BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018D08 634 bp,

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593487.1|  PREDICTED: cytokinin dehydrogenase 7               327   1e-105   Nicotiana tomentosiformis
ref|XP_011081605.1|  PREDICTED: cytokinin dehydrogenase 7               325   2e-105   Sesamum indicum [beniseed]
ref|XP_009781977.1|  PREDICTED: cytokinin dehydrogenase 7               325   7e-105   Nicotiana sylvestris
ref|XP_011102038.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    322   3e-104   Sesamum indicum [beniseed]
ref|XP_007012417.1|  Cytokinin oxidase                                  320   1e-103   Theobroma cacao [chocolate]
ref|XP_009126512.1|  PREDICTED: cytokinin dehydrogenase 7-like          320   1e-103   Brassica rapa
gb|AEK97325.1|  chromoplast cytokinin dehydrogenase/ oxidoreductase     310   2e-103   Brassica rapa var. parachinensis [cai xin]
gb|KJB65480.1|  hypothetical protein B456_010G096700                    314   1e-102   Gossypium raimondii
ref|NP_850863.1|  cytokinin dehydrogenase 7                             317   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KDP34032.1|  hypothetical protein JCGZ_07603                         317   3e-102   Jatropha curcas
ref|XP_006367057.1|  PREDICTED: cytokinin dehydrogenase 7-like          317   3e-102   Solanum tuberosum [potatoes]
ref|XP_006287493.1|  hypothetical protein CARUB_v10000702mg             317   3e-102   Capsella rubella
gb|KFK26358.1|  hypothetical protein AALP_AA8G238000                    316   5e-102   Arabis alpina [alpine rockcress]
ref|XP_010454451.1|  PREDICTED: cytokinin dehydrogenase 7-like          316   5e-102   Camelina sativa [gold-of-pleasure]
emb|CDY16602.1|  BnaC09g36710D                                          314   6e-102   Brassica napus [oilseed rape]
gb|KHG16444.1|  Cytokinin dehydrogenase 7 -like protein                 314   2e-101   Gossypium arboreum [tree cotton]
pdb|2EXR|A  Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROG...    314   3e-101   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM74649.1|  cytokinin oxidase/dehydrogenase                        314   4e-101   Torenia fournieri [bluewings]
gb|KJB65479.1|  hypothetical protein B456_010G096700                    313   5e-101   Gossypium raimondii
ref|XP_010420976.1|  PREDICTED: cytokinin dehydrogenase 7               313   6e-101   Camelina sativa [gold-of-pleasure]
emb|CDP13465.1|  unnamed protein product                                313   1e-100   Coffea canephora [robusta coffee]
ref|XP_010493247.1|  PREDICTED: cytokinin dehydrogenase 7-like          312   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009120710.1|  PREDICTED: cytokinin dehydrogenase 7               312   2e-100   Brassica rapa
ref|XP_002871976.1|  hypothetical protein ARALYDRAFT_489034             312   2e-100   Arabidopsis lyrata subsp. lyrata
gb|EYU20300.1|  hypothetical protein MIMGU_mgv1a004484mg                311   3e-100   Erythranthe guttata [common monkey flower]
ref|XP_004245052.1|  PREDICTED: cytokinin dehydrogenase 7-like          310   2e-99    
ref|XP_006400694.1|  hypothetical protein EUTSA_v10013259mg             308   5e-99    Eutrema salsugineum
gb|KJB54572.1|  hypothetical protein B456_009G040700                    304   1e-98    Gossypium raimondii
gb|KJB54574.1|  hypothetical protein B456_009G040700                    304   2e-98    Gossypium raimondii
ref|XP_007161054.1|  hypothetical protein PHAVU_001G038800g             307   2e-98    Phaseolus vulgaris [French bean]
ref|NP_001275121.1|  cytokinin oxidase/dehydrogenase                    306   2e-98    Solanum tuberosum [potatoes]
ref|XP_004172756.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    302   7e-98    
ref|XP_008220595.1|  PREDICTED: cytokinin dehydrogenase 7               305   8e-98    Prunus mume [ume]
ref|XP_009362741.1|  PREDICTED: cytokinin dehydrogenase 7-like          304   2e-97    Pyrus x bretschneideri [bai li]
ref|XP_007222863.1|  hypothetical protein PRUPE_ppa004276mg             304   3e-97    Prunus persica
ref|XP_010324957.1|  PREDICTED: cytokinin oxidase/dehydrogenase-l...    300   5e-97    Solanum lycopersicum
gb|AGM20669.1|  CKX5                                                    299   1e-96    Populus tomentosa [Chinese white poplar]
gb|KJB54573.1|  hypothetical protein B456_009G040700                    302   1e-96    Gossypium raimondii
ref|XP_004141436.1|  PREDICTED: cytokinin dehydrogenase 7-like          300   8e-96    
gb|KGN55376.1|  hypothetical protein Csa_4G647490                       301   2e-95    Cucumis sativus [cucumbers]
ref|XP_011019350.1|  PREDICTED: cytokinin dehydrogenase 7               299   2e-95    Populus euphratica
ref|NP_001266216.1|  cytokinin oxidase/dehydrogenase-like               299   2e-95    Solanum lycopersicum
ref|XP_008393590.1|  PREDICTED: cytokinin dehydrogenase 7               299   2e-95    Malus domestica [apple tree]
ref|XP_008377825.1|  PREDICTED: cytokinin dehydrogenase 7-like          299   2e-95    Malus domestica [apple tree]
ref|XP_010520480.1|  PREDICTED: cytokinin dehydrogenase 7-like          299   2e-95    Tarenaya hassleriana [spider flower]
gb|KJB82928.1|  hypothetical protein B456_013G221000                    299   2e-95    Gossypium raimondii
ref|XP_002309468.1|  cytokinin oxidase family protein                   297   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_008452781.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    296   2e-94    Cucumis melo [Oriental melon]
ref|XP_002279960.1|  PREDICTED: cytokinin dehydrogenase 7               296   3e-94    Vitis vinifera
ref|XP_003544550.1|  PREDICTED: cytokinin dehydrogenase 7-like          296   4e-94    Glycine max [soybeans]
gb|KJB27239.1|  hypothetical protein B456_004G286300                    296   4e-94    Gossypium raimondii
ref|XP_002516133.1|  gulonolactone oxidase, putative                    295   1e-93    Ricinus communis
ref|XP_004303465.1|  PREDICTED: cytokinin dehydrogenase 7               292   9e-93    Fragaria vesca subsp. vesca
gb|EPS58008.1|  cytokinin dehydrogenase 7                               287   3e-92    Genlisea aurea
ref|XP_003588931.1|  Cytokinin dehydrogenase                            290   4e-92    Medicago truncatula
ref|XP_010535754.1|  PREDICTED: cytokinin dehydrogenase 7-like          288   2e-91    Tarenaya hassleriana [spider flower]
ref|XP_006453001.1|  hypothetical protein CICLE_v10007999mg             285   5e-91    Citrus clementina
ref|XP_004498857.1|  PREDICTED: cytokinin dehydrogenase 7-like          288   6e-91    Cicer arietinum [garbanzo]
ref|XP_010098364.1|  Cytokinin dehydrogenase 7                          287   6e-91    Morus notabilis
gb|ABK32520.1|  cytokinin oxidase/dehydrogenase 1                       286   2e-90    Pisum sativum [garden pea]
gb|KDO73618.1|  hypothetical protein CISIN_1g009956mg                   286   2e-90    Citrus sinensis [Valencia orange]
ref|XP_006474490.1|  PREDICTED: cytokinin dehydrogenase 7-like          286   3e-90    Citrus sinensis [Valencia orange]
ref|XP_009334680.1|  PREDICTED: cytokinin dehydrogenase 7-like          285   6e-90    Pyrus x bretschneideri [bai li]
emb|CBI20721.3|  unnamed protein product                                281   4e-89    Vitis vinifera
ref|XP_006453000.1|  hypothetical protein CICLE_v10007999mg             283   4e-89    Citrus clementina
ref|XP_010261926.1|  PREDICTED: cytokinin dehydrogenase 7               283   5e-89    Nelumbo nucifera [Indian lotus]
ref|XP_010669322.1|  PREDICTED: cytokinin dehydrogenase 7               281   3e-88    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007136881.1|  hypothetical protein PHAVU_009G081800g             280   4e-88    Phaseolus vulgaris [French bean]
ref|XP_010049279.1|  PREDICTED: cytokinin dehydrogenase 7               277   8e-87    Eucalyptus grandis [rose gum]
ref|XP_011460257.1|  PREDICTED: cytokinin dehydrogenase 7-like          261   9e-81    Fragaria vesca subsp. vesca
ref|XP_010917178.1|  PREDICTED: cytokinin dehydrogenase 11-like         261   1e-80    Elaeis guineensis
ref|XP_008786614.1|  PREDICTED: cytokinin dehydrogenase 11-like         260   3e-80    Phoenix dactylifera
ref|XP_006849648.1|  hypothetical protein AMTR_s00024p00226830          257   4e-79    Amborella trichopoda
ref|XP_010932426.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    254   5e-78    Elaeis guineensis
ref|XP_009408414.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    253   2e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660189.1|  PREDICTED: cytokinin dehydrogenase 11-like         249   4e-77    Oryza brachyantha
ref|XP_004973628.1|  PREDICTED: cytokinin dehydrogenase 11-like         250   2e-76    Setaria italica
ref|XP_002445610.1|  hypothetical protein SORBIDRAFT_07g022530          249   3e-76    Sorghum bicolor [broomcorn]
gb|KJB65481.1|  hypothetical protein B456_010G096700                    244   5e-76    Gossypium raimondii
ref|XP_009414109.1|  PREDICTED: cytokinin dehydrogenase 11-like         249   7e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784471.1|  PREDICTED: cytokinin dehydrogenase 11-like         246   9e-75    Phoenix dactylifera
gb|EEE68814.1|  hypothetical protein OsJ_27576                          242   4e-74    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146838.1|  cytokinin dehydrogenase 10                         244   6e-74    Zea mays [maize]
sp|Q6Z955.1|CKX11_ORYSJ  RecName: Full=Cytokinin dehydrogenase 11...    243   7e-74    Oryza sativa Japonica Group [Japonica rice]
gb|KJB54571.1|  hypothetical protein B456_009G040700                    237   3e-73    Gossypium raimondii
gb|AFK79782.1|  cytokinin oxidase/dehydrogenase                         231   2e-72    Hordeum vulgare subsp. vulgare [barley]
ref|XP_010235198.1|  PREDICTED: cytokinin dehydrogenase 11              239   4e-72    Brachypodium distachyon [annual false brome]
gb|ADB81979.1|  cytokinin oxidase/dehydrogenase 3                       239   4e-72    Triticum aestivum [Canadian hard winter wheat]
gb|KCW81798.1|  hypothetical protein EUGRSUZ_C031572                    219   2e-66    Eucalyptus grandis [rose gum]
ref|XP_006854620.1|  hypothetical protein AMTR_s00030p00163490          218   6e-65    Amborella trichopoda
emb|CDM86341.1|  unnamed protein product                                213   6e-63    Triticum aestivum [Canadian hard winter wheat]
gb|KFK36997.1|  hypothetical protein AALP_AA4G199000                    215   9e-63    Arabis alpina [alpine rockcress]
ref|XP_008464595.1|  PREDICTED: cytokinin dehydrogenase 1 isoform X2    213   1e-62    
gb|EMS67590.1|  Cytokinin dehydrogenase 4                               211   2e-62    Triticum urartu
gb|KHN37061.1|  Cytokinin dehydrogenase 7                               206   4e-62    Glycine soja [wild soybean]
ref|XP_006421171.1|  hypothetical protein CICLE_v10006491mg             213   4e-62    Citrus clementina
ref|XP_006293839.1|  hypothetical protein CARUB_v10022823mg             215   4e-62    Capsella rubella
gb|EAZ14789.1|  hypothetical protein OsJ_04719                          210   5e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645310.1|  PREDICTED: cytokinin dehydrogenase 4-like          212   6e-62    Oryza brachyantha
ref|XP_008464594.1|  PREDICTED: cytokinin dehydrogenase 1 isoform X1    213   6e-62    Cucumis melo [Oriental melon]
ref|XP_006491496.1|  PREDICTED: cytokinin dehydrogenase 1-like          213   7e-62    Citrus sinensis [Valencia orange]
ref|XP_003605865.1|  Cytokinin oxidase                                  211   1e-61    Medicago truncatula
ref|XP_004971217.1|  PREDICTED: cytokinin dehydrogenase 4-like          211   2e-61    Setaria italica
ref|XP_010090224.1|  Cytokinin dehydrogenase 1                          211   3e-61    Morus notabilis
ref|XP_002988125.1|  hypothetical protein SELMODRAFT_127173             211   3e-61    Selaginella moellendorffii
gb|EMT32653.1|  Cytokinin dehydrogenase 1                               209   3e-61    Aegilops tauschii
ref|XP_010523651.1|  PREDICTED: cytokinin dehydrogenase 1               211   4e-61    Tarenaya hassleriana [spider flower]
ref|XP_010505935.1|  PREDICTED: cytokinin dehydrogenase 1               211   4e-61    Camelina sativa [gold-of-pleasure]
dbj|BAK61871.1|  cytokinin oxidase                                      212   4e-61    Citrus unshiu [Satsuma orange]
ref|XP_002972678.1|  hypothetical protein SELMODRAFT_98722              210   4e-61    Selaginella moellendorffii
gb|AFW83998.1|  cytokinin oxidase 3, mRNA                               209   5e-61    Zea mays [maize]
ref|XP_006411418.1|  hypothetical protein EUTSA_v10016470mg             210   6e-61    Eutrema salsugineum
ref|XP_009391556.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    209   6e-61    Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY77168.1|  hypothetical protein OsI_05138                          209   6e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_003565050.1|  PREDICTED: cytokinin dehydrogenase 4               209   6e-61    Brachypodium distachyon [annual false brome]
ref|NP_001045353.1|  Os01g0940000                                       209   7e-61    
gb|AFW83999.1|  LOW QUALITY PROTEIN: cytokinin oxidase 3                209   8e-61    Zea mays [maize]
emb|CAE55201.1|  cytokinin oxidase 3                                    209   9e-61    Zea mays [maize]
gb|AFK79777.1|  cytokinin oxidase/dehydrogenase                         208   9e-61    Hordeum vulgare subsp. vulgare [barley]
ref|XP_004513273.1|  PREDICTED: cytokinin dehydrogenase 6-like          212   9e-61    
pdb|4ML8|A  Chain A, Structure Of Maize Cytokinin Oxidase/dehydro...    207   2e-60    Zea mays [maize]
ref|XP_002284560.2|  PREDICTED: cytokinin dehydrogenase 1-like          208   3e-60    Vitis vinifera
ref|NP_001105526.1|  cytokinin oxidase 2 precursor                      207   4e-60    Zea mays [maize]
emb|CCH15046.1|  cytokinin oxidase/dehydrogenase 1                      206   4e-60    Eleusine coracana
ref|XP_010508710.1|  PREDICTED: cytokinin dehydrogenase 1-like          209   4e-60    Camelina sativa [gold-of-pleasure]
dbj|BAL04493.1|  cytokinin oxidase                                      207   4e-60    Pisum sativum [garden pea]
ref|XP_010672924.1|  PREDICTED: cytokinin dehydrogenase 1-like          207   5e-60    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008811766.1|  PREDICTED: cytokinin dehydrogenase 4-like          207   5e-60    Phoenix dactylifera
ref|XP_004142714.1|  PREDICTED: cytokinin dehydrogenase 1-like          207   7e-60    Cucumis sativus [cucumbers]
ref|NP_181682.1|  cytokinin dehydrogenase 1                             208   8e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438909.1|  hypothetical protein CICLE_v10031210mg             207   8e-60    Citrus clementina
ref|NP_001105163.1|  cytokinin oxidase 3 precursor                      206   1e-59    Zea mays [maize]
emb|CDY35410.1|  BnaA03g19500D                                          207   1e-59    Brassica napus [oilseed rape]
ref|XP_010938664.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    206   1e-59    Elaeis guineensis
dbj|BAG16373.1|  cytokinin oxidase family protein                       206   1e-59    Brassica oleracea var. italica [asparagus broccoli]
emb|CDP13849.1|  unnamed protein product                                204   1e-59    Coffea canephora [robusta coffee]
ref|XP_007131444.1|  hypothetical protein PHAVU_011G014000g             206   2e-59    Phaseolus vulgaris [French bean]
ref|XP_002879935.1|  ATCKX1/CKX1                                        206   2e-59    Arabidopsis lyrata subsp. lyrata
ref|XP_010517646.1|  PREDICTED: cytokinin dehydrogenase 1-like          207   2e-59    Camelina sativa [gold-of-pleasure]
ref|XP_002304773.1|  FAD-binding domain-containing family protein       206   2e-59    Populus trichocarpa [western balsam poplar]
gb|ACU22904.1|  unknown                                                 205   2e-59    Glycine max [soybeans]
gb|KDO83251.1|  hypothetical protein CISIN_1g008291mg                   206   2e-59    Citrus sinensis [Valencia orange]
ref|XP_008443336.1|  PREDICTED: cytokinin dehydrogenase 1-like          206   2e-59    Cucumis melo [Oriental melon]
ref|XP_011042115.1|  PREDICTED: cytokinin dehydrogenase 6-like          205   2e-59    Populus euphratica
ref|XP_002456917.1|  hypothetical protein SORBIDRAFT_03g045410          205   3e-59    Sorghum bicolor [broomcorn]
ref|XP_010921880.1|  PREDICTED: cytokinin dehydrogenase 9-like          205   3e-59    Elaeis guineensis
ref|XP_006482960.1|  PREDICTED: cytokinin dehydrogenase 6-like          205   3e-59    Citrus sinensis [Valencia orange]
ref|XP_009336587.1|  PREDICTED: cytokinin dehydrogenase 1-like          205   5e-59    Pyrus x bretschneideri [bai li]
gb|KHN39533.1|  Cytokinin dehydrogenase 6                               204   6e-59    Glycine soja [wild soybean]
