LA
Sbjct  61   EANLA  65



>ref|XP_006350700.1| PREDICTED: uncharacterized protein LOC102598957 [Solanum tuberosum]
Length=68

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M  F  ++ LAPKTKNLV+AGGL+GFVFGVY+YTMRAVGG+DELQ+AIDKF+  K++ + 
Sbjct  1    MAGFPGYSALAPKTKNLVMAGGLTGFVFGVYYYTMRAVGGSDELQVAIDKFEDAKRSSEA  60

Query  341  KASLA  355
            +ASLA
Sbjct  61   EASLA  65



>ref|XP_004241003.1| PREDICTED: uncharacterized protein LOC101247433 [Solanum lycopersicum]
Length=68

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     ++ LAPKTKNLV+AGGL+GFVFGVY+YTMRAVGG+DELQ+AIDKF+  K++ D 
Sbjct  1    MAGLPGYSALAPKTKNLVMAGGLTGFVFGVYYYTMRAVGGSDELQVAIDKFEDAKRSSDA  60

Query  341  KASLA  355
            +ASLA
Sbjct  61   EASLA  65



>ref|XP_007033727.1| Uncharacterized protein TCM_019853 [Theobroma cacao]
 gb|EOY04653.1| Uncharacterized protein TCM_019853 [Theobroma cacao]
Length=67

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     +N LAPKTKNLVVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF++ K+ ++ 
Sbjct  1    MAGLLGYNSLAPKTKNLVVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKFEEHKK-QEA  59

Query  341  KASLAS  358
            +AS+AS
Sbjct  60   RASMAS  65



>ref|XP_006371514.1| hypothetical protein POPTR_0019s12660g, partial [Populus trichocarpa]
 gb|ERP49311.1| hypothetical protein POPTR_0019s12660g, partial [Populus trichocarpa]
Length=94

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F+ LAPKTKNLVVAGGLS FVFGVYFYTMRAVGGTDELQ AIDKF+Q+K  ++++A++ S
Sbjct  33   FSSLAPKTKNLVVAGGLSAFVFGVYFYTMRAVGGTDELQTAIDKFEQQKSKEESEATIPS  92



>ref|XP_007212340.1| hypothetical protein PRUPE_ppa014467mg [Prunus persica]
 gb|EMJ13539.1| hypothetical protein PRUPE_ppa014467mg [Prunus persica]
Length=68

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M   + +  LAPKTKN +VAGGLS FVFGVYFYTMRAVGGTDELQ+AI+KF++EK  K+ 
Sbjct  1    MSGISGYRSLAPKTKNAIVAGGLSAFVFGVYFYTMRAVGGTDELQVAINKFEEEKGQKEA  60

Query  341  KASLASNT  364
            +AS+ S  
Sbjct  61   EASMPSEA  68



>ref|XP_008244362.1| PREDICTED: uncharacterized protein LOC103342505 [Prunus mume]
Length=68

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M   + +  LAPKTKN +VAGGLS FVFGVYFYTMRAVGGTDELQ+AI+KF++EK  K+ 
Sbjct  1    MSGISGYRSLAPKTKNAIVAGGLSAFVFGVYFYTMRAVGGTDELQVAINKFEEEKGQKEA  60

Query  341  KASLAS  358
            +AS+ S
Sbjct  61   EASMPS  66



>ref|XP_011073978.1| PREDICTED: uncharacterized protein LOC105158803 [Sesamum indicum]
 ref|XP_011073979.1| PREDICTED: uncharacterized protein LOC105158803 [Sesamum indicum]
Length=68

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLA  355
            +  LAPKTKNL+VAGGLS FVFGVYFYTMRAVGGTDELQ+AIDKF++ K+  + +A+LA
Sbjct  7    YRALAPKTKNLIVAGGLSAFVFGVYFYTMRAVGGTDELQVAIDKFEEHKRRNEEEATLA  65



>ref|XP_009403291.1| PREDICTED: uncharacterized protein LOC103986877 [Musa acuminata 
subsp. malaccensis]
Length=65

 Score = 95.1 bits (235),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTK  343
             T F  LAPKTKNL+VAGGLSGFV GVY+YTMRAVGGTDELQ+AIDKF+Q K  K+ +
Sbjct  1    MTRFGSLAPKTKNLIVAGGLSGFVLGVYYYTMRAVGGTDELQVAIDKFEQAKNKKEAE  58



>gb|ABC41690.1| unknown [Musa acuminata]
Length=77

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKAS  349
             T F  LAPKTKNL+VAGGLSGFV GVY+YTMRAVGGT+ELQ+AIDKF+Q K  K+ + +
Sbjct  1    MTRFGSLAPKTKNLIVAGGLSGFVLGVYYYTMRAVGGTNELQVAIDKFEQAKNKKEAETT  60

Query  350  LASNT*YHC  376
             ++ + Y C
Sbjct  61   SSAGS-YSC  68



>ref|XP_006442160.1| hypothetical protein CICLE_v10023247mg [Citrus clementina]
 ref|XP_006492783.1| PREDICTED: uncharacterized protein LOC102626571 [Citrus sinensis]
 gb|ESR55400.1| hypothetical protein CICLE_v10023247mg [Citrus clementina]
 gb|KDO40656.1| hypothetical protein CISIN_1g035465mg [Citrus sinensis]
Length=60

 Score = 92.4 bits (228),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     FN LAP+TKNLVVAGGL+ FVFGVY+YTMRAVGGTDELQ AIDKF+++K  +D+
Sbjct  1    MAGLAGFNTLAPRTKNLVVAGGLTAFVFGVYYYTMRAVGGTDELQAAIDKFEEQKNKQDS  60



>gb|EMS64794.1| hypothetical protein TRIUR3_12008 [Triticum urartu]
Length=155

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = +2

Query  110  RGWTPETGQKHNSDSCKMVV-FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTD  286
            R W  E G+ + + S ++      F  LAPKTKNLVV GGL+GFVFGVY+YTMRAVG TD
Sbjct  65   RPWLIEQGEGNRTGSAELPEQMVGFGSLAPKTKNLVVGGGLTGFVFGVYYYTMRAVGSTD  124

Query  287  ELQIAIDKFKQEKQNKDTKASLASN  361
            ELQ+AIDKF+  K+ KD  A+ A+N
Sbjct  125  ELQVAIDKFEDLKK-KDADATPAAN  148



>ref|XP_008800738.1| PREDICTED: uncharacterized protein LOC103715013 [Phoenix dactylifera]
Length=69

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     F+ LAPKTKNL+VAGGLSGFV GVY+YTMRAVG TDELQ+AIDKF +E +NKD 
Sbjct  1    MSSIKGFSSLAPKTKNLIVAGGLSGFVLGVYYYTMRAVGNTDELQVAIDKF-EEMKNKDE  59

Query  341  KASLAS  358
              + AS
Sbjct  60   AETAAS  65



>ref|XP_010101371.1| hypothetical protein L484_020386 [Morus notabilis]
 gb|EXB88318.1| hypothetical protein L484_020386 [Morus notabilis]
Length=127

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKAS  349
            F  LAPKTKNLVVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF+ +K  KD ++S
Sbjct  5    FRSLAPKTKNLVVAGGLTAFVFGVYFYTMRAVGGTDELQMAIDKFEAQKGKKDAESS  61



>ref|XP_010672441.1| PREDICTED: uncharacterized protein LOC104889013 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672442.1| PREDICTED: uncharacterized protein LOC104889013 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672443.1| PREDICTED: uncharacterized protein LOC104889013 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672444.1| PREDICTED: uncharacterized protein LOC104889013 [Beta vulgaris 
subsp. vulgaris]
Length=63

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKAS  349
            F  LAP+TKN++VAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF+++K + + KA+
Sbjct  7    FGALAPRTKNVIVAGGLTTFVFGVYFYTMRAVGGTDELQVAIDKFEEKKHHDEAKAN  63



>ref|XP_003625112.1| hypothetical protein MTR_7g091060 [Medicago truncatula]
Length=78