ref|XP_003538221.1|  PREDICTED: cytokinin dehydrogenase 6               205   6e-59    Glycine max [soybeans]
ref|XP_002977614.1|  hypothetical protein SELMODRAFT_106833             203   1e-58    Selaginella moellendorffii
ref|XP_004159659.1|  PREDICTED: cytokinin dehydrogenase 1-like          204   1e-58    
emb|CDY23844.1|  BnaC04g01930D                                          205   1e-58    Brassica napus [oilseed rape]
ref|XP_009417944.1|  PREDICTED: cytokinin dehydrogenase 4-like          204   1e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004136791.1|  PREDICTED: cytokinin dehydrogenase 1-like          204   1e-58    Cucumis sativus [cucumbers]
emb|CDY14777.1|  BnaC04g47740D                                          204   2e-58    Brassica napus [oilseed rape]
ref|XP_006654329.1|  PREDICTED: cytokinin dehydrogenase 9-like          203   2e-58    Oryza brachyantha
ref|XP_010231472.1|  PREDICTED: cytokinin dehydrogenase 9               202   2e-58    Brachypodium distachyon [annual false brome]
ref|XP_009141995.1|  PREDICTED: cytokinin dehydrogenase 1-like          203   2e-58    Brassica rapa
ref|NP_001244907.1|  cytokinin oxidase/dehydrogenase-like 5 precu...    203   2e-58    Solanum lycopersicum
ref|XP_008360505.1|  PREDICTED: cytokinin dehydrogenase 1-like          203   3e-58    Malus domestica [apple tree]
ref|XP_001776926.1|  predicted protein                                  202   3e-58    Physcomitrella patens
ref|XP_003599606.1|  Cytokinin dehydrogenase                            203   3e-58    Medicago truncatula
ref|XP_009133497.1|  PREDICTED: cytokinin dehydrogenase 1-like          203   3e-58    Brassica rapa
ref|XP_011075363.1|  PREDICTED: cytokinin dehydrogenase 1               203   3e-58    Sesamum indicum [beniseed]
ref|XP_010279585.1|  PREDICTED: cytokinin dehydrogenase 9-like          203   3e-58    Nelumbo nucifera [Indian lotus]
gb|KHN14944.1|  Cytokinin dehydrogenase 1                               203   4e-58    Glycine soja [wild soybean]
ref|XP_002513118.1|  Cytokinin dehydrogenase, putative                  202   4e-58    Ricinus communis
ref|XP_003553393.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    202   4e-58    Glycine max [soybeans]
ref|XP_008796239.1|  PREDICTED: cytokinin dehydrogenase 9-like          202   4e-58    Phoenix dactylifera
ref|XP_011033192.1|  PREDICTED: cytokinin dehydrogenase 1-like          202   5e-58    Populus euphratica
ref|XP_006368582.1|  FAD-binding domain-containing family protein       202   5e-58    Populus trichocarpa [western balsam poplar]
ref|XP_007149023.1|  hypothetical protein PHAVU_005G034000g             202   6e-58    Phaseolus vulgaris [French bean]
ref|XP_011037797.1|  PREDICTED: cytokinin dehydrogenase 6-like          202   6e-58    Populus euphratica
ref|NP_001244203.1|  cytokinin dehydrogenase 1-like                     202   6e-58    Glycine max [soybeans]
gb|KJB74440.1|  hypothetical protein B456_011G295400                    202   7e-58    Gossypium raimondii
ref|XP_002323274.1|  hypothetical protein POPTR_0016s04340g             202   8e-58    Populus trichocarpa [western balsam poplar]
ref|XP_006402274.1|  hypothetical protein EUTSA_v10005878mg             201   9e-58    Eutrema salsugineum
gb|EAY97807.1|  hypothetical protein OsI_19727                          201   9e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_011088157.1|  PREDICTED: cytokinin dehydrogenase 6-like          201   9e-58    Sesamum indicum [beniseed]
ref|NP_001055371.2|  Os05g0374200                                       201   1e-57    
dbj|BAM74647.1|  cytokinin oxidase/dehydrogenase                        201   1e-57    Torenia fournieri [bluewings]
ref|XP_002975207.1|  hypothetical protein SELMODRAFT_174721             200   2e-57    Selaginella moellendorffii
ref|XP_010907734.1|  PREDICTED: cytokinin dehydrogenase 5-like          201   2e-57    Elaeis guineensis
ref|XP_010547318.1|  PREDICTED: cytokinin dehydrogenase 6-like          200   2e-57    Tarenaya hassleriana [spider flower]
ref|XP_010938665.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X2    201   2e-57    Elaeis guineensis
emb|CDY22528.1|  BnaC03g23380D                                          200   2e-57    Brassica napus [oilseed rape]
ref|XP_002439706.1|  hypothetical protein SORBIDRAFT_09g018640          200   3e-57    Sorghum bicolor [broomcorn]
gb|AII20187.1|  cytokinin oxidase/dehydrogenase-like 7                  201   3e-57    Nicotiana tabacum [American tobacco]
ref|XP_010067774.1|  PREDICTED: cytokinin dehydrogenase 6-like          200   3e-57    Eucalyptus grandis [rose gum]
ref|XP_001777489.1|  predicted protein                                  199   3e-57    Physcomitrella patens
ref|XP_004514814.1|  PREDICTED: cytokinin dehydrogenase 6-like          200   4e-57    Cicer arietinum [garbanzo]
ref|XP_007219000.1|  hypothetical protein PRUPE_ppa004120mg             199   5e-57    Prunus persica
gb|KJB76264.1|  hypothetical protein B456_012G081000                    199   5e-57    Gossypium raimondii
gb|EYU27005.1|  hypothetical protein MIMGU_mgv1a004144mg                199   6e-57    Erythranthe guttata [common monkey flower]
ref|XP_006843486.1|  hypothetical protein AMTR_s00053p00208790          199   7e-57    Amborella trichopoda
ref|XP_003539919.1|  PREDICTED: cytokinin dehydrogenase 6-like          199   7e-57    Glycine max [soybeans]
ref|XP_009767664.1|  PREDICTED: cytokinin dehydrogenase 1-like          199   9e-57    Nicotiana sylvestris
gb|KJB35953.1|  hypothetical protein B456_006G134800                    199   1e-56    Gossypium raimondii
ref|XP_003625100.1|  Cytokinin oxidase                                  199   1e-56    Medicago truncatula
ref|XP_004143695.1|  PREDICTED: cytokinin dehydrogenase 6-like          199   1e-56    Cucumis sativus [cucumbers]
ref|XP_010932835.1|  PREDICTED: cytokinin dehydrogenase 5-like          198   1e-56    Elaeis guineensis
ref|XP_010269658.1|  PREDICTED: cytokinin dehydrogenase 1-like          198   1e-56    Nelumbo nucifera [Indian lotus]
ref|XP_008796604.1|  PREDICTED: cytokinin dehydrogenase 5-like          199   1e-56    Phoenix dactylifera
ref|XP_001784400.1|  predicted protein                                  197   1e-56    Physcomitrella patens
emb|CAN76251.1|  hypothetical protein VITISV_025507                     199   1e-56    Vitis vinifera
ref|XP_008387997.1|  PREDICTED: cytokinin dehydrogenase 5-like          198   2e-56    Malus domestica [apple tree]
ref|XP_009609443.1|  PREDICTED: cytokinin dehydrogenase 1-like          198   2e-56    Nicotiana tomentosiformis
ref|XP_004962256.1|  PREDICTED: cytokinin dehydrogenase 9-like          197   2e-56    Setaria italica
gb|KJB14468.1|  hypothetical protein B456_002G126300                    197   2e-56    Gossypium raimondii
gb|AAN16383.1|  cytokinin dehydrogenase 2                               197   2e-56    Hordeum vulgare [barley]
gb|KJB58188.1|  hypothetical protein B456_009G198300                    195   2e-56    Gossypium raimondii
ref|XP_008392337.1|  PREDICTED: cytokinin dehydrogenase 1-like          197   3e-56    Malus domestica [apple tree]
dbj|BAH47540.1|  cytokinin oxidase                                      197   4e-56    Zinnia violacea [garden zinnia]
gb|KHN32384.1|  Cytokinin dehydrogenase 6                               197   4e-56    Glycine soja [wild soybean]
gb|EMS64767.1|  Cytokinin dehydrogenase 9                               197   4e-56    Triticum urartu
ref|XP_007203158.1|  hypothetical protein PRUPE_ppa024442mg             197   4e-56    Prunus persica
dbj|BAG16379.1|  cytokinin oxidase family protein                       197   4e-56    Brassica rapa var. perviridis [kabuna]
gb|KGN62632.1|  hypothetical protein Csa_2G362450                       195   5e-56    Cucumis sativus [cucumbers]
ref|XP_001777510.1|  predicted protein                                  197   5e-56    Physcomitrella patens
ref|XP_008349298.1|  PREDICTED: cytokinin dehydrogenase 6-like          197   5e-56    Malus domestica [apple tree]
gb|EMT30248.1|  Cytokinin dehydrogenase 1                               196   6e-56    Aegilops tauschii
ref|XP_009352666.1|  PREDICTED: cytokinin dehydrogenase 3-like          196   7e-56    Pyrus x bretschneideri [bai li]
ref|XP_002534458.1|  gulonolactone oxidase, putative                    196   7e-56    Ricinus communis
ref|XP_003534375.1|  PREDICTED: cytokinin dehydrogenase 6-like          196   7e-56    Glycine max [soybeans]
ref|XP_008445865.1|  PREDICTED: cytokinin dehydrogenase 6               197   8e-56    Cucumis melo [Oriental melon]
gb|KHN17264.1|  Cytokinin dehydrogenase 7                               190   8e-56    Glycine soja [wild soybean]
ref|XP_004295395.2|  PREDICTED: cytokinin dehydrogenase 6-like          196   8e-56    Fragaria vesca subsp. vesca
ref|XP_007008757.1|  Cytokinin oxidase/dehydrogenase 6 isoform 1        196   9e-56    Theobroma cacao [chocolate]
ref|XP_010106427.1|  Cytokinin dehydrogenase 1                          196   9e-56    Morus notabilis
ref|XP_002876723.1|  predicted protein                                  196   1e-55    Arabidopsis lyrata subsp. lyrata
gb|AAO50082.1|  cytokinin dehydrogenase 3                               196   1e-55    Hordeum vulgare [barley]
ref|XP_008244287.1|  PREDICTED: cytokinin dehydrogenase 1               196   1e-55    Prunus mume [ume]
gb|KDP40485.1|  hypothetical protein JCGZ_24484                         195   1e-55    Jatropha curcas
gb|KHN11723.1|  Cytokinin dehydrogenase 6                               196   1e-55    Glycine soja [wild soybean]
ref|XP_009354403.1|  PREDICTED: cytokinin dehydrogenase 6-like          196   1e-55    Pyrus x bretschneideri [bai li]
gb|AAM08400.2|AF490591_1  cytokinin dehydrogenase 2                     196   1e-55    Hordeum vulgare [barley]
gb|EYU20769.1|  hypothetical protein MIMGU_mgv1a022053mg                196   1e-55    Erythranthe guttata [common monkey flower]
ref|XP_008444755.1|  PREDICTED: cytokinin dehydrogenase 5               196   1e-55    Cucumis melo [Oriental melon]
ref|XP_004303072.1|  PREDICTED: cytokinin dehydrogenase 6-like          195   2e-55    Fragaria vesca subsp. vesca
ref|XP_007162153.1|  hypothetical protein PHAVU_001G128800g             196   2e-55    Phaseolus vulgaris [French bean]
ref|XP_006604338.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    195   2e-55    
ref|XP_009142753.1|  PREDICTED: cytokinin dehydrogenase 1-like          195   2e-55    Brassica rapa
ref|XP_009335765.1|  PREDICTED: cytokinin dehydrogenase 5               195   2e-55    Pyrus x bretschneideri [bai li]
ref|XP_008375236.1|  PREDICTED: cytokinin dehydrogenase 6-like          195   3e-55    Malus domestica [apple tree]
gb|KJB58187.1|  hypothetical protein B456_009G198300                    195   3e-55    Gossypium raimondii
emb|CDP14175.1|  unnamed protein product                                192   3e-55    Coffea canephora [robusta coffee]
ref|XP_009408782.1|  PREDICTED: cytokinin dehydrogenase 5-like          194   3e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002308930.2|  hypothetical protein POPTR_0006s04650g             195   3e-55    Populus trichocarpa [western balsam poplar]
ref|XP_006576244.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    195   3e-55    
ref|XP_010061263.1|  PREDICTED: cytokinin dehydrogenase 5               194   4e-55    Eucalyptus grandis [rose gum]
ref|XP_002510450.1|  gulonolactone oxidase, putative                    194   4e-55    Ricinus communis
ref|XP_010539134.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    194   4e-55    Tarenaya hassleriana [spider flower]
gb|KHN17673.1|  Cytokinin dehydrogenase 3                               191   4e-55    Glycine soja [wild soybean]
ref|XP_004508239.1|  PREDICTED: cytokinin dehydrogenase 3-like          194   5e-55    Cicer arietinum [garbanzo]
ref|XP_001786014.1|  predicted protein                                  194   5e-55    Physcomitrella patens
ref|XP_008804537.1|  PREDICTED: cytokinin dehydrogenase 5-like          194   5e-55    Phoenix dactylifera
ref|XP_004288952.2|  PREDICTED: cytokinin dehydrogenase 3               194   5e-55    Fragaria vesca subsp. vesca
ref|XP_010468848.1|  PREDICTED: cytokinin dehydrogenase 6-like          194   6e-55    Camelina sativa [gold-of-pleasure]
ref|XP_001772547.1|  predicted protein                                  192   7e-55    Physcomitrella patens
emb|CDX79932.1|  BnaA05g02240D                                          194   7e-55    Brassica napus [oilseed rape]
ref|XP_007028626.1|  Cytokinin oxidase/dehydrogenase 1 isoform 1        194   7e-55    Theobroma cacao [chocolate]
gb|KJB78728.1|  hypothetical protein B456_013G014800                    194   7e-55    Gossypium raimondii
ref|XP_011048092.1|  PREDICTED: cytokinin dehydrogenase 1               194   9e-55    Populus euphratica
ref|XP_010275527.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    193   9e-55    Nelumbo nucifera [Indian lotus]
ref|XP_009368087.1|  PREDICTED: cytokinin dehydrogenase 6-like          193   1e-54    Pyrus x bretschneideri [bai li]
ref|XP_003595184.1|  Cytokinin dehydrogenase                            193   1e-54    Medicago truncatula
ref|XP_011467367.1|  PREDICTED: cytokinin dehydrogenase 1               193   1e-54    Fragaria vesca subsp. vesca
ref|XP_008367923.1|  PREDICTED: cytokinin dehydrogenase 3-like          193   1e-54    Malus domestica [apple tree]
ref|XP_009391555.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    193   2e-54    Musa acuminata subsp. malaccensis [pisang utan]
gb|AHL64253.1|  cytokinin dehydrogenase 5                               193   2e-54    Rosa canina [dog briar]
ref|XP_010672675.1|  PREDICTED: cytokinin dehydrogenase 5               192   2e-54    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009363232.1|  PREDICTED: cytokinin dehydrogenase 1-like          193   2e-54    Pyrus x bretschneideri [bai li]
ref|XP_002270841.2|  PREDICTED: cytokinin dehydrogenase 9               193   2e-54    Vitis vinifera
ref|XP_002300742.2|  cytokinin oxidase 6 family protein                 192   2e-54    Populus trichocarpa [western balsam poplar]
ref|XP_006838693.1|  hypothetical protein AMTR_s00002p00248240          192   2e-54    
ref|XP_011028922.1|  PREDICTED: cytokinin dehydrogenase 5-like          192   3e-54    Populus euphratica
ref|XP_010418548.1|  PREDICTED: cytokinin dehydrogenase 6               192   3e-54    Camelina sativa [gold-of-pleasure]
ref|XP_010254676.1|  PREDICTED: cytokinin dehydrogenase 5-like          192   3e-54    Nelumbo nucifera [Indian lotus]
ref|XP_004488057.1|  PREDICTED: cytokinin dehydrogenase 3-like          192   3e-54    
gb|KHN13439.1|  Cytokinin dehydrogenase 3                               190   3e-54    
emb|CDP07468.1|  unnamed protein product                                192   3e-54    
gb|KHN45882.1|  Cytokinin dehydrogenase 5                               189   3e-54    
gb|KDP38564.1|  hypothetical protein JCGZ_04489                         192   3e-54    
emb|CBI28611.3|  unnamed protein product                                193   3e-54    
ref|XP_007012819.1|  Cytokinin oxidase                                  192   4e-54    
ref|NP_001274957.1|  cytokinin oxidase/dehydrogenase precursor          192   4e-54    
ref|XP_008377186.1|  PREDICTED: cytokinin dehydrogenase 5-like          192   4e-54    
gb|KHN06618.1|  Cytokinin dehydrogenase 3                               189   4e-54    
ref|XP_007008758.1|  Cytokinin oxidase/dehydrogenase 6 isoform 2        191   5e-54    
ref|XP_009782890.1|  PREDICTED: cytokinin dehydrogenase 1-like          192   5e-54    
ref|XP_010110013.1|  Cytokinin dehydrogenase 5                          192   6e-54    
ref|XP_004291832.1|  PREDICTED: cytokinin dehydrogenase 5               191   6e-54    
ref|XP_004500977.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    189   6e-54    
ref|XP_006351290.1|  PREDICTED: cytokinin dehydrogenase 1-like          191   8e-54    
gb|KHN22222.1|  Cytokinin dehydrogenase 5                               189   8e-54    
gb|EPS70157.1|  hypothetical protein M569_04602                         191   8e-54    
gb|EMT11915.1|  Cytokinin dehydrogenase 1                               191   8e-54    
ref|NP_001275006.1|  cytokinin oxidase/dehydrogenase                    191   9e-54    
ref|XP_004493454.1|  PREDICTED: cytokinin dehydrogenase 1-like          191   9e-54    
ref|XP_009799177.1|  PREDICTED: cytokinin dehydrogenase 3-like          190   1e-53    
gb|KDO84681.1|  hypothetical protein CISIN_1g042782mg                   191   1e-53    
gb|KHG27003.1|  Cytokinin dehydrogenase 5 -like protein                 188   1e-53    
gb|KCW79507.1|  hypothetical protein EUGRSUZ_C00881                     190   1e-53    
ref|XP_002280797.1|  PREDICTED: cytokinin dehydrogenase 5 isoform X1    190   1e-53    
ref|XP_010047562.1|  PREDICTED: cytokinin dehydrogenase 3-like          190   1e-53    
ref|XP_006577980.1|  PREDICTED: cytokinin dehydrogenase 5-like          190   1e-53    
ref|XP_010036309.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    190   1e-53    
gb|ACM79256.1|  cytokinin oxidase/dehydrogenase                         190   2e-53    
ref|XP_010523657.1|  PREDICTED: cytokinin dehydrogenase 6               190   2e-53    
ref|XP_006473567.1|  PREDICTED: cytokinin dehydrogenase 5-like          191   2e-53    
ref|XP_009398389.1|  PREDICTED: cytokinin dehydrogenase 5               190   2e-53    
ref|NP_001243813.1|  cytokinin dehydrogenase 3-like                     190   2e-53    
ref|XP_010036308.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    190   2e-53    
ref|XP_003547474.1|  PREDICTED: cytokinin dehydrogenase 3-like          190   2e-53    
ref|NP_001266251.1|  cytokinin oxidase/dehydrogenase-like precursor     190   2e-53    
gb|KDO49370.1|  hypothetical protein CISIN_1g009793mg                   189   2e-53    
gb|EYU32888.1|  hypothetical protein MIMGU_mgv1a004444mg                189   2e-53    
ref|NP_200507.1|  cytokinin dehydrogenase 3                             189   2e-53    
ref|XP_002308300.2|  Cytokinin dehydrogenase 3 precursor family p...    189   2e-53    
emb|CBI19763.3|  unnamed protein product                                190   3e-53    
gb|ADT63069.1|  cytokinin oxidase                                       181   3e-53    
ref|XP_006475463.1|  PREDICTED: cytokinin dehydrogenase 3-like          189   3e-53    
ref|NP_001244908.1|  cytokinin oxidase/dehydrogenase-like 7 precu...    189   3e-53    
dbj|BAK52671.1|  cytokinin oxidase                                      189   3e-53    
gb|KJB83046.1|  hypothetical protein B456_013G227400                    189   3e-53    
ref|XP_007136628.1|  hypothetical protein PHAVU_009G060200g             189   3e-53    
ref|XP_008459369.1|  PREDICTED: cytokinin dehydrogenase 3-like          189   4e-53    
emb|CDY47521.1|  BnaAnng09190D                                          189   4e-53    
ref|XP_003542331.1|  PREDICTED: cytokinin dehydrogenase 3-like          189   4e-53    
gb|KGN66247.1|  hypothetical protein Csa_1G588560                       187   4e-53    
ref|XP_003581439.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    189   4e-53    
gb|AIU94750.1|  cytokinin oxidase                                       188   4e-53    
ref|XP_009116997.1|  PREDICTED: cytokinin dehydrogenase 6               189   4e-53    
ref|XP_004500976.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    189   4e-53    
emb|CDY11474.1|  BnaA09g40400D                                          187   4e-53    
ref|XP_011009888.1|  PREDICTED: cytokinin dehydrogenase 3               189   5e-53    
gb|KEH36208.1|  cytokinin oxidase/dehydrogenase-like protein            189   5e-53    
ref|XP_006390301.1|  hypothetical protein EUTSA_v10018378mg             189   5e-53    
ref|NP_001244909.1|  cytokinin oxidase/dehydrogenase-like 2             189   5e-53    
ref|XP_009106198.1|  PREDICTED: cytokinin dehydrogenase 5               189   5e-53    
ref|XP_011083611.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    189   5e-53    
ref|XP_006435071.1|  hypothetical protein CICLE_v10000709mg             189   5e-53    
ref|NP_191903.3|  cytokinin oxidase/dehydrogenase 6                     189   5e-53    
ref|XP_002889026.1|  hypothetical protein ARALYDRAFT_476695             189   5e-53    
ref|XP_009590336.1|  PREDICTED: cytokinin dehydrogenase 6-like          189   6e-53    
gb|KJB07273.1|  hypothetical protein B456_001G012300                    189   6e-53    
gb|EPS64605.1|  cytokinin oxidase                                       188   6e-53    
ref|XP_007221789.1|  hypothetical protein PRUPE_ppa003895mg             189   6e-53    
ref|XP_006292397.1|  hypothetical protein CARUB_v10018610mg             189   7e-53    
gb|KJB63590.1|  hypothetical protein B456_010G007500                    189   7e-53    
ref|XP_009609662.1|  PREDICTED: cytokinin dehydrogenase 5               188   7e-53    
ref|XP_003527677.1|  PREDICTED: cytokinin dehydrogenase 5-like          189   7e-53    
ref|XP_009602355.1|  PREDICTED: cytokinin dehydrogenase 3-like          188   7e-53    
ref|XP_009784170.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    188   8e-53    
gb|KHG00982.1|  Cytokinin dehydrogenase 5 -like protein                 188   8e-53    
emb|CDX73174.1|  BnaC06g36220D                                          188   8e-53    
ref|XP_006451484.1|  hypothetical protein CICLE_v10007992mg             188   9e-53    
ref|XP_004152677.1|  PREDICTED: cytokinin dehydrogenase 5-like          188   9e-53    
gb|KHN35852.1|  Cytokinin dehydrogenase 3                               188   9e-53    
gb|AGT15872.1|  cytokinin dehydrogenase                                 188   1e-52    
gb|KFK41981.1|  hypothetical protein AALP_AA2G196900                    188   1e-52    
ref|XP_009761052.1|  PREDICTED: cytokinin dehydrogenase 5               188   1e-52    
emb|CDY62828.1|  BnaCnng41060D                                          187   1e-52    
dbj|BAM74650.1|  cytokinin oxidase/dehydrogenase                        188   1e-52    
ref|XP_007138720.1|  hypothetical protein PHAVU_009G231700g             187   1e-52    
ref|XP_003534923.1|  PREDICTED: cytokinin dehydrogenase 3-like          188   1e-52    
ref|XP_010451653.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    187   2e-52    
ref|XP_011048828.1|  PREDICTED: cytokinin dehydrogenase 5-like          187   2e-52    
ref|XP_002307681.1|  hypothetical protein POPTR_0005s25380g             187   2e-52    
ref|XP_008221343.1|  PREDICTED: cytokinin dehydrogenase 5               187   2e-52    
emb|CDY51023.1|  BnaC09g33450D                                          186   2e-52    
ref|XP_004251670.1|  PREDICTED: cytokinin dehydrogenase 3               187   3e-52    
ref|NP_177678.2|  cytokinin dehydrogenase 5                             187   3e-52    
dbj|BAF00384.1|  cytokinin oxidase -like protein                        186   3e-52    
ref|XP_004173096.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    186   3e-52    
dbj|BAM74648.1|  cytokinin oxidase/dehydrogenase                        187   3e-52    
emb|CDX76698.1|  BnaC08g32840D                                          186   4e-52    
ref|XP_007017645.1|  Cytokinin oxidase 5                                186   4e-52    
ref|XP_004144003.1|  PREDICTED: cytokinin dehydrogenase 3-like          186   4e-52    
ref|XP_004158449.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    186   4e-52    
ref|XP_008450862.1|  PREDICTED: cytokinin dehydrogenase 3-like          186   5e-52    
ref|XP_009610079.1|  PREDICTED: cytokinin dehydrogenase 3               186   5e-52    
ref|XP_011078924.1|  PREDICTED: cytokinin dehydrogenase 1-like          186   7e-52    
ref|XP_010047563.1|  PREDICTED: cytokinin dehydrogenase 3-like          186   7e-52    
ref|XP_002514119.1|  gulonolactone oxidase, putative                    186   7e-52    
emb|CDY50467.1|  BnaA10g28940D                                          184   8e-52    
ref|XP_008672378.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    186   8e-52    
gb|ADP38079.1|  cytokinin dehydrogenase 4                               186   9e-52    
emb|CAN81010.1|  hypothetical protein VITISV_017949                     185   9e-52    
ref|XP_008663392.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    186   9e-52    
gb|KEH32513.1|  cytokinin oxidase/dehydrogenase-like protein            185   1e-51    
ref|XP_006849989.1|  hypothetical protein AMTR_s00022p00164680          180   1e-51    
ref|XP_006353538.1|  PREDICTED: cytokinin dehydrogenase 3               185   1e-51    
ref|XP_002455003.1|  hypothetical protein SORBIDRAFT_03g002810          186   1e-51    
ref|XP_010670377.1|  PREDICTED: cytokinin dehydrogenase 6-like          185   1e-51    
ref|NP_001185960.1|  cytokinin dehydrogenase 4b precursor               185   1e-51    
gb|AFW84922.1|  hypothetical protein ZEAMMB73_083779                    185   1e-51    
ref|XP_010451656.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    185   1e-51    
gb|AAG30909.1|AF303982_1  cytokinin oxidase                             185   2e-51    
ref|XP_004141168.1|  PREDICTED: uncharacterized protein LOC101212791    187   2e-51    
gb|KCW45277.1|  hypothetical protein EUGRSUZ_L01060                     182   2e-51    
ref|NP_001275401.1|  cytokinin oxidase/dehydrogenase 2                  184   2e-51    
ref|XP_010242231.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    184   2e-51    
ref|XP_010242232.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    184   2e-51    
ref|XP_009120210.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    184   2e-51    
ref|XP_009793978.1|  PREDICTED: cytokinin dehydrogenase 3               184   3e-51    
ref|XP_002866175.1|  hypothetical protein ARALYDRAFT_918856             183   4e-51    
ref|XP_002446804.1|  hypothetical protein SORBIDRAFT_06g022930          184   4e-51    
sp|A2XVN3.1|CKX8_ORYSI  RecName: Full=Cytokinin dehydrogenase 8; ...    183   5e-51    
ref|XP_009400307.1|  PREDICTED: cytokinin dehydrogenase 3-like          183   5e-51    
ref|XP_006653607.1|  PREDICTED: cytokinin dehydrogenase 8-like          182   5e-51    
ref|XP_009784168.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    183   6e-51    
gb|EEC83684.1|  hypothetical protein OsI_29488                          181   6e-51    
ref|XP_010443356.1|  PREDICTED: cytokinin dehydrogenase 3               183   7e-51    
ref|XP_002458582.1|  hypothetical protein SORBIDRAFT_03g036160          183   7e-51    
ref|XP_006401261.1|  hypothetical protein EUTSA_v10013271mg             182   8e-51    
ref|XP_004976275.1|  PREDICTED: cytokinin dehydrogenase 8-like          183   8e-51    
ref|XP_010040366.1|  PREDICTED: cytokinin dehydrogenase 3-like          183   8e-51    
gb|KGN59504.1|  hypothetical protein Csa_3G823030                       180   9e-51    
gb|KCW60469.1|  hypothetical protein EUGRSUZ_H03195                     182   9e-51    
ref|XP_010024059.1|  PREDICTED: cytokinin dehydrogenase 3-like          182   1e-50    
ref|XP_004970152.1|  PREDICTED: cytokinin dehydrogenase 5-like          182   1e-50    
ref|XP_010090055.1|  Cytokinin dehydrogenase 3                          182   2e-50    
ref|NP_001185402.1|  cytokinin dehydrogenase 5                          182   2e-50    
ref|XP_008813776.1|  PREDICTED: cytokinin dehydrogenase 3-like          182   2e-50    
ref|XP_010940748.1|  PREDICTED: cytokinin dehydrogenase 3-like          182   3e-50    
ref|XP_009393975.1|  PREDICTED: cytokinin dehydrogenase 6-like          181   3e-50    
ref|XP_007154651.1|  hypothetical protein PHAVU_003G136400g             181   4e-50    
ref|NP_001185961.1|  cytokinin dehydrogenase 12                         181   5e-50    
ref|NP_001275030.1|  cytokinin oxidase/dehydrogenase 1 precursor        181   6e-50    
gb|EAY85042.1|  hypothetical protein OsI_06399                          180   7e-50    
gb|EPS73626.1|  hypothetical protein M569_01132                         180   7e-50    
ref|XP_009120209.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    180   8e-50    
gb|KJB65179.1|  hypothetical protein B456_010G083400                    179   1e-49    
gb|KCW60467.1|  hypothetical protein EUGRSUZ_H03190                     178   1e-49    
emb|CDP03155.1|  unnamed protein product                                179   2e-49    
ref|XP_010026877.1|  PREDICTED: cytokinin dehydrogenase 3-like          179   2e-49    
gb|AGW52152.1|  CKX3                                                    179   2e-49    
ref|XP_009401857.1|  PREDICTED: cytokinin dehydrogenase 3-like          179   2e-49    
gb|KDP33841.1|  hypothetical protein JCGZ_07412                         179   2e-49    
ref|XP_008242354.1|  PREDICTED: cytokinin dehydrogenase 3-like          179   2e-49    
ref|XP_006280310.1|  hypothetical protein CARUB_v10026233mg             179   2e-49    
gb|AEK84310.1|  cytokinin oxidase/dehydrogenase                         179   2e-49    
gb|EAZ22265.1|  hypothetical protein OsJ_05920                          178   2e-49    
gb|ADG57789.1|  cytokinin oxidase 2                                     179   3e-49    
ref|XP_009408848.1|  PREDICTED: cytokinin dehydrogenase 6-like          179   3e-49    
ref|XP_004971745.1|  PREDICTED: cytokinin dehydrogenase 2-like          179   3e-49    
ref|XP_008451152.1|  PREDICTED: cytokinin dehydrogenase 4               178   3e-49    
sp|Q6YW50.1|CKX7_ORYSJ  RecName: Full=Cytokinin dehydrogenase 7; ...    178   4e-49    
ref|XP_008231518.1|  PREDICTED: cytokinin dehydrogenase 6-like          174   4e-49    
ref|XP_003564990.2|  PREDICTED: cytokinin dehydrogenase 2-like          179   4e-49    
gb|AEC33261.1|  cytokinin oxidase/dehydrogenase                         178   6e-49    
ref|XP_008797779.1|  PREDICTED: cytokinin dehydrogenase 6-like          178   6e-49    
gb|AFK79773.1|  cytokinin oxidase/dehydrogenase                         178   7e-49    
ref|XP_007138721.1|  hypothetical protein PHAVU_009G231800g             177   7e-49    
ref|XP_007203595.1|  hypothetical protein PRUPE_ppb021417mg             177   8e-49    
gb|AES65430.2|  cytokinin oxidase/dehydrogenase-like protein            177   1e-48    
ref|XP_004967225.1|  PREDICTED: cytokinin dehydrogenase 10-like         177   1e-48    
gb|ADG57787.1|  cytokinin oxidase 2                                     177   1e-48    
gb|EAZ19670.1|  hypothetical protein OsJ_35246                          175   1e-48    
ref|XP_010262099.1|  PREDICTED: cytokinin dehydrogenase 3-like          177   1e-48    
gb|AFK79776.1|  cytokinin oxidase/dehydrogenase                         175   1e-48    
emb|CBI37291.3|  unnamed protein product                                176   1e-48    
gb|EMS47570.1|  Cytokinin dehydrogenase 2                               177   1e-48    
ref|XP_002263646.1|  PREDICTED: cytokinin dehydrogenase 3               176   2e-48    
gb|AEV76971.1|  cytokinin oxidase/dehydrogenase 2                       177   2e-48    
gb|AFK79770.1|  cytokinin oxidase/dehydrogenase                         177   2e-48    
dbj|BAK05047.1|  predicted protein                                      177   2e-48    
ref|XP_003635626.2|  PREDICTED: cytokinin dehydrogenase 3-like          173   2e-48    
emb|CBI41113.3|  unnamed protein product                                173   2e-48    
ref|XP_004507936.1|  PREDICTED: cytokinin dehydrogenase 3-like          176   3e-48    
ref|XP_010227585.1|  PREDICTED: cytokinin dehydrogenase 10-like         176   3e-48    
ref|XP_003571898.1|  PREDICTED: cytokinin dehydrogenase 3               176   3e-48    
ref|XP_007154653.1|  hypothetical protein PHAVU_003G1365000g            174   4e-48    
ref|XP_009630860.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    175   4e-48    
ref|XP_003534915.2|  PREDICTED: cytokinin dehydrogenase 3-like          176   4e-48    
emb|CBI27904.3|  unnamed protein product                                175   4e-48    
gb|EEE65911.1|  hypothetical protein OsJ_21758                          173   4e-48    
ref|XP_003571719.1|  PREDICTED: cytokinin dehydrogenase 7-like          176   4e-48    
ref|XP_010696503.1|  PREDICTED: cytokinin dehydrogenase 3               176   4e-48    
ref|XP_002279519.1|  PREDICTED: cytokinin dehydrogenase 3               175   4e-48    
gb|KEH32514.1|  cytokinin oxidase/dehydrogenase-like protein            175   4e-48    
emb|CBI33301.3|  unnamed protein product                                173   5e-48    
ref|XP_003635659.1|  PREDICTED: cytokinin dehydrogenase 3-like          173   5e-48    
ref|XP_009630800.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    175   6e-48    
emb|CAN77185.1|  hypothetical protein VITISV_039458                     174   9e-48    
ref|XP_008776727.1|  PREDICTED: cytokinin dehydrogenase 3-like          172   9e-48    
ref|XP_009126914.1|  PREDICTED: cytokinin dehydrogenase 3               174   9e-48    
dbj|BAK52672.1|  cytokinin oxidase                                      175   9e-48    
ref|XP_008805777.1|  PREDICTED: cytokinin dehydrogenase 6-like          175   1e-47    
gb|AFK79768.1|  cytokinin oxidase/dehydrogenase                         175   1e-47    
gb|KCW60470.1|  hypothetical protein EUGRSUZ_H03197                     174   1e-47    
ref|XP_010026880.1|  PREDICTED: cytokinin dehydrogenase 3-like          174   1e-47    
gb|AFK79783.1|  cytokinin oxidase/dehydrogenase                         169   1e-47    
ref|XP_006662450.1|  PREDICTED: cytokinin dehydrogenase 3-like          173   1e-47    
ref|XP_006595335.1|  PREDICTED: cytokinin dehydrogenase 3-like          174   2e-47    
gb|AFW80325.1|  hypothetical protein ZEAMMB73_057649                    174   2e-47    
ref|NP_001185958.1|  cytokinin dehydrogenase 5 precursor                174   2e-47    
ref|NP_001064886.1|  Os10g0483500                                       174   2e-47    