 Score = 90.5 bits (223),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  155  CKMVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNK  334
             KM     ++ LAPKTKN +VAGGL+ FVFG YFYTMRAVGGTDELQ+AIDKF+ +K  K
Sbjct  9    TKMAGVLGYSGLAPKTKNFIVAGGLTTFVFGAYFYTMRAVGGTDELQVAIDKFEADKSTK  68

Query  335  DTKASLAS  358
            + ++S+ S
Sbjct  69   EGESSIPS  76



>ref|XP_011467158.1| PREDICTED: uncharacterized protein LOC101315450 [Fragaria vesca 
subsp. vesca]
Length=68

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     F+  APKTKN++VAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF+ +K  K  
Sbjct  1    MAGIPGFSSFAPKTKNVIVAGGLTSFVFGVYFYTMRAVGGTDELQVAIDKFEGDKVQKQA  60

Query  341  KASLASNT  364
            + S+ S  
Sbjct  61   EGSMPSKV  68



>gb|KGN51660.1| hypothetical protein Csa_5G589280 [Cucumis sativus]
Length=62

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     F+ L PKTKN+VVAGGL+ FVFGVYFYTMRAVGG+DELQ+AID+F+ +K+NK++
Sbjct  1    MAGLLGFSGLGPKTKNIVVAGGLTAFVFGVYFYTMRAVGGSDELQVAIDQFESQKRNKES  60



>ref|XP_002881931.1| hypothetical protein ARALYDRAFT_903781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58190.1| hypothetical protein ARALYDRAFT_903781 [Arabidopsis lyrata subsp. 
lyrata]
Length=67

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ-NKD  337
            M  F  F+ L PK+KN VVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF+ +KQ   D
Sbjct  1    MAGFPGFSYLGPKSKNTVVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKFEGQKQVETD  60

Query  338  TKA  346
            TKA
Sbjct  61   TKA  63



>ref|XP_008446026.1| PREDICTED: uncharacterized protein LOC103488878 [Cucumis melo]
Length=62

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     ++ L PKTKN+VVAGGL+ FVFGVYFYTMRAVGG+DELQ+AIDKF+ +K NK++
Sbjct  1    MAGLLGYSGLGPKTKNIVVAGGLTAFVFGVYFYTMRAVGGSDELQVAIDKFEAQKSNKES  60



>ref|XP_004500007.1| PREDICTED: uncharacterized protein LOC101511132 [Cicer arietinum]
Length=68

 Score = 89.7 bits (221),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            +  LAPKTKN +VAGGL+ FVFG YFYTMRAVGGTDELQ+AIDKF+ +K  K+  AS+ S
Sbjct  7    YRSLAPKTKNFIVAGGLTTFVFGAYFYTMRAVGGTDELQVAIDKFEADKSTKEGDASIPS  66



>gb|AFK39184.1| unknown [Medicago truncatula]
 gb|AES81330.2| transmembrane protein, putative [Medicago truncatula]
Length=68

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            ++ LAPKTKN +VAGGL+ FVFG YFYTMRAVGGTDELQ+AIDKF+ +K  K+ ++S+ S
Sbjct  7    YSGLAPKTKNFIVAGGLTTFVFGAYFYTMRAVGGTDELQVAIDKFEADKSTKEGESSIPS  66



>gb|ACG24737.1| hypothetical protein [Zea mays]
 gb|ACG31491.1| hypothetical protein [Zea mays]
 gb|AFW82523.1| hypothetical protein ZEAMMB73_957297 [Zea mays]
 gb|AFW82524.1| hypothetical protein ZEAMMB73_957297 [Zea mays]
 gb|AFW82527.1| hypothetical protein ZEAMMB73_368802 [Zea mays]
Length=67

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F  LAPKT+NLVVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF++ K+    + S +S
Sbjct  4    FRSLAPKTRNLVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEETKKQDAARNSSSS  63



>gb|EEE53594.1| hypothetical protein OsJ_36841 [Oryza sativa Japonica Group]
Length=84

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +2

Query  125  ETGQKHNSDSCKMVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAI  304
            E+     S+ CK+ +   F  LAPKTKN+VVAGGLS FV GVY+YTMRAVGGTDELQ+AI
Sbjct  7    ESSGSFCSNRCKLKM-AGFGSLAPKTKNIVVAGGLSAFVLGVYYYTMRAVGGTDELQVAI  65

Query  305  DKFKQEKQNKDTKASLASNT  364
            DKF+  K+ KD   S A+ +
Sbjct  66   DKFEGMKK-KDAGNSSAAGS  84



>ref|XP_010025143.1| PREDICTED: uncharacterized protein LOC104415519 [Eucalyptus grandis]
Length=60

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  TAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNK  334
            +A+  LAPKTKNLVVAGGL+ FVFGVYFYTMRAVGG+DELQ AIDKF+++K  +
Sbjct  5    SAYRSLAPKTKNLVVAGGLTAFVFGVYFYTMRAVGGSDELQTAIDKFEEQKSKQ  58



>gb|EAY96212.1| hypothetical protein OsI_18101 [Oryza sativa Indica Group]
 gb|EEE62011.1| hypothetical protein OsJ_16793 [Oryza sativa Japonica Group]
Length=64

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F  LAPKTKN VVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF+  K+N    +S A 
Sbjct  4    FGSLAPKTKNFVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEDMKKNDAGNSSTAG  63

Query  359  N  361
            +
Sbjct  64   S  64



>ref|XP_004493466.1| PREDICTED: uncharacterized protein LOC101497044 [Cicer arietinum]
Length=68

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASL  352
            +  LAPKTKN +VAGGL+ FVFG YFYTMRAVGGTDELQ+AIDKF+ +K  K+  AS+
Sbjct  7    YRSLAPKTKNFIVAGGLTTFVFGAYFYTMRAVGGTDELQVAIDKFEADKSTKEGDASI  64



>ref|XP_006295375.1| hypothetical protein CARUB_v10024467mg [Capsella rubella]
 ref|XP_006295376.1| hypothetical protein CARUB_v10024467mg [Capsella rubella]
 gb|EOA28273.1| hypothetical protein CARUB_v10024467mg [Capsella rubella]
 gb|EOA28274.1| hypothetical protein CARUB_v10024467mg [Capsella rubella]
Length=67

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ  328
            M  F  F+ L PK+KN+VVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF+ +KQ
Sbjct  1    MAGFPGFSHLGPKSKNVVVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKFEGQKQ  56



>gb|KHG00051.1| Cytochrome oxidase assembly 3, mitochondrial [Gossypium arboreum]
Length=60

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  AFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNK  334
            A+  LAPKTKN+VVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF++ K+ +
Sbjct  6    AYGSLAPKTKNMVVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKFEELKKQE  58



>gb|KCW61744.1| hypothetical protein EUGRSUZ_H04449, partial [Eucalyptus grandis]
Length=171

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  152  SCKMVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQN  331
            S +M   +A+  LAPKTKNLVVAGGL+ FVFGVYFYTMRAVGG+DELQ AIDKF+++K  
Sbjct  109  SHEMAGPSAYRSLAPKTKNLVVAGGLTAFVFGVYFYTMRAVGGSDELQTAIDKFEEQKSK  168

Query  332  K  334
            +
Sbjct  169  Q  169



>ref|XP_006371510.1| hypothetical protein POPTR_0019s12610g, partial [Populus trichocarpa]
 gb|ERP49307.1| hypothetical protein POPTR_0019s12610g, partial [Populus trichocarpa]
Length=92

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F+ LAPKT+NLVVAGGLS FVFGVYF TMRAVGGT+ELQ AI KF+Q+K  ++++A++ S
Sbjct  31   FSSLAPKTRNLVVAGGLSAFVFGVYFNTMRAVGGTNELQTAIHKFEQQKSKQESEATIPS  90



>gb|EMT30105.1| hypothetical protein F775_07022 [Aegilops tauschii]
Length=92

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F  LAPKTKNLVV GGL+GFVFGVY+YTMRAVG TDELQ+AIDKF  E   KD  A+  +
Sbjct  27   FGSLAPKTKNLVVGGGLTGFVFGVYYYTMRAVGSTDELQVAIDKF--EDLKKDAAATPTA  84