>ref|XP_009593487.1| PREDICTED: cytokinin dehydrogenase 7 [Nicotiana tomentosiformis]
Length=556

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTS VTELEVVTGNG+  VCS + NSELF+SVLGGLGQFGIITRAR++LQPAPD
Sbjct  214  AFRYGPQTSTVTELEVVTGNGERTVCSNSQNSELFFSVLGGLGQFGIITRARILLQPAPD  273

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRVVYS F++FT+DAE LV   ESFDYVEGFVFVNSDDPVNGW +VPL+S+H  +P
Sbjct  274  MVRWIRVVYSEFDEFTRDAELLVMSPESFDYVEGFVFVNSDDPVNGWPSVPLDSNHSFDP  333

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            T++P + GPVLYCLE+ALHY N+DHPST+N   E+L G  R+ + LRFE++++YMNFLLR
Sbjct  334  THLPTNTGPVLYCLEVALHYHNHDHPSTVNMMVEKLFGRSRFIEHLRFEIDLNYMNFLLR  393

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            VK+ E+ AR NG WD PHPWLN+F+S
Sbjct  394  VKRVEQMARDNGIWDAPHPWLNMFVS  419



>ref|XP_011081605.1| PREDICTED: cytokinin dehydrogenase 7 [Sesamum indicum]
Length=520

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 177/207 (86%), Gaps = 2/207 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            F +GPQT NVTELEVVTGNGD+ VCS+  N ELF+SVLGGLGQFGIITRARV+LQPAPDM
Sbjct  177  FIYGPQTENVTELEVVTGNGDVLVCSKNENPELFFSVLGGLGQFGIITRARVLLQPAPDM  236

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIRVVYS F +FT+DAE LVTR E  SFDY+EGFVFVNSDDPVNGW++VPL+SD   +
Sbjct  237  VRWIRVVYSEFSEFTRDAEFLVTRAEGDSFDYLEGFVFVNSDDPVNGWASVPLDSDQFFD  296

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P+ IP+ AGPVLYCLE+ALHYKN D PS ++ ++ERL+GGLR+ + LRF V+V YM FLL
Sbjct  297  PSCIPRAAGPVLYCLEVALHYKNEDPPSAVDMRSERLMGGLRFVEGLRFSVDVGYMEFLL  356

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RVK+ EE A+ANG WD PHPWLNLF+S
Sbjct  357  RVKRAEEEAKANGIWDAPHPWLNLFVS  383



>ref|XP_009781977.1| PREDICTED: cytokinin dehydrogenase 7 [Nicotiana sylvestris]
Length=556

 Score =   325 bits (832),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTS VTELEVVTGNG+  VCS + NSELF+SVLGGLGQFGIITRARVMLQPAPD
Sbjct  214  AFRYGPQTSTVTELEVVTGNGERTVCSNSQNSELFFSVLGGLGQFGIITRARVMLQPAPD  273

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRVVYS F++FT+DAE LV   ESFDYVEGFVFVNSDDPVNGW +VPL+S+H  +P
Sbjct  274  MVRWIRVVYSEFDEFTRDAELLVMSPESFDYVEGFVFVNSDDPVNGWPSVPLDSNHSFDP  333

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            T +P + GPVLYCLE+ALHY N+DHP+T+N   E+L+  LR+ + LRFE +++YM+FLLR
Sbjct  334  TQLPTNTGPVLYCLEVALHYHNHDHPTTVNMMVEKLLARLRFIEHLRFEADMTYMDFLLR  393

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            VK+ E+ AR NG WD PHPWLN+F+S
Sbjct  394  VKRVEQMARDNGIWDAPHPWLNMFVS  419



>ref|XP_011102038.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 7-like 
[Sesamum indicum]
Length=513

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF +GPQT NVTELEVVTGNGD+ VCS   NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  168  AFLYGPQTENVTELEVVTGNGDVLVCSNNQNSELFFSVLGGLGQFGIITRARVLLQPAPD  227

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS F +FT+DAE LVTR +  SFDYVEGFVFVNSDDPVNGW +VPLN D   
Sbjct  228  MVRWIRVVYSEFSEFTRDAELLVTRGDGNSFDYVEGFVFVNSDDPVNGWPSVPLNPDQPF  287

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +  +AGPVLYCLE+ALHYKN D PS I+++ ERLVGGL++ + LR EV+V Y++FL
Sbjct  288  DPTRMTPNAGPVLYCLEVALHYKNEDGPSAIDERVERLVGGLKFLEGLRLEVDVGYIDFL  347

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            +RVK+ EE A+A+G WD PHPWLNLF+S
Sbjct  348  VRVKRAEEGAKASGIWDAPHPWLNLFVS  375



>ref|XP_007012417.1| Cytokinin oxidase [Theobroma cacao]
 gb|EOY30036.1| Cytokinin oxidase [Theobroma cacao]
Length=515

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I+VCSET N ELF+ VLGGLGQFGIITRARV LQ APD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGEISVCSETQNPELFFGVLGGLGQFGIITRARVKLQLAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS FEDFT+DAE LVT+ E  SFDYVEGFVF N+DD VNGWS+VPL  D + 
Sbjct  232  MVRWIRVVYSEFEDFTRDAEFLVTQKEGESFDYVEGFVFANNDDQVNGWSSVPLGPDQEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P +IP+ AG VLYCLE+A HY+N+DHPST++    RL+G L + + L+F+V+VSY+ FL
Sbjct  292  DPAHIPQTAGSVLYCLEVAFHYRNSDHPSTVDTAVSRLLGRLGFVRGLKFQVDVSYVEFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EEHA+ANG WD+PHPWLNLF+S
Sbjct  352  LRVKRAEEHAKANGIWDSPHPWLNLFVS  379



>ref|XP_009126512.1| PREDICTED: cytokinin dehydrogenase 7-like [Brassica rapa]
 emb|CDY09108.1| BnaA02g05340D [Brassica napus]
Length=517

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 181/208 (87%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  175  AFRYGPQTSNVTELDVVTGNGDVVTCSEVENSELFFSVLGGLGQFGIITRARVLLQPAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY+ F++FT+DAE LV++  + SFDYVEGFVFVN DDPVNGW TVPL+ DH  
Sbjct  235  MVRWIRIVYTEFDEFTRDAEWLVSQKDESSFDYVEGFVFVNGDDPVNGWPTVPLHPDHDF  294

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+ +G VLYCLE+ALHY+++D  ST++K+ ERL+G LR+ + LRFEV++ Y++FL
Sbjct  295  DPTQLPQSSGSVLYCLELALHYRDSDSNSTVDKRVERLIGRLRFVEGLRFEVDLPYVDFL  354

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ NGTW+TPHPWLNLF+S
Sbjct  355  LRVKRAEEIAKVNGTWETPHPWLNLFVS  382



>gb|AEK97325.1| chromoplast cytokinin dehydrogenase/ oxidoreductase [Brassica 
rapa var. parachinensis]
Length=227

 Score =   310 bits (793),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 177/205 (86%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  23   AFRYGPQTSNVTELDVVTGNGDVVTCSEMENSELFFSVLGGLGQFGIITRARVLLQPAPD  82

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY+ F++FT+DAE LV++  + SFDYVEGFVFVN DDPVNGW TVPL+ D   
Sbjct  83   MVRWIRIVYAEFDEFTRDAEWLVSQKDESSFDYVEGFVFVNGDDPVNGWPTVPLHPDQDF  142

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+ +G VLYCLE+ALHY+++D  S+++K+ ERL+G LR+ + LRFEV++ Y++FL
Sbjct  143  DPTRLPQSSGSVLYCLELALHYRDSDSNSSVDKRVERLIGRLRFDEGLRFEVDLPYVDFL  202

Query  536  LRVKKGEEHARANGTWDTPHPWLNL  610
            LRVK+ EE A+ NGTW+TPHPWLNL
Sbjct  203  LRVKRSEEIAKVNGTWETPHPWLNL  227



>gb|KJB65480.1| hypothetical protein B456_010G096700 [Gossypium raimondii]
Length=412

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 170/208 (82%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG GDI VCSET N ELF+  LGGLGQFGIITRARV LQPAPD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGDITVCSETQNPELFFGALGGLGQFGIITRARVKLQPAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ FE+FT+DAE LV++  DESFDYVEGFVF N+DDPVNGW +V LN D + 
Sbjct  232  MVRWIRVVYAEFEEFTRDAELLVSQKEDESFDYVEGFVFCNNDDPVNGWPSVQLNPDQEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NP ++P+ AGPVLYCLE+  HY+N+D PST++    RLV GL +   L  +V+VSYM FL
Sbjct  292  NPAHLPQTAGPVLYCLELGFHYRNSDQPSTVDMAVSRLVRGLGFVDGLISQVDVSYMGFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ E+ A+ANG WD PHPWLNLF+S
Sbjct  352  LRVKRAEQDAKANGVWDNPHPWLNLFVS  379



>ref|NP_850863.1| cytokinin dehydrogenase 7 [Arabidopsis thaliana]
 sp|Q9FUJ1.1|CKX7_ARATH RecName: Full=Cytokinin dehydrogenase 7; AltName: Full=Cytokinin 
oxidase 7; Short=AtCKX5; Short=AtCKX7; Short=CKO7 [Arabidopsis 
thaliana]
 gb|AAG30908.1|AF303981_1 cytokinin oxidase [Arabidopsis thaliana]
 gb|AAO73882.1| FAD-linked oxidoreductase family [Arabidopsis thaliana]
 gb|AED92951.1| cytokinin dehydrogenase 7 [Arabidopsis thaliana]
Length=524

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 179/208 (86%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  181  AFRYGPQTSNVTELDVVTGNGDVVTCSEIENSELFFSVLGGLGQFGIITRARVLLQPAPD  240

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F++FTQDAE LV++  + SFDYVEGFVFVN  DPVNGW TVPL+ DH+ 
Sbjct  241  MVRWIRVVYTEFDEFTQDAEWLVSQKNESSFDYVEGFVFVNGADPVNGWPTVPLHPDHEF  300

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+  G VLYCLE+ LHY+++D  STI+K+ ERL+G LR+ + LRFEV++ Y++FL
Sbjct  301  DPTRLPQSCGSVLYCLELGLHYRDSDSNSTIDKRVERLIGRLRFNEGLRFEVDLPYVDFL  360

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ NGTW+TPHPWLNLF+S
Sbjct  361  LRVKRSEEIAKENGTWETPHPWLNLFVS  388



>gb|KDP34032.1| hypothetical protein JCGZ_07603 [Jatropha curcas]
Length=516

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF +GPQTSNVTEL+VVTG GDI  CSET NSELF+  LGGLGQFGIITRARV LQ APD
Sbjct  171  AFIYGPQTSNVTELDVVTGKGDILTCSETENSELFFGALGGLGQFGIITRARVKLQSAPD  230

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS FE+FT+DAE LVTR   ESFDYVEGFVFVNSDDPVNGW +VPL+ DH  
Sbjct  231  MVRWIRVVYSEFEEFTRDAEWLVTRPEGESFDYVEGFVFVNSDDPVNGWPSVPLDPDHGF  290

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            + T IP+ AGPVLYCLE+ALHY+NN+H ST++     L+G LR+ + L+F+V+V+Y++FL
Sbjct  291  DRTAIPRTAGPVLYCLEVALHYQNNEHTSTVDTVVNSLLGRLRFVEDLQFQVDVNYVDFL  350

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EEHARANG WD+PHPWLNLF+S
Sbjct  351  LRVKRVEEHARANGIWDSPHPWLNLFVS  378



>ref|XP_006367057.1| PREDICTED: cytokinin dehydrogenase 7-like [Solanum tuberosum]
Length=542

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFRFGPQTS+VTELEVVTGNG+  VCS + NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  200  AFRFGPQTSSVTELEVVTGNGEKIVCSNSQNSELFFSVLGGLGQFGIITRARVLLQPAPD  259

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRVVYS FEDFT DAE L+T  E+F+YVEGFVFVNSDDPV GW +VPLNS+   +P
Sbjct  260  MVRWIRVVYSEFEDFTHDAELLITSQETFNYVEGFVFVNSDDPVTGWPSVPLNSNQSFDP  319

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            T +PK  GPVLY LE+ LHY N+D PST+N   E+L+G L+Y +  RFE N++YM+FLLR
Sbjct  320  TLLPKKTGPVLYYLELVLHYNNHDDPSTLNMMVEKLLGKLKYLEHFRFETNLTYMDFLLR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            V   EE AR +G W TPHPWLN+FIS
Sbjct  380  VDHVEEAARGSGIWATPHPWLNMFIS  405



>ref|XP_006287493.1| hypothetical protein CARUB_v10000702mg [Capsella rubella]
 gb|EOA20391.1| hypothetical protein CARUB_v10000702mg [Capsella rubella]
Length=526

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  183  AFRYGPQTSNVTELDVVTGNGDVVTCSEVENSELFFSVLGGLGQFGIITRARVLLQPAPD  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-RDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVRWIRVVY+ F+DFT+DAE LV+ +DES  FDYVEGFVFVN DDPVNGW TVPL+ DH 
Sbjct  243  MVRWIRVVYAEFDDFTRDAEWLVSQKDESSSFDYVEGFVFVNGDDPVNGWPTVPLHPDHY  302

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +PT +P+ +G VLYCLE+ LHY+++D  ST++K+ ERL+G L++ + LRFEV++SY++F
Sbjct  303  FDPTRLPQSSGSVLYCLELGLHYRDSDSNSTVDKRVERLIGRLKFNEGLRFEVDLSYVDF  362

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EE A+  GTW+TPHPWLNLF+S
Sbjct  363  LLRVKRSEEIAKEIGTWETPHPWLNLFVS  391



>gb|KFK26358.1| hypothetical protein AALP_AA8G238000 [Arabis alpina]
Length=518

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 179/208 (86%), Gaps = 3/208 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR+GPQTSNVTELEVVTGNGD+  CSE  NSELFYSVLGGLGQFGIITRARV+LQPAPDM
Sbjct  176  FRYGPQTSNVTELEVVTGNGDVVTCSEIENSELFYSVLGGLGQFGIITRARVLLQPAPDM  235

Query  185  VRWIRVVYSAFEDFTQDAESLVT-RDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            VRWIRVVY+ F++FT+DAE LV+ +DES  FDYVEGFVFVN DDPVNGW ++PL+ DH  
Sbjct  236  VRWIRVVYTEFDEFTRDAEWLVSQKDESSSFDYVEGFVFVNGDDPVNGWPSIPLHPDHDF  295

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+ +G VLYCLE+ LHY N+D  ST++K+ ++L+G LR+   LRFE+++SY++F+
Sbjct  296  DPTRLPQSSGSVLYCLELGLHYMNSDSNSTVDKRVDKLIGRLRFVDGLRFEIDLSYVDFI  355

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ NGTW+TPHPWLNLF+S
Sbjct  356  LRVKRSEEIAKVNGTWETPHPWLNLFVS  383



>ref|XP_010454451.1| PREDICTED: cytokinin dehydrogenase 7-like [Camelina sativa]
Length=521

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGI+TRARV+LQPAPD
Sbjct  178  AFRYGPQTSNVTELDVVTGNGDVVTCSEVENSELFFSVLGGLGQFGIVTRARVLLQPAPD  237

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-RDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVRWIRVVY+ F++FT+DAE LV+ +DES  FDYVEGFVFVN DDPVNGW TVPL+ DH 
Sbjct  238  MVRWIRVVYTEFDEFTRDAEWLVSQKDESPSFDYVEGFVFVNDDDPVNGWPTVPLHPDHD  297

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +PT +P+ +G VLYCLE+ LHY+++D  ST++K+ ERL+G LR+ + LRFEV++SY++F
Sbjct  298  FDPTRLPQSSGSVLYCLELGLHYRDSDSNSTVDKRVERLIGRLRFIEGLRFEVDLSYVDF  357

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EE A+  GTW+TPHPWLNLF+S
Sbjct  358  LLRVKRSEEIAKEIGTWETPHPWLNLFVS  386



>emb|CDY16602.1| BnaC09g36710D [Brassica napus]
Length=464

 Score =   314 bits (805),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 180/208 (87%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  122  AFRYGPQTSNVTELDVVTGNGDVVTCSEMENSELFFSVLGGLGQFGIITRARVLLQPAPD  181

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY+ F++FT+DAE LV++  + SFDYVEGFVFVN DDPVNGW TVPL+ D   
Sbjct  182  MVRWIRIVYAEFDEFTRDAEWLVSQKDESSFDYVEGFVFVNGDDPVNGWPTVPLHPDQDF  241

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+ +G VLYCLE+ALHY+++D  S+++K+ ERL+G LR+ + LRFEV++ Y++FL
Sbjct  242  DPTRLPQSSGSVLYCLELALHYRDSDSNSSVDKRMERLLGRLRFDEGLRFEVDLPYVDFL  301

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ NGTW+TPHPWLNLF+S
Sbjct  302  LRVKRSEEIAKVNGTWETPHPWLNLFVS  329



>gb|KHG16444.1| Cytokinin dehydrogenase 7 -like protein [Gossypium arboreum]
Length=512

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 171/208 (82%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG GDI VCSET N ELF+  LGGLGQFGIITRARV LQ APD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGDITVCSETQNPELFFGALGGLGQFGIITRARVKLQLAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ FE+FT+DAE LV++  DESFDYVEGFVF N+DDPVNGW +V LN D + 
Sbjct  232  MVRWIRVVYAEFEEFTRDAEFLVSQKEDESFDYVEGFVFCNNDDPVNGWPSVQLNPDQEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NP ++P+ AGPVLYCLE+A HY+N+D PST++    RLVGGL +   L  +V+VSYM FL
Sbjct  292  NPAHLPQTAGPVLYCLELAFHYRNSDQPSTVDMAVSRLVGGLGFVDGLISQVDVSYMGFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ E+ A+ANG WD PHPWLNLF+S
Sbjct  352  LRVKRAEQDAKANGVWDNPHPWLNLFVS  379



>pdb|2EXR|A Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE (CKX) 
FROM Arabidopsis Thaliana At5g21482
 pdb|2Q4W|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Cytokinin OxidaseDEHYDROGENASE (CKX) FROM ARABIDOPSIS THALIANA 
AT5G21482
Length=524

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 178/208 (86%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  181  AFRYGPQTSNVTELDVVTGNGDVVTCSEIENSELFFSVLGGLGQFGIITRARVLLQPAPD  240

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             VRWIRVVY+ F++FTQDAE LV++  + SFDYVEGFVFVN  DPVNGW TVPL+ DH+ 
Sbjct  241  XVRWIRVVYTEFDEFTQDAEWLVSQKNESSFDYVEGFVFVNGADPVNGWPTVPLHPDHEF  300

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+  G VLYCLE+ LHY+++D  STI+K+ ERL+G LR+ + LRFEV++ Y++FL
Sbjct  301  DPTRLPQSCGSVLYCLELGLHYRDSDSNSTIDKRVERLIGRLRFNEGLRFEVDLPYVDFL  360

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ NGTW+TPHPWLNLF+S
Sbjct  361  LRVKRSEEIAKENGTWETPHPWLNLFVS  388



>dbj|BAM74649.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=516

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            F +GPQT NVTELEVVTGNGD++VCS++ NSELF+SVLGGLGQFG+ITRARV+LQPAP M
Sbjct  173  FLYGPQTENVTELEVVTGNGDVSVCSKSQNSELFFSVLGGLGQFGVITRARVLLQPAPHM  232

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRVVYS F DFT+D+E+LVT  ++FDYVEGFVFVN DDPVNGW +VPL+ D  L+PT
Sbjct  233  VRWIRVVYSDFSDFTRDSEALVTTGDTFDYVEGFVFVNGDDPVNGWPSVPLDPDQVLDPT  292

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
             I   AGPVLYCLE+ALHY N D    + ++ ++L+G LR+ + LRFEV+++Y  FLLRV
Sbjct  293  RIQSSAGPVLYCLEVALHYNNEDPTFAVEERVDKLLGRLRFVEGLRFEVDMAYTEFLLRV  352

Query  545  KKGEEHARANGTWDTPHPWLNLFIS  619
            K+ E+HARANGTWD PHPWLNLF+S
Sbjct  353  KRAEQHARANGTWDAPHPWLNLFVS  377



>gb|KJB65479.1| hypothetical protein B456_010G096700 [Gossypium raimondii]
Length=512

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 170/208 (82%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG GDI VCSET N ELF+  LGGLGQFGIITRARV LQPAPD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGDITVCSETQNPELFFGALGGLGQFGIITRARVKLQPAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ FE+FT+DAE LV++  DESFDYVEGFVF N+DDPVNGW +V LN D + 
Sbjct  232  MVRWIRVVYAEFEEFTRDAELLVSQKEDESFDYVEGFVFCNNDDPVNGWPSVQLNPDQEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NP ++P+ AGPVLYCLE+  HY+N+D PST++    RLV GL +   L  +V+VSYM FL
Sbjct  292  NPAHLPQTAGPVLYCLELGFHYRNSDQPSTVDMAVSRLVRGLGFVDGLISQVDVSYMGFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ E+ A+ANG WD PHPWLNLF+S
Sbjct  352  LRVKRAEQDAKANGVWDNPHPWLNLFVS  379



>ref|XP_010420976.1| PREDICTED: cytokinin dehydrogenase 7 [Camelina sativa]
Length=521

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+V+TGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  178  AFRYGPQTSNVTELDVITGNGDVVTCSEVENSELFFSVLGGLGQFGIITRARVLLQPAPD  237

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-RDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVRWIRVVY+ F++FT+DAE LV+ +DES  FDYVEGFVFVN DDPVNGW TVPL+ DH 
Sbjct  238  MVRWIRVVYTEFDEFTRDAEWLVSQKDESSSFDYVEGFVFVNGDDPVNGWPTVPLHPDHD  297

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +PT +P+ +G VLYCLE+ LHY+++D  ST++K+ ERL+  LR+ + LRFEV++SY++F
Sbjct  298  FDPTRLPQSSGSVLYCLELCLHYRDSDSNSTVDKRVERLIERLRFIEGLRFEVDLSYVDF  357

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EE A+  GTW+TPHPWLNLF+S
Sbjct  358  LLRVKRSEEIAKEIGTWETPHPWLNLFVS  386



>emb|CDP13465.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 172/209 (82%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQT NVTELEVVTG G+I  CS   NS+LF+SVLGGLGQFGIITRARV+LQP+P 
Sbjct  171  AFRYGPQTENVTELEVVTGKGEIVTCSRNENSQLFFSVLGGLGQFGIITRARVLLQPSPQ  230

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE---SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVRWIRVVYS F +FT+DAE LV+++E   SFDYVEGFVFVNSDDPVNGW +VPL+ +H 
Sbjct  231  MVRWIRVVYSEFSEFTRDAELLVSQEEGGESFDYVEGFVFVNSDDPVNGWPSVPLDPNHP  290

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P  IP  AGPVLYCLE+ LH++ ND PS++N   +RL+G LR+CKKLRFEV++ Y+ F
Sbjct  291  FDPAGIPTSAGPVLYCLELVLHHRENDRPSSVNLVVDRLLGQLRFCKKLRFEVDLKYVEF  350

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            L RVK  E+ A+ANG WD PHPWLNLF+S
Sbjct  351  LSRVKVAEQQAKANGIWDAPHPWLNLFVS  379



>ref|XP_010493247.1| PREDICTED: cytokinin dehydrogenase 7-like [Camelina sativa]
Length=521

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 178/209 (85%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  178  AFRYGPQTSNVTELDVVTGNGDVVTCSEVENSELFFSVLGGLGQFGIITRARVLLQPAPD  237

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-RDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVRWIRVVY+ F++FT+DAE LV+ +DES  FDYVEGFVFVN DDPVNGW TVPL+ DH 
Sbjct  238  MVRWIRVVYTEFDEFTRDAEWLVSQKDESSSFDYVEGFVFVNGDDPVNGWPTVPLHPDHY  297

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
              P  +P+ +G VLYCLE+ LHY+++D  S ++K+ ERL+G LR+ + LRFEV++SY++F
Sbjct  298  FEPARLPQSSGSVLYCLELGLHYRDSDSNSNVDKRVERLIGRLRFIEGLRFEVDLSYVDF  357

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EE A+  GTW+TPHPWLNLF+S
Sbjct  358  LLRVKRSEEIAKVIGTWETPHPWLNLFVS  386



>ref|XP_009120710.1| PREDICTED: cytokinin dehydrogenase 7 [Brassica rapa]
 emb|CDX92398.1| BnaA10g14370D [Brassica napus]
Length=525

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 178/208 (86%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQ APD
Sbjct  183  AFRYGPQTSNVTELDVVTGNGDVVTCSEMENSELFFSVLGGLGQFGIITRARVLLQQAPD  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY+ F++FT+DAE LV++  + SFDYVEGFVFVN DDPVNGW TVPL+ D   
Sbjct  243  MVRWIRIVYAEFDEFTRDAEWLVSQKDESSFDYVEGFVFVNGDDPVNGWPTVPLHPDQDF  302

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+ +G VLYCLE+ALHY+++D  S+++K+ ERL+G LR+   LRFEV++ Y++FL
Sbjct  303  DPTRLPQSSGSVLYCLELALHYRDSDSNSSVDKRVERLIGRLRFDDGLRFEVDLPYVDFL  362