Query  359  N  361
            N
Sbjct  85   N  85



>ref|XP_002535277.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27106.1| conserved hypothetical protein [Ricinus communis]
Length=60

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  173  TAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKD  337
            + +  LAPKTKNL+VAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDK++ +K  ++
Sbjct  5    SGYRNLAPKTKNLIVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKYEGQKSKQE  59



>ref|NP_181906.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001154575.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK60291.1|AF385698_1 At2g43780/F18O19.11 [Arabidopsis thaliana]
 gb|AAB64028.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL77717.1| At2g43780/F18O19.11 [Arabidopsis thaliana]
 gb|AAM64430.1| unknown [Arabidopsis thaliana]
 gb|AEC10323.1| uncharacterized protein AT2G43780 [Arabidopsis thaliana]
 gb|AEC10324.1| uncharacterized protein AT2G43780 [Arabidopsis thaliana]
Length=67

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ-NKD  337
            M  F  F+ L PK KN VVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF+ +KQ + D
Sbjct  1    MAGFPGFSYLGPKGKNTVVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKFEGQKQVDTD  60

Query  338  TK  343
            TK
Sbjct  61   TK  62



>ref|XP_004960595.1| PREDICTED: uncharacterized protein LOC101765916 [Setaria italica]
Length=64

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ  328
            F  LAPKT+NLVVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF++ K+
Sbjct  4    FRSLAPKTRNLVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEEMKK  53



>ref|XP_002440101.1| hypothetical protein SORBIDRAFT_09g026050 [Sorghum bicolor]
 gb|EES18531.1| hypothetical protein SORBIDRAFT_09g026050 [Sorghum bicolor]
Length=65

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKAS  349
               F  LAPKT+NLVVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF++ K+    + S
Sbjct  1    MAGFRSLAPKTRNLVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEEMKKKDAARNS  60



>gb|EAY83864.1| hypothetical protein OsI_39086 [Oryza sativa Indica Group]
Length=160

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  146  SDSCKMVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEK  325
            S+ CK+ +   F  LAPKTKN+VVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF+  K
Sbjct  90   SNRCKLKM-AGFGSLAPKTKNIVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEGMK  148

Query  326  QNKDTKASLASNT  364
            + KD   S A+ +
Sbjct  149  K-KDAGNSSAAGS  160



>gb|KJB71629.1| hypothetical protein B456_011G134700 [Gossypium raimondii]
Length=61

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  167  VFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNK  334
            +F  +  LAPKTKN+VVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDK ++ K+ +
Sbjct  4    LFAYYGSLAPKTKNMVVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKLEELKKQE  59



>ref|NP_001067254.1| Os12g0611700 [Oryza sativa Japonica Group]
 dbj|BAF30273.1| Os12g0611700 [Oryza sativa Japonica Group]
Length=64

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKAS  349
               F  LAPKTKN+VVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF+  K+ KD   S
Sbjct  1    MAGFGSLAPKTKNIVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEGMKK-KDAGNS  59

Query  350  LASNT  364
             A+ +
Sbjct  60   SAAGS  64



>ref|NP_001054398.2| Os05g0103800 [Oryza sativa Japonica Group]
 dbj|BAF16312.2| Os05g0103800 [Oryza sativa Japonica Group]
Length=185

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  146  SDSCKMVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEK  325
            ++ CK+ +   F  LAPKTKN VVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF+  K
Sbjct  115  NNRCKLKM-AGFGSLAPKTKNFVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEDMK  173

Query  326  QNKDTKASLA  355
            +N    +S A
Sbjct  174  KNDAGNSSTA  183



>ref|XP_003552731.1| PREDICTED: uncharacterized protein LOC100500217 [Glycine max]
 gb|ACU15217.1| unknown [Glycine max]
 gb|KHN17321.1| hypothetical protein glysoja_036926 [Glycine soja]
Length=68