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ NGTW+TPHPWLNLF+S
Sbjct  363  LRVKRSEEIAKVNGTWETPHPWLNLFVS  390



>ref|XP_002871976.1| hypothetical protein ARALYDRAFT_489034 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48235.1| hypothetical protein ARALYDRAFT_489034 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 178/208 (86%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTGNGD+  CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  181  AFRYGPQTSNVTELDVVTGNGDVVTCSEIENSELFFSVLGGLGQFGIITRARVLLQPAPD  240

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F++FTQDAE LV++  + SFDYVEGFVFVN DDPVNGW TVPL+ D + 
Sbjct  241  MVRWIRVVYTEFDEFTQDAEWLVSQKNESSFDYVEGFVFVNGDDPVNGWPTVPLHPDQEF  300

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+ +G VLYCLE+ LHY+++D  S ++K+ ERL+G LR+ + LRFEV++ Y++FL
Sbjct  301  DPTRLPQSSGSVLYCLELGLHYRDSDSNSNVDKRVERLIGRLRFNEGLRFEVDLPYVDFL  360

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+  GTW+TPHPWLNLF+S
Sbjct  361  LRVKRSEEIAKEIGTWETPHPWLNLFVS  388



>gb|EYU20300.1| hypothetical protein MIMGU_mgv1a004484mg [Erythranthe guttata]
Length=525

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 172/208 (83%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF +GPQT NVTELEVVTGNGD+ VCS+  N ELF+SVLGGLGQFG+ITRARVMLQPAPD
Sbjct  180  AFVYGPQTENVTELEVVTGNGDVLVCSKNQNPELFFSVLGGLGQFGVITRARVMLQPAPD  239

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS F DFT+DAE LVTR   +SFDYVEGFV  NSDDPVNGW TVPL+++   
Sbjct  240  MVRWIRVVYSEFSDFTRDAELLVTRPAGDSFDYVEGFVVTNSDDPVNGWPTVPLDTNQSF  299

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT IP++AGPV+YCLE+ALHY N D P T++ + ERL+GG+R  + +RFEV V Y+ FL
Sbjct  300  DPTRIPRNAGPVVYCLEVALHYSNEDPPFTVDMRVERLMGGMRVKEGMRFEVEVGYVEFL  359

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ E+ A+ANG W+ PHPWLNLFIS
Sbjct  360  SRVKRAEKEAKANGIWEAPHPWLNLFIS  387



>ref|XP_004245052.1| PREDICTED: cytokinin dehydrogenase 7-like [Solanum lycopersicum]
Length=531

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFRFGPQTS+VTELEVVTGNG+  VCS + NSELF+SVLGGLGQFGII+RARV+LQPAPD
Sbjct  189  AFRFGPQTSSVTELEVVTGNGEKIVCSNSQNSELFFSVLGGLGQFGIISRARVLLQPAPD  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRVVYS F DFT+DAE L+T +E+F+YVEGFVFVNS+D V GW +VPLNS+   +P
Sbjct  249  MVRWIRVVYSEFNDFTRDAELLITSEETFNYVEGFVFVNSNDSVTGWPSVPLNSNQSFDP  308

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            T +PK AGPVLY LE+ LHY N+D PST+N   E+L+G L+Y +  +FE N +YM+FLLR
Sbjct  309  TLLPKTAGPVLYYLELTLHYNNHDDPSTVNMMVEKLLGKLKYLEDFKFETNSTYMDFLLR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            V   EE AR +G W TPHPWLN+FIS
Sbjct  369  VDNVEEAARGSGIWATPHPWLNIFIS  394



>ref|XP_006400694.1| hypothetical protein EUTSA_v10013259mg [Eutrema salsugineum]
 gb|ESQ42147.1| hypothetical protein EUTSA_v10013259mg [Eutrema salsugineum]
Length=522

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQT NVTEL+VVTGNGD   CSE  NSELF+SVLGGLGQFGIITRARV+LQPAP 
Sbjct  180  AFRYGPQTENVTELDVVTGNGDFVTCSEMENSELFFSVLGGLGQFGIITRARVLLQPAPH  239

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F++FT+DAE LV++  + SFDYVEGFVFVN DDP NGW TVPL+ DH  
Sbjct  240  MVRWIRVVYAEFDEFTRDAEWLVSQKDESSFDYVEGFVFVNGDDPANGWPTVPLHPDHDF  299

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +PT +P+ +G VLYCLE+ALHY+++D  ST++K+ +RL+G L + + LRFEV++ Y++FL
Sbjct  300  DPTRLPQSSGSVLYCLELALHYRDSDSNSTVDKRVDRLIGRLSFNEGLRFEVDLPYVDFL  359

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ NGTW+TPHPWLNLF+S
Sbjct  360  LRVKRSEEIAKVNGTWETPHPWLNLFVS  387



>gb|KJB54572.1| hypothetical protein B456_009G040700 [Gossypium raimondii]
Length=411

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 170/208 (82%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I VCSET NSELF+ VLGGLGQFGIITRAR+ LQ APD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGEITVCSETLNSELFFGVLGGLGQFGIITRARIKLQQAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD--ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS FE+FT+DAE LVT+   ESFDYVEGFVF N+DDP NGW +VPL+  H+ 
Sbjct  232  MVRWIRVVYSEFEEFTRDAEFLVTQKEGESFDYVEGFVFCNNDDPFNGWPSVPLDPGHEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NPT+I + AG VLYCLE+A HY+N+DHP T++     L+G LR+ + L+ +V+VSY  FL
Sbjct  292  NPTHISQTAGSVLYCLEVAFHYRNSDHP-TVDTAVNGLLGRLRFVEGLKSQVDVSYTKFL  350

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRV + EE  +ANGTWD PHPWLNLF+S
Sbjct  351  LRVNRAEEQVKANGTWDGPHPWLNLFVS  378



>gb|KJB54574.1| hypothetical protein B456_009G040700 [Gossypium raimondii]
Length=416

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 170/208 (82%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I VCSET NSELF+ VLGGLGQFGIITRAR+ LQ APD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGEITVCSETLNSELFFGVLGGLGQFGIITRARIKLQQAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD--ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS FE+FT+DAE LVT+   ESFDYVEGFVF N+DDP NGW +VPL+  H+ 
Sbjct  232  MVRWIRVVYSEFEEFTRDAEFLVTQKEGESFDYVEGFVFCNNDDPFNGWPSVPLDPGHEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NPT+I + AG VLYCLE+A HY+N+DHP T++     L+G LR+ + L+ +V+VSY  FL
Sbjct  292  NPTHISQTAGSVLYCLEVAFHYRNSDHP-TVDTAVNGLLGRLRFVEGLKSQVDVSYTKFL  350

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRV + EE  +ANGTWD PHPWLNLF+S
Sbjct  351  LRVNRAEEQVKANGTWDGPHPWLNLFVS  378



>ref|XP_007161054.1| hypothetical protein PHAVU_001G038800g [Phaseolus vulgaris]
 gb|ESW33048.1| hypothetical protein PHAVU_001G038800g [Phaseolus vulgaris]
Length=512

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 169/208 (81%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNV ELEVVTG G+  VCSET NSELF++ LGGLGQFGIITRARV +QPAPD
Sbjct  164  AFRYGPQTSNVAELEVVTGKGETLVCSETQNSELFFATLGGLGQFGIITRARVAVQPAPD  223

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS FEDFT+DAE LVT  E   FDYVEGFV VNSDDP NGW TVP   + + 
Sbjct  224  MVRWIRVVYSEFEDFTRDAEWLVTLREGYGFDYVEGFVLVNSDDPCNGWPTVPTGPNQRF  283

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P  +P  AGPVLYCLE+ALHY++ DH S +N + +RL+G LR+ + L+F ++++YM+FL
Sbjct  284  DPARLPASAGPVLYCLELALHYRDEDHASAVNMEVDRLLGRLRFVEGLKFSLDLTYMDFL  343

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ANG WD PHPWLNLF+S
Sbjct  344  LRVKRVEEDAKANGIWDAPHPWLNLFVS  371



>ref|NP_001275121.1| cytokinin oxidase/dehydrogenase [Solanum tuberosum]
 gb|ACP40989.1| cytokinin oxidase/dehydrogenase [Solanum tuberosum]
Length=513

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 4/207 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
             FRFGPQTS VTELEVVTGNG+I VCS +HNS+LF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  173  TFRFGPQTSTVTELEVVTGNGEIIVCSNSHNSQLFFSVLGGLGQFGIITRARVLLQPAPD  232

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRVVYS F++FT DAE L+T  ESFDYVEGFVFVNSDDPVNGW +V L+S+   +P
Sbjct  233  MVRWIRVVYSEFDEFTHDAELLITSQESFDYVEGFVFVNSDDPVNGWLSVLLDSNQAFDP  292

Query  362  TYIPKDAGPVLYCLEMALHYKNN-DHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            T++PK  GPVLYCLE+ALHY NN D P  +    E+L+G LRY K  RFE++++YMNFL 
Sbjct  293  THLPKKTGPVLYCLEVALHYNNNHDDPFMM---VEKLLGKLRYLKHFRFEIDLTYMNFLS  349

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RV   EE AR +G W TPHPWLN+F+S
Sbjct  350  RVDHVEEAARGSGIWATPHPWLNMFVS  376



>ref|XP_004172756.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 7-like, 
partial [Cucumis sativus]
Length=411

 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 166/208 (80%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV ELEVVTG GD  +CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  172  AFRYGPQISNVAELEVVTGKGDTLICSENENSELFFSVLGGLGQFGIITRARVLLQPAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY  FE F  DAESL+ R E  SFDYVEGFVF N+DDP+ G  TVPL+S+   
Sbjct  232  MVRWIRLVYDEFERFAHDAESLIRRPEGDSFDYVEGFVFXNNDDPLTGRPTVPLDSNTIF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            N +Y+P+ AG VLYCLE+A+HY+NND  ST++   ERL+ GL Y K LRF+V++SY+ FL
Sbjct  292  NSSYLPETAGSVLYCLEVAVHYRNNDQVSTVDTDVERLLSGLGYVKGLRFQVDLSYIQFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ EE A ANG WD PHPWLNLF+S
Sbjct  352  SRVKRAEEEAVANGVWDAPHPWLNLFVS  379



>ref|XP_008220595.1| PREDICTED: cytokinin dehydrogenase 7 [Prunus mume]
Length=489

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 174/209 (83%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTG G+I  CSET NSELF+  LGGLGQFGI+TRARV+LQPAPD
Sbjct  143  AFRYGPQTSNVTELQVVTGKGEIFNCSETENSELFFGALGGLGQFGIVTRARVLLQPAPD  202

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR---DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVRWIR+VY+ FEDFT+DAE LVTR   ++SFDYVEGF FVNSD+P +G  +VPL+ D  
Sbjct  203  MVRWIRLVYTEFEDFTRDAELLVTRQDEEDSFDYVEGFAFVNSDNPADGRPSVPLDPDQV  262

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +PT++P+ AG +LYCLE+A HY+N D PS ++    RL+GGL + ++L+F+V++SY+ F
Sbjct  263  FDPTHLPRTAGSMLYCLELARHYRNADDPSIVDMGVNRLLGGLGFVERLKFQVDLSYLEF  322

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EEHA+ANG WD PHPWLNLF+S
Sbjct  323  LLRVKRAEEHAKANGIWDAPHPWLNLFVS  351



>ref|XP_009362741.1| PREDICTED: cytokinin dehydrogenase 7-like [Pyrus x bretschneideri]
Length=520

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 173/210 (82%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I  CSET NSELF+  LGGLGQFGIIT+ARV+LQPAPD
Sbjct  170  AFRYGPQTSNVTELEVVTGKGEIFNCSETENSELFFGALGGLGQFGIITKARVLLQPAPD  229

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE----SFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
            MVRWIR+VY+ F+DFT+DAE LVTR +    SFDYVEGF F+NSD+P +G  +VPL+   
Sbjct  230  MVRWIRLVYTEFDDFTRDAELLVTRQDDGGDSFDYVEGFAFINSDNPADGRPSVPLDPQE  289

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
              +  ++P+ AGP+LYCLE+A HY+  DHPST++   +RL+GGL + ++L+F+V++SY+ 
Sbjct  290  TFDAAHLPRTAGPILYCLELARHYRKTDHPSTVDTGVKRLLGGLGFVEQLKFQVDISYVE  349

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            FLLRVK+ EEHA+ANG WD PHPWLN+F+S
Sbjct  350  FLLRVKRAEEHAKANGIWDAPHPWLNMFVS  379



>ref|XP_007222863.1| hypothetical protein PRUPE_ppa004276mg [Prunus persica]
 gb|EMJ24062.1| hypothetical protein PRUPE_ppa004276mg [Prunus persica]
Length=519

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 174/209 (83%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTEL+VVTG G+I  CSET NSELF+  LGGLGQFGIITRARV+LQPAPD
Sbjct  173  AFRYGPQTSNVTELQVVTGKGEIFNCSETENSELFFGALGGLGQFGIITRARVLLQPAPD  232

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR---DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVRWIR+VY+ FEDFT+DAE LVTR   ++SFDYVEGF FVNSD+P +G  +VPL+ D  
Sbjct  233  MVRWIRLVYTEFEDFTRDAELLVTRQDEEDSFDYVEGFAFVNSDNPADGRPSVPLDPDQV  292

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +PT++P+ AG +LYCLE+A HY++ D PS ++    RL+GGL + ++L+F+V++SY+ F
Sbjct  293  FDPTHLPRTAGSMLYCLELARHYRHADDPSIVDMGVNRLLGGLGFVERLKFQVDLSYLEF  352

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EEHA+ANG WD PHPWLNLF+S
Sbjct  353  LLRVKRAEEHAKANGIWDAPHPWLNLFVS  381



>ref|XP_010324957.1| PREDICTED: cytokinin oxidase/dehydrogenase-like isoform X2 [Solanum 
lycopersicum]
Length=424

 Score =   300 bits (769),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FRFGPQTS VTELEVVTG G+  V S + NS+LF+SVLGGLGQFGIITRARV+LQPAPDM
Sbjct  178  FRFGPQTSTVTELEVVTGTGEKIVSSNSQNSQLFFSVLGGLGQFGIITRARVLLQPAPDM  237

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRW+RVVYS F +F+ DAE L+T  ESFDYVEGFVFVNSDDPVNGW +VPL+S+   +PT
Sbjct  238  VRWVRVVYSEFHEFSSDAELLITNPESFDYVEGFVFVNSDDPVNGWLSVPLDSNQTFDPT  297

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
            ++PK  GP+LYCLE+ALHY  ++ P  +N   E+L+G LRY K  R+E++++YMNFL RV
Sbjct  298  HLPKKIGPLLYCLEVALHYNKHEDPFIVNMMIEKLLGKLRYLKHFRYEIDLTYMNFLSRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFIS  619
               EE AR +G W TPHPWLN+F+S
Sbjct  358  DHVEEAARGSGIWSTPHPWLNMFVS  382



>gb|AGM20669.1| CKX5 [Populus tomentosa]
Length=416

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 167/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFRFGPQTSNV EL+VVTG G +  C++  NSELF+  LGGLGQFGI+TRARV++Q APD
Sbjct  175  AFRFGPQTSNVAELDVVTGKGQLMTCNKNENSELFFGALGGLGQFGIVTRARVVVQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNS-DDPVNGWSTVPLNSDHQ  352
            MVRWIRVVYS FEDFT+DAE LVTR   ESFDYVEGFVFVNS DDP NGW TVPL+ D  
Sbjct  235  MVRWIRVVYSEFEDFTRDAEWLVTRPEGESFDYVEGFVFVNSVDDPANGWPTVPLDPDQG  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P+ +P+ AG VLYCLE ALHY+  DHPST++K    L+G L + + ++F+V+VSY+ F
Sbjct  295  FDPSRVPRTAGSVLYCLEAALHYQKTDHPSTVDKAVNSLLGRLGFIEDMKFQVDVSYVEF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK  EE AR NGTWD PHPWLN+F+S
Sbjct  355  LLRVKHAEESARENGTWDAPHPWLNMFVS  383



>gb|KJB54573.1| hypothetical protein B456_009G040700 [Gossypium raimondii]
Length=519

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 170/208 (82%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I VCSET NSELF+ VLGGLGQFGIITRAR+ LQ APD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGEITVCSETLNSELFFGVLGGLGQFGIITRARIKLQQAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD--ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS FE+FT+DAE LVT+   ESFDYVEGFVF N+DDP NGW +VPL+  H+ 
Sbjct  232  MVRWIRVVYSEFEEFTRDAEFLVTQKEGESFDYVEGFVFCNNDDPFNGWPSVPLDPGHEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NPT+I + AG VLYCLE+A HY+N+DHP T++     L+G LR+ + L+ +V+VSY  FL
Sbjct  292  NPTHISQTAGSVLYCLEVAFHYRNSDHP-TVDTAVNGLLGRLRFVEGLKSQVDVSYTKFL  350

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRV + EE  +ANGTWD PHPWLNLF+S
Sbjct  351  LRVNRAEEQVKANGTWDGPHPWLNLFVS  378



>ref|XP_004141436.1| PREDICTED: cytokinin dehydrogenase 7-like [Cucumis sativus]
Length=517

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 166/208 (80%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV ELEVVTG GD  +CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  172  AFRYGPQISNVAELEVVTGKGDTLICSENENSELFFSVLGGLGQFGIITRARVLLQPAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY  FE F  DAESL+ R E  SFDYVEGFVF N+DDP+ G  TVPL+S+   
Sbjct  232  MVRWIRLVYDEFERFAHDAESLIRRPEGDSFDYVEGFVFSNNDDPLTGRPTVPLDSNTIF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            N +Y+P+ AG VLYCLE+A+HY+NND  ST++   ERL+ GL Y K LRF+V++SY+ FL
Sbjct  292  NSSYLPETAGSVLYCLEVAVHYRNNDQVSTVDTDVERLLSGLGYVKGLRFQVDLSYIQFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ EE A ANG WD PHPWLNLF+S
Sbjct  352  SRVKRAEEEAVANGVWDAPHPWLNLFVS  379



>gb|KGN55376.1| hypothetical protein Csa_4G647490 [Cucumis sativus]
Length=571

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 166/208 (80%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV ELEVVTG GD  +CSE  NSELF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  226  AFRYGPQISNVAELEVVTGKGDTLICSENENSELFFSVLGGLGQFGIITRARVLLQPAPD  285

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY  FE F  DAESL+ R E  SFDYVEGFVF N+DDP+ G  TVPL+S+   
Sbjct  286  MVRWIRLVYDEFERFAHDAESLIRRPEGDSFDYVEGFVFSNNDDPLTGRPTVPLDSNTIF  345

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            N +Y+P+ AG VLYCLE+A+HY+NND  ST++   ERL+ GL Y K LRF+V++SY+ FL
Sbjct  346  NSSYLPETAGSVLYCLEVAVHYRNNDQVSTVDTDVERLLSGLGYVKGLRFQVDLSYIQFL  405

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ EE A ANG WD PHPWLNLF+S
Sbjct  406  SRVKRAEEEAVANGVWDAPHPWLNLFVS  433



>ref|XP_011019350.1| PREDICTED: cytokinin dehydrogenase 7 [Populus euphratica]
Length=521

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 167/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFRFGPQT NV EL+VVTG G +  C++  NSELF+  LGGLGQFGI+TRARV++Q APD
Sbjct  175  AFRFGPQTGNVAELDVVTGKGQLVTCNKNENSELFFGALGGLGQFGIVTRARVVVQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNS-DDPVNGWSTVPLNSDHQ  352
            MVRWIRVVY+ FEDFT+D E LVTR   ESFDYVEGFVFVNS DDP NGW TVPL+ D  
Sbjct  235  MVRWIRVVYAEFEDFTRDVEWLVTRPEGESFDYVEGFVFVNSVDDPANGWPTVPLDPDQG  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P+ +P+ AGPVLYCLE ALHY+  DHPST++K A  L+G L + + ++F+V+VSY+ F
Sbjct  295  FDPSRVPRTAGPVLYCLEAALHYQKTDHPSTVDKAANSLLGRLGFIEDMKFQVDVSYVEF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK  EE A+ NGTWD PHPWLN+F+S
Sbjct  355  LLRVKHAEESAKGNGTWDAPHPWLNMFVS  383



>ref|NP_001266216.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
 dbj|BAM09004.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=519

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 166/206 (81%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
             FRFGPQTS VTELEVVTG G+  V S + NS+LF+SVLGGLGQFGIITRARV+LQPAPD
Sbjct  177  TFRFGPQTSTVTELEVVTGTGEKIVSSNSQNSQLFFSVLGGLGQFGIITRARVLLQPAPD  236

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRW+RVVYS F +F+ DAE L+T  ESFDYVEGFVFVNSDDPVNGW +VPL+S+   +P
Sbjct  237  MVRWVRVVYSEFHEFSSDAELLITNPESFDYVEGFVFVNSDDPVNGWLSVPLDSNQTFDP  296

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            T++PK  GP+LYCLE+ALHY  ++ P  +N   E+L+G LRY K  R+E++++YMNFL R
Sbjct  297  THLPKKIGPLLYCLEVALHYNKHEDPFIVNMMIEKLLGKLRYLKHFRYEIDLTYMNFLSR  356

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            V   EE AR +G W TPHPWLN+F+S
Sbjct  357  VDHVEEAARGSGIWSTPHPWLNMFVS  382



>ref|XP_008393590.1| PREDICTED: cytokinin dehydrogenase 7 [Malus domestica]
Length=517

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 171/210 (81%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I  CSET NSELF+  LGGLGQFGIIT+ARV+LQPAPD
Sbjct  170  AFRYGPQTSNVTELEVVTGKGEIFNCSETENSELFFGALGGLGQFGIITKARVLLQPAPD  229

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE----SFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
            MVRWIR+VY+ F+DFT++AE LVTR +    SFDYVEGF FVNSD+P +G  +VPL+   
Sbjct  230  MVRWIRLVYTEFDDFTREAELLVTRQDHGGDSFDYVEGFAFVNSDNPADGRPSVPLDPQE  289

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
              +  ++P+ AGP+LYCLE+A HY+  DH ST++    RL+GGL + ++L+F+V++SY+ 
Sbjct  290  TFDAAHLPRTAGPILYCLELARHYRKTDHSSTVDTGVNRLLGGLGFVEQLKFQVDISYVE  349

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            FLLRVK+ EEHA+ANG WD PHPWLN+F+S
Sbjct  350  FLLRVKRAEEHAKANGIWDAPHPWLNMFVS  379



>ref|XP_008377825.1| PREDICTED: cytokinin dehydrogenase 7-like [Malus domestica]
Length=513

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 172/210 (82%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I  CSE  NSELF+  LGGLGQFGIIT+A+V+LQPAPD
Sbjct  166  AFRYGPQTSNVTELEVVTGKGEIFNCSEKENSELFFGALGGLGQFGIITKAKVLLQPAPD  225

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE----SFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
            MVRWIR+VY+ F+DFT+DAE LVTR +    SFDYVEGF FVNSD+P +G  +VPL+   
Sbjct  226  MVRWIRLVYTEFDDFTRDAELLVTRQDDGGDSFDYVEGFAFVNSDNPADGRPSVPLDPQE  285

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
              +P ++P+ +GP+LYCLE+A HY+N D PS+++    RL+GGL + ++L+F+V++SY+ 
Sbjct  286  TFDPAHLPRTSGPILYCLELAHHYRNTDRPSSVDTGVNRLLGGLGFVEELKFQVDLSYVE  345

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            FLLRVK+ EEHA+ANG WD PHPWLN+F+S
Sbjct  346  FLLRVKRAEEHAKANGIWDAPHPWLNMFVS  375



>ref|XP_010520480.1| PREDICTED: cytokinin dehydrogenase 7-like [Tarenaya hassleriana]
Length=513

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 172/207 (83%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQT NVTEL+VVTG GD   CS T N +LF++VLGGLGQFGIITRARV+LQ APD
Sbjct  173  AFRYGPQTENVTELDVVTGKGDAVTCSPTENPDLFFAVLGGLGQFGIITRARVLLQSAPD  232

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD-ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            MVRWIRVVY+ F++FT+DAE LV+++ ESFDYVEGFVFVN +DPVNGW TVPL+ + + +
Sbjct  233  MVRWIRVVYAEFDEFTRDAEWLVSQEGESFDYVEGFVFVNGEDPVNGWPTVPLDPEDRFD  292

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P  IPK AG VLYCLE+ALHY+N+D  ST++ + ERL+G L + + +RFE +VSY+ F+L
Sbjct  293  PNRIPKTAGSVLYCLEVALHYRNSDRESTVDTRVERLIGRLGFVEGMRFEKDVSYVEFIL  352

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RVK+ E  A+A GTWD+PHPWLNLF+S
Sbjct  353  RVKRSEAAAKAGGTWDSPHPWLNLFVS  379



>gb|KJB82928.1| hypothetical protein B456_013G221000 [Gossypium raimondii]
Length=515

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 175/208 (84%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFRFGPQTSNVTELEVVTG G+I VCSET NSELF+  LGGLGQ GIITRARV LQ APD
Sbjct  172  AFRFGPQTSNVTELEVVTGKGEITVCSETQNSELFFGALGGLGQLGIITRARVKLQRAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ FE+F +DAE LVT++ES  FDYVEGFVF NSDDP+NGW +VPL+ DH+ 
Sbjct  232  MVRWIRVVYTEFEEFARDAEFLVTQEESESFDYVEGFVFSNSDDPINGWPSVPLDPDHEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NP YIP+ AG VLYCLE+ALHY+N+D PST++    RL+  L   ++L+F++NVSY+ FL
Sbjct  292  NPAYIPQTAGSVLYCLEVALHYRNSDRPSTVDTAVSRLLERLGSIQRLKFQLNVSYVEFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EEHA+ANG WD+PHPWLN+FIS
Sbjct  352  LRVKQVEEHAKANGNWDSPHPWLNIFIS  379



>ref|XP_002309468.1| cytokinin oxidase family protein [Populus trichocarpa]
 gb|EEE92991.1| cytokinin oxidase family protein [Populus trichocarpa]
Length=521

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 166/209 (79%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFRFGPQT NV EL+VVTG G +  C++  NSELF+  LGGLGQFGI+TRARV++Q APD
Sbjct  175  AFRFGPQTCNVAELDVVTGEGQLMTCNKNENSELFFGALGGLGQFGIVTRARVVVQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNS-DDPVNGWSTVPLNSDHQ  352
            MVRWIRVVYS FEDFT+DAE LVTR   ESFDYVEGFVFVNS DDP NGW TVPL+ D  
Sbjct  235  MVRWIRVVYSEFEDFTRDAEWLVTRPEGESFDYVEGFVFVNSVDDPANGWPTVPLDPDQG  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P+ +P+ AG VLYCLE ALHY+  DHPST++K    L+G L + + ++F+V+VSY+ F
Sbjct  295  FDPSRVPRTAGSVLYCLEAALHYQKTDHPSTVDKAVNSLLGRLGFIEDMKFQVDVSYVEF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK  EE AR NGTWD PHPWLN+F+S
Sbjct  355  LLRVKHAEESARENGTWDAPHPWLNMFVS  383



>ref|XP_008452781.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 7 [Cucumis 
melo]
Length=518

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 165/208 (79%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
             FR+GPQ SNV ELEVVTG GD  +CSE  NSELF+SVLGGLGQFGIITRARV+LQPAP+
Sbjct  173  GFRYGPQISNVAELEVVTGKGDTLICSENENSELFFSVLGGLGQFGIITRARVLLQPAPE  232

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY  FE F  DAESL+ R E  SFDYVEGFVF N+DDP+ G  TVPL+S+   
Sbjct  233  MVRWIRLVYDEFERFAHDAESLIRRPEGDSFDYVEGFVFXNNDDPLTGRPTVPLDSNTVF  292

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            + +Y+P+ AG VLYCLE+A+HY+NND  ST++   ERL+ GL Y K LRFEV++SY+ FL
Sbjct  293  DSSYLPETAGSVLYCLEVAVHYRNNDQVSTVDTDVERLLSGLGYVKGLRFEVDLSYIQFL  352

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ EE A ANG WD PHPWLNLF+S
Sbjct  353  SRVKRAEEEAVANGVWDAPHPWLNLFVS  380



>ref|XP_002279960.1| PREDICTED: cytokinin dehydrogenase 7 [Vitis vinifera]
Length=515

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 167/208 (80%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTE+EVVTG  +  VCSET N E+F+++LGGLGQFGIITRARV+LQPAPD
Sbjct  171  AFRYGPQTSNVTEMEVVTGKAETLVCSETQNPEIFFAILGGLGQFGIITRARVLLQPAPD  230

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRW+R+VY+ F+ F++DAE LVTR E  SFDYVEGFVFVNS DPVNGW +VPL  + + 
Sbjct  231  MVRWMRLVYAEFDAFSRDAEFLVTRPEGDSFDYVEGFVFVNSSDPVNGWPSVPLTPEQRF  290

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            N   +P+ AG VLYC+E+ALHYK++DH ST++    R++G L + + L F V+V YM FL
Sbjct  291  NSGRVPRTAGSVLYCIEVALHYKSSDHASTVDMAVSRMLGRLGFIEGLEFHVDVGYMEFL  350

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE ARANG WD PHPWLNL +S
Sbjct  351  LRVKRVEEDARANGIWDAPHPWLNLLVS  378



>ref|XP_003544550.1| PREDICTED: cytokinin dehydrogenase 7-like [Glycine max]
Length=513

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 167/208 (80%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQT+NVTELEVVTG G+  VCSE+ NSELF++ LGGLGQFGIITRAR+ +Q APD
Sbjct  165  SFRYGPQTANVTELEVVTGKGETLVCSESQNSELFFATLGGLGQFGIITRARLPVQQAPD  224

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRV+YS F  FT+DAE LVT  E   FDYVEGFV VNSDDP NGW TVP+  +   
Sbjct  225  MVRWIRVLYSEFAHFTRDAEWLVTLPEGDGFDYVEGFVLVNSDDPCNGWPTVPMGPNQYF  284

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P  IP  AGP+LYCLE+ALHY+N DHPS ++ + +RL+G LR+ + L+F V+V+YM FL
Sbjct  285  DPLRIPSAAGPLLYCLELALHYRNQDHPSAVDMEVDRLLGRLRFVEGLKFCVDVTYMEFL  344

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ANG WD PHPWLN+F+S
Sbjct  345  LRVKRVEEDAKANGIWDAPHPWLNMFVS  372



>gb|KJB27239.1| hypothetical protein B456_004G286300 [Gossypium raimondii]
Length=514

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 164/208 (79%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV ELE++TG GDI VCSET N ELF+  LGGLGQFGIITRA V LQPAPD
Sbjct  173  AFRYGPQISNVAELEIITGKGDIMVCSETRNPELFFGSLGGLGQFGIITRAMVKLQPAPD  232

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD--ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F++FT+DAE LV+RD  ESFDYVEGFVF N+DDPVNGW +VPL+  H  
Sbjct  233  MVRWIRVVYTEFDEFTRDAEFLVSRDDGESFDYVEGFVFCNNDDPVNGWPSVPLDPVHGF  292

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            N   IP+    VLYCLE+A HY+  DHPST++K    L+  LR+ + L+ +V++SY+ FL
Sbjct  293  NQGIIPQTGASVLYCLEVAFHYQKGDHPSTVDKAVAGLLKPLRFVEGLKSQVDLSYVEFL  352

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ANG WD PHPWLNLFIS
Sbjct  353  LRVKRAEEQAKANGIWDAPHPWLNLFIS  380



>ref|XP_002516133.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF46135.1| gulonolactone oxidase, putative [Ricinus communis]
Length=520