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     +  L PK KNLVVAGGL+ FVFG YFYTMRAVGGTDELQ+AIDKF+ +K   + 
Sbjct  1    MAGLLGYRSLPPKAKNLVVAGGLTAFVFGAYFYTMRAVGGTDELQVAIDKFEADKSKNEG  60

Query  341  KASLAS  358
             A++ S
Sbjct  61   DANMPS  66



>gb|ABA99375.1| expressed protein [Oryza sativa Japonica Group]
Length=173

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +2

Query  146  SDSCKMVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEK  325
            S+ CK+ +   F  LAPKTKN+VVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF+  K
Sbjct  103  SNRCKLKM-AGFGSLAPKTKNIVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEGMK  161

Query  326  QNKDTKASLASN  361
            +     +S A +
Sbjct  162  KKDAGNSSAAGS  173



>gb|AFK39872.1| unknown [Lotus japonicus]
Length=68

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F  L PK KN VVAGGL+ FVFG YFYTMRAVGGTDELQ+AIDKF+ +K  ++ + S+ S
Sbjct  7    FASLPPKAKNFVVAGGLTAFVFGTYFYTMRAVGGTDELQVAIDKFEADKSKQEGEPSVPS  66

Query  359  NT  364
              
Sbjct  67   KV  68



>ref|XP_007139144.1| hypothetical protein PHAVU_008G005000g [Phaseolus vulgaris]
 gb|ESW11138.1| hypothetical protein PHAVU_008G005000g [Phaseolus vulgaris]
Length=68

 Score = 84.7 bits (208),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     F  L PK KNLVVAG L+ FVFG YFYTMRAVGGTDELQ+AIDKF+  K   + 
Sbjct  1    MAGLLGFRSLPPKAKNLVVAGSLTAFVFGAYFYTMRAVGGTDELQVAIDKFESHKTKNEG  60

Query  341  KASLAS  358
            +++++S
Sbjct  61   ESNMSS  66



>ref|XP_003532337.1| PREDICTED: uncharacterized protein LOC100811894 [Glycine max]
 gb|KHN24942.1| hypothetical protein glysoja_027056 [Glycine soja]
Length=68

 Score = 84.7 bits (208),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     +  L PK KNLVVAGGL+ FVFG YFYTMRAVGGTDELQ+AIDKF+ +K     
Sbjct  1    MAGLLGYRSLPPKAKNLVVAGGLTAFVFGAYFYTMRAVGGTDELQVAIDKFEADKNKNAG  60

Query  341  KASLAS  358
             A++ S
Sbjct  61   DANMPS  66



>gb|EMS64218.1| hypothetical protein TRIUR3_13515 [Triticum urartu]
Length=117

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKASLAS  358
            F  LAPKTKN+VVAGGL+GFVFGVY+YTM AVG TDELQ+ IDKF+  K+ ++  A+ +S
Sbjct  53   FGSLAPKTKNVVVAGGLTGFVFGVYYYTMWAVGSTDELQVTIDKFEDLKKKEEAAATSSS  112



>ref|XP_009142962.1| PREDICTED: uncharacterized protein LOC103866740 [Brassica rapa]
Length=67

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ  328
            M  F   + L PK+KN VVAGGL+ FVFGVYFYTM+AVGGTDELQ+AIDKF+ +KQ
Sbjct  1    MSGFPGLSFLGPKSKNAVVAGGLTAFVFGVYFYTMKAVGGTDELQMAIDKFEDQKQ  56



>ref|XP_006397549.1| hypothetical protein EUTSA_v10001711mg [Eutrema salsugineum]
 gb|ESQ39002.1| hypothetical protein EUTSA_v10001711mg [Eutrema salsugineum]
Length=67

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNK-D  337
            M  F   + L PK+KN+VVAGGL+ FV GVYFYTMRAVGGTDELQ+AIDKF+ +K  K D
Sbjct  1    MAGFPGLSFLGPKSKNMVVAGGLTAFVSGVYFYTMRAVGGTDELQMAIDKFEDQKPVKSD  60

Query  338  TKA  346
             KA
Sbjct  61   PKA  63



>ref|XP_004985334.1| PREDICTED: uncharacterized protein LOC101758110 [Setaria italica]
Length=64

 Score = 82.0 bits (201),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ  328
               F  L+PKT+ LVVAGGLS FV GVY+YTMRAVGGTDELQ+AIDKF++ K+
Sbjct  1    MAGFRSLSPKTRKLVVAGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEELKK  53



>ref|XP_006858783.1| hypothetical protein AMTR_s00066p00158830 [Amborella trichopoda]
 gb|ERN20250.1| hypothetical protein AMTR_s00066p00158830 [Amborella trichopoda]
Length=337

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  167  VFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKD  337
            +   F  LAPKTKN++VAGGL+GFV GVYFYTM+AVGGTDELQ+AIDKF + K+ ++
Sbjct  272  IMAGFAGLAPKTKNVIVAGGLTGFVLGVYFYTMKAVGGTDELQVAIDKFDELKKQEN  328



>emb|CDY44255.1| BnaC03g24470D [Brassica napus]
Length=100

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ  328
            F   + L PK+KN VVAGGL+ FVFGVYFYTM+AVGGTDELQ+AIDKF+ +KQ
Sbjct  37   FPGLSFLGPKSKNAVVAGGLTAFVFGVYFYTMKAVGGTDELQMAIDKFEDQKQ  89



>ref|XP_009133634.1| PREDICTED: uncharacterized protein LOC103858094 [Brassica rapa]
 emb|CDX83460.1| BnaA03g20460D [Brassica napus]
Length=67

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ  328
            M  F   + L PK KN VVAGGL+ FVFGVYFYTM+AVGGTDELQ+AIDKF+ +KQ
Sbjct  1    MSGFPGLSFLGPKGKNAVVAGGLTAFVFGVYFYTMKAVGGTDELQMAIDKFEDQKQ  56



>gb|EPS62010.1| hypothetical protein M569_12784, partial [Genlisea aurea]
Length=58

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNK  334
            +  LAPK KNL+VAGGL+ FVFGVYFYTM+AVG +DELQ+AIDKF+++K  +
Sbjct  7    YRGLAPKAKNLLVAGGLTTFVFGVYFYTMKAVGSSDELQVAIDKFEEQKHKQ  58



>ref|XP_010431000.1| PREDICTED: uncharacterized protein LOC104715279 [Camelina sativa]
Length=546

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFK-QEKQNKD  337
            M  F  F+ L PK+KN VVAGGL+ FVFGVYFYTMRAVGGTDELQ+AIDKF+ Q+    D
Sbjct  480  MAGFPGFSYLGPKSKNTVVAGGLTAFVFGVYFYTMRAVGGTDELQVAIDKFEGQKPVETD  539

Query  338  TKA  346
            TK 
Sbjct  540  TKV  542



>gb|EMT31212.1| hypothetical protein F775_26572 [Aegilops tauschii]
Length=68

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  176  AFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQ  319
             F  LAPKTKN+VVAGGL+GFVFGVY+YTM AVG TDELQ+ IDKF+ 
Sbjct  3    GFGSLAPKTKNVVVAGGLTGFVFGVYYYTMWAVGSTDELQVTIDKFED  50



>gb|KHN40935.1| hypothetical protein glysoja_046166 [Glycine soja]
Length=68

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     +  L PK KNLVV GGL+ FVFG YFYTMRAVGGT+ELQ+AIDKF+  K     
Sbjct  1    MAGLLGYRSLPPKAKNLVVVGGLTTFVFGAYFYTMRAVGGTNELQVAIDKFEANKNKNVG  60

Query  341  KASLAS  358
             A++ S
Sbjct  61   DANMRS  66



>emb|CDY17912.1| BnaC04g03070D [Brassica napus]
Length=417

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ-NKD  337
            M  F   + L PK+KN VVAGGL+ FVFGVYFYTM+AVGGTDELQ+AIDKF+ +K    D
Sbjct  1    MSGFPGLSFLGPKSKNAVVAGGLTAFVFGVYFYTMKAVGGTDELQMAIDKFEDQKHVETD  60