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 168/208 (81%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ+SNV EL+VVTG GD+  C+ET N ELF+  LGGLGQFGIITRARV LQ APD
Sbjct  175  AFRYGPQSSNVAELDVVTGKGDLVTCNETENPELFFGALGGLGQFGIITRARVKLQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ FED+ +DAE LVTR  D SFDYVEGFVFVNSDD VNGW +V L+ D   
Sbjct  235  MVRWIRVVYTEFEDYARDAEWLVTRPDDMSFDYVEGFVFVNSDDHVNGWPSVSLDPDRGY  294

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            + T IP  AG VLYCLE+ALHY+N+DHPST++     L+G L + + LRF+V++S+++FL
Sbjct  295  DHTAIPATAGSVLYCLEVALHYQNSDHPSTVDTAVNSLLGRLGFLEDLRFQVDISFVDFL  354

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE+ARANG WD PHPWLN+F+S
Sbjct  355  LRVKRVEENARANGIWDAPHPWLNMFVS  382



>ref|XP_004303465.1| PREDICTED: cytokinin dehydrogenase 7 [Fragaria vesca subsp. vesca]
Length=520

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 169/210 (80%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+  VCSE  NSELF+SVLGGLGQFGIITRARV LQ APD
Sbjct  173  AFRYGPQTSNVTELEVVTGKGETFVCSEEENSELFFSVLGGLGQFGIITRARVRLQQAPD  232

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR----DESFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
            MVRWIR+VY+ F+ FT+DAESLVTR     ESFDYVEGF F+NSD+P +G  +VPL+ D 
Sbjct  233  MVRWIRLVYTEFDAFTRDAESLVTRPHDDGESFDYVEGFAFMNSDNPADGLPSVPLHPDQ  292

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
              +PT +P++AG VLYCLE+A HY+++DH S ++K   RL+ GL + + L F+V++ Y  
Sbjct  293  VFDPTRLPQEAGSVLYCLELARHYRSSDHLSAVDKGVNRLLEGLGFVEGLEFQVDLGYEE  352

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            FLLRVK+ EEHA+A+G WD PHPWLNLF+S
Sbjct  353  FLLRVKQAEEHAKASGIWDAPHPWLNLFVS  382



>gb|EPS58008.1| cytokinin dehydrogenase 7, partial [Genlisea aurea]
Length=404

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 162/207 (78%), Gaps = 3/207 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            F  GPQT NVTELEVVTGNGD+ VCS+  NS+LFY+ LGGLGQFGIITRAR++LQP PD 
Sbjct  166  FLHGPQTENVTELEVVTGNGDVLVCSDHQNSDLFYAALGGLGQFGIITRARILLQPVPDK  225

Query  185  VRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIRVVYS F DFT DAES+V R   ++FDY+EGFVFVN  DPVNGW +VP    +  +
Sbjct  226  VRWIRVVYSEFGDFTGDAESVVARPPQDNFDYLEGFVFVNGADPVNGWPSVPHRGQY-FD  284

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            PT IPK +GPVLYCLE+ALHY +    S I+KK +RL+GGLR+   LRFE++V Y  FL 
Sbjct  285  PTRIPKSSGPVLYCLELALHYDDEVPRSAIDKKVDRLIGGLRFVDGLRFEIDVGYAEFLT  344

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RVK+ EE A++NG W+ PHPWLN+FIS
Sbjct  345  RVKRVEEDAKSNGIWEAPHPWLNIFIS  371



>ref|XP_003588931.1| Cytokinin dehydrogenase [Medicago truncatula]
 gb|AES59182.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=509

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 164/207 (79%), Gaps = 2/207 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR+GPQT+NVTELEVVTG GD  VC++  NS+LF++ LGGLGQFG+ITRAR++LQ APDM
Sbjct  166  FRYGPQTANVTELEVVTGKGDSFVCNDNQNSDLFFASLGGLGQFGVITRARIVLQQAPDM  225

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIRV+YS FED+T+DAE LVT  E   FDYVEGFV  N+DDP NGW T+P+ S+   N
Sbjct  226  VRWIRVIYSEFEDYTRDAEWLVTLPEGDGFDYVEGFVVANNDDPCNGWPTIPMGSNQIFN  285

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P  +P  AGPVLYCLE+ALHY+     S +N K +RL+GGLR+ + ++FE +V YM+FLL
Sbjct  286  PVCLPSSAGPVLYCLELALHYRKTARSSEVNTKVDRLLGGLRFVEGIKFEDDVKYMDFLL  345

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RVK+ EE A+A G WD PHPWLN+F+S
Sbjct  346  RVKRVEEDAKAKGIWDAPHPWLNMFVS  372



>ref|XP_010535754.1| PREDICTED: cytokinin dehydrogenase 7-like [Tarenaya hassleriana]
Length=510

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 170/207 (82%), Gaps = 2/207 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR+GPQT NVTEL+VVTG GD   CS T NS+LF+SVLGGLGQFGIITRAR++LQPAPDM
Sbjct  168  FRYGPQTENVTELDVVTGKGDAVSCSPTENSDLFFSVLGGLGQFGIITRARILLQPAPDM  227

Query  185  VRWIRVVYSAFEDFTQDAESLVTRD-ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            VRWIRVVY+ F++FT+DAE LV+++ ESFDYVEGFVFVN +D +NGW TVPL+ +   + 
Sbjct  228  VRWIRVVYAEFDEFTRDAEWLVSQEGESFDYVEGFVFVNGEDSINGWPTVPLDPEDWFDS  287

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
              IP+ AG VLYCLE+ALHY+++D  ST++ +AERL+G L + + LRFE++V+Y+ F+LR
Sbjct  288  DRIPRSAGSVLYCLEVALHYRDSDRKSTVDTRAERLIGRLGFIEGLRFEIDVTYVEFILR  347

Query  542  VKKGEEHARANGTWD-TPHPWLNLFIS  619
            V + E  A+A GTWD  PHPWLNLF+S
Sbjct  348  VNRSEAAAKAKGTWDEAPHPWLNLFVS  374



>ref|XP_006453001.1| hypothetical protein CICLE_v10007999mg [Citrus clementina]
 gb|ESR66241.1| hypothetical protein CICLE_v10007999mg [Citrus clementina]
Length=416

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 166/209 (79%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV +L+VVTGNGD+  CSE+   ELF++VLGGLGQFGIITRARV+LQ APD
Sbjct  175  AFRYGPQISNVAQLDVVTGNGDMVTCSESRQPELFFNVLGGLGQFGIITRARVLLQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVT---RDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
             VRWIR+VY+ F++FT+DAE LV+     ESFDYVEGFVFVNSDD VNGW +VPL+    
Sbjct  235  KVRWIRLVYAEFDEFTRDAELLVSLKEERESFDYVEGFVFVNSDDTVNGWPSVPLDPAQV  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P ++P+ AG VLYCLE+ALHY N+D  S ++   +RL+  L +  KL F V+VSY++F
Sbjct  295  FDPAHLPQTAGSVLYCLEVALHYNNSDPRSAVDAVVDRLLERLGFVSKLNFPVDVSYVDF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK  EEHARANG WD+PHPWLN+F+S
Sbjct  355  LLRVKLVEEHARANGMWDSPHPWLNMFVS  383



>ref|XP_004498857.1| PREDICTED: cytokinin dehydrogenase 7-like [Cicer arietinum]
Length=519

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 164/207 (79%), Gaps = 2/207 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR+GPQT+NVTELEVVTG G+  VCSE  NSELF++ LGGLGQFGIITRAR++LQ +PDM
Sbjct  166  FRYGPQTANVTELEVVTGKGETFVCSENQNSELFFATLGGLGQFGIITRARIVLQKSPDM  225

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIRVVYS FED+T+DAE LVT  E   FDYVEGFV  N+DDP NGW T+P+ S+   +
Sbjct  226  VRWIRVVYSEFEDYTRDAEWLVTLPEGDGFDYVEGFVVANNDDPCNGWPTIPMGSNQMFD  285

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P  +P +AGPV+YCLE+ALHY+     S ++ K +RL+G LR+ + ++FE +V YM+FLL
Sbjct  286  PVRLPSEAGPVIYCLELALHYRKTARSSDVDMKVDRLLGRLRFVEGIKFEDDVKYMDFLL  345

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RVK+ EE A+A G WD PHPWLN+F+S
Sbjct  346  RVKRVEEDAKAKGIWDAPHPWLNMFVS  372



>ref|XP_010098364.1| Cytokinin dehydrogenase 7 [Morus notabilis]
 gb|EXB74888.1| Cytokinin dehydrogenase 7 [Morus notabilis]
Length=514

 Score =   287 bits (735),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 167/207 (81%), Gaps = 3/207 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR+GPQTSNVTELEVVTG G+  VCSET NS+LF+SVLGGLGQFGIITRARV+LQPAPDM
Sbjct  172  FRYGPQTSNVTELEVVTGKGETLVCSETENSDLFFSVLGGLGQFGIITRARVLLQPAPDM  231

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIRVVY+ FEDFT+DAE LVT+ E  SFDYVEGFVF N+D+P  G  TVPL+ D   N
Sbjct  232  VRWIRVVYAEFEDFTRDAEFLVTQPEGKSFDYVEGFVFSNNDNPSTGRPTVPLSPDQTFN  291

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P+ +P  +G VLYCLE+ALHY+N D PS I+     L+  L + + LRF+V+V+Y +FLL
Sbjct  292  PSRLPPRSGSVLYCLELALHYRNTDRPS-IDTAVNSLLRRLGFVEHLRFQVDVTYTDFLL  350

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RVK+ EE A+AN  W++PHPWLN+F+S
Sbjct  351  RVKRAEEEAKANDVWESPHPWLNMFVS  377



>gb|ABK32520.1| cytokinin oxidase/dehydrogenase 1 [Pisum sativum]
Length=519

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 164/207 (79%), Gaps = 2/207 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR+GPQT+NVTELEVVTG G+  VCSE  NSELF++ LGGLGQFGIITRAR++LQ APDM
Sbjct  166  FRYGPQTANVTELEVVTGKGESLVCSENQNSELFFATLGGLGQFGIITRARIILQQAPDM  225

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIRV+YS FE+FT+DAE LVT  E   FDYVEGFV  N+DDP NGW T+P+ S+   +
Sbjct  226  VRWIRVIYSEFEEFTKDAEWLVTLPEGDGFDYVEGFVVANNDDPCNGWPTIPMGSNQIFD  285

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P ++   AGPVLYCLE+ALHY+     S ++ K +RL+GGLR+ + ++FE +V Y++FLL
Sbjct  286  PVHLSPSAGPVLYCLELALHYRKAARSSEVDTKVDRLLGGLRFVEGVKFEDDVKYVDFLL  345

Query  539  RVKKGEEHARANGTWDTPHPWLNLFIS  619
            RVK+ EE A+A G WD PHPWLN+F+S
Sbjct  346  RVKRVEEDAKAKGIWDAPHPWLNMFVS  372



>gb|KDO73618.1| hypothetical protein CISIN_1g009956mg [Citrus sinensis]
Length=521

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV +L+VVTGNGD+  CSE+   ELF++VLGGLGQFGIITRARV+LQ APD
Sbjct  175  AFRYGPQISNVAQLDVVTGNGDMVTCSESRQPELFFNVLGGLGQFGIITRARVLLQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVT---RDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
             VRWIR+VY+ F++FT+DAE LV+     ESFDYVEGFVFVNSDD VNGW +VPL+    
Sbjct  235  KVRWIRLVYAEFDEFTRDAELLVSLKEERESFDYVEGFVFVNSDDTVNGWPSVPLDPAQV  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P ++P+ AG VLYCLE+ALHY N+D  S ++   +RL+  L +  KL F+V+VSY++F
Sbjct  295  FDPAHLPQTAGSVLYCLEVALHYNNSDPRSAVDAVVDRLLERLGFVSKLNFQVDVSYVDF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EEHARANG WD+PHPWLN+F+S
Sbjct  355  LLRVKQVEEHARANGMWDSPHPWLNMFVS  383



>ref|XP_006474490.1| PREDICTED: cytokinin dehydrogenase 7-like [Citrus sinensis]
Length=521

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV +L+VVTGNGD+  CSE+   ELF++VLGGLGQFGIITRARV+LQ APD
Sbjct  175  AFRYGPQISNVAQLDVVTGNGDMVTCSESRQPELFFNVLGGLGQFGIITRARVLLQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVT---RDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
             VRWIR+VY+ F++FT+DAE LV+     ESFDYVEGFVFVNSDD VNGW +VPL+    
Sbjct  235  KVRWIRLVYAEFDEFTRDAELLVSLKEERESFDYVEGFVFVNSDDTVNGWPSVPLDPAQV  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P ++P+ AG VLYCLE+ALHY N+D  S ++   +RL+  L +  KL F+V+VSY++F
Sbjct  295  FDPAHLPQTAGSVLYCLEVALHYNNSDPRSAVDAVVDRLLERLGFVSKLNFQVDVSYVDF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK+ EEHARANG WD+PHPWLN+F+S
Sbjct  355  LLRVKQVEEHARANGMWDSPHPWLNMFVS  383



>ref|XP_009334680.1| PREDICTED: cytokinin dehydrogenase 7-like [Pyrus x bretschneideri]
Length=513

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 171/210 (81%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I  CSET NSELF+  LGGLGQFGIITRARV+LQP+PD
Sbjct  166  AFRYGPQTSNVTELEVVTGKGEIFNCSETENSELFFGALGGLGQFGIITRARVLLQPSPD  225

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR----DESFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
            MVRWIR+VY+ F+DFT+DAE LVTR     +SFDYVEGF FVNS++P +G  +VPL+   
Sbjct  226  MVRWIRLVYTEFDDFTRDAELLVTRHDDGGDSFDYVEGFAFVNSNNPADGRPSVPLDPQE  285

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
              +P ++P  +GP+LYCLE+A HY+N D PST++     L+GGL + ++L+F++++SY+ 
Sbjct  286  TFDPGHLPPTSGPILYCLELAHHYRNTDRPSTVDTGVNGLLGGLGFVEELKFQLDLSYVE  345

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            FLLRVK+ EEHA+ANG WD PHPWLN+F+S
Sbjct  346  FLLRVKRAEEHAKANGIWDAPHPWLNMFVS  375



>emb|CBI20721.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 160/201 (80%), Gaps = 2/201 (1%)
 Frame = +2

Query  23   TSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDMVRWIRV  202
            TSNVTE+EVVTG  +  VCSET N E+F+++LGGLGQFGIITRARV+LQPAPDMVRW+R+
Sbjct  135  TSNVTEMEVVTGKAETLVCSETQNPEIFFAILGGLGQFGIITRARVLLQPAPDMVRWMRL  194

Query  203  VYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPTYIPK  376
            VY+ F+ F++DAE LVTR E  SFDYVEGFVFVNS DPVNGW +VPL  + + N   +P+
Sbjct  195  VYAEFDAFSRDAEFLVTRPEGDSFDYVEGFVFVNSSDPVNGWPSVPLTPEQRFNSGRVPR  254

Query  377  DAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRVKKGE  556
             AG VLYC+E+ALHYK++DH ST++    R++G L + + L F V+V YM FLLRVK+ E
Sbjct  255  TAGSVLYCIEVALHYKSSDHASTVDMAVSRMLGRLGFIEGLEFHVDVGYMEFLLRVKRVE  314

Query  557  EHARANGTWDTPHPWLNLFIS  619
            E ARANG WD PHPWLNL +S
Sbjct  315  EDARANGIWDAPHPWLNLLVS  335



>ref|XP_006453000.1| hypothetical protein CICLE_v10007999mg [Citrus clementina]
 gb|ESR66240.1| hypothetical protein CICLE_v10007999mg [Citrus clementina]
Length=521

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 166/209 (79%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV +L+VVTGNGD+  CSE+   ELF++VLGGLGQFGIITRARV+LQ APD
Sbjct  175  AFRYGPQISNVAQLDVVTGNGDMVTCSESRQPELFFNVLGGLGQFGIITRARVLLQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVT---RDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
             VRWIR+VY+ F++FT+DAE LV+     ESFDYVEGFVFVNSDD VNGW