Query  338  TKAS  349
             K S
Sbjct  61   PKGS  64



>emb|CDX79802.1| BnaA05g03540D [Brassica napus]
Length=415

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +2

Query  188  LAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQ-NKDTKAS  349
            L PK+KN VVAGGL+ FVFGVYFYTM+AVGGTDELQ+AIDKF+ +KQ   D K S
Sbjct  10   LGPKSKNAVVAGGLTAFVFGVYFYTMKAVGGTDELQMAIDKFEDKKQVETDPKGS  64



>gb|EMS62869.1| hypothetical protein TRIUR3_15614 [Triticum urartu]
Length=167

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  176  AFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQN  331
             F  LAPKTKN+VVAGGL+GFVFGVY+ TM AVG TDELQ+ IDKF+  K+ 
Sbjct  101  GFGSLAPKTKNVVVAGGLTGFVFGVYYNTMWAVGSTDELQVTIDKFEDLKKE  152



>emb|CAN67579.1| hypothetical protein VITISV_022628 [Vitis vinifera]
 emb|CBI24695.3| unnamed protein product [Vitis vinifera]
Length=61

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKD  337
               F+ L  K KN +VAGGL+ FV GVY YTMRAVGGTDE+Q+AI+KF++EK  K+
Sbjct  1    MAGFSGLPTKGKNGIVAGGLTAFVVGVYIYTMRAVGGTDEIQVAINKFEEEKAMKE  56



>gb|ABK25362.1| unknown [Picea sitchensis]
Length=69

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKD  337
            F +F  L  ++KN++VAGGL+GFV  VY YTMRAVG TDELQ AI+ F+++K  + 
Sbjct  4    FRSFTSLTSRSKNIIVAGGLTGFVAAVYIYTMRAVGSTDELQTAIETFEKQKSQES  59



>gb|KHN48830.1| hypothetical protein glysoja_030600 [Glycine soja]
Length=67

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDT  340
            M     +  L PK KNLVV GGL  FVFG YFYTMR VGGT+ELQ+AIDKF+ +K     
Sbjct  1    MARILGYRSLPPKAKNLVV-GGLIAFVFGAYFYTMRVVGGTNELQVAIDKFEVDKNKNAG  59

Query  341  KASLAS  358
             A++ S
Sbjct  60   DANMPS  65



>gb|ABK25618.1| unknown [Picea sitchensis]
Length=69

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  170  FTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKD  337
            F +F  L  ++KN+++AGGL+GFV  VY YTMRAVG TDELQ AI+ F+++K  + 
Sbjct  4    FRSFTSLTSRSKNIILAGGLTGFVAAVYIYTMRAVGSTDELQTAIETFEKQKSQES  59



>gb|AFW78824.1| hypothetical protein ZEAMMB73_450786, partial [Zea mays]
Length=65

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  188  LAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAIDKFKQEKQNKDTKAS  349
            L P+       GGLS FV GVY+YTMRAVGGTDELQ+AIDKF++ K+    + S
Sbjct  7    LHPRPGTWWWLGGLSAFVLGVYYYTMRAVGGTDELQVAIDKFEEMKKKDAARNS  60



>gb|ACG38832.1| hypothetical protein [Zea mays]
Length=52

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +2

Query  179  FNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDE-LQIAIDKF  313
            F  LAPKT+NLVVAGGLS FV GVY+YTMRAVGGT E L++ I  F
Sbjct  4    FRSLAPKTRNLVVAGGLSAFVLGVYYYTMRAVGGTRERLRVRISPF  49



>gb|KHN45780.1| hypothetical protein glysoja_042528, partial [Glycine soja]
Length=49

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  161  MVVFTAFNRLAPKTKNLVVAGGLSGFVFGVYFYTMRAVGGTDELQIAID  307
            M     +  L PK KNLVV GGL+ FVFG YFYT R VGGT+EL +AID
Sbjct  1    MAGLLGYRSLPPKAKNLVVVGGLTAFVFGAYFYTKRVVGGTNELHVAID  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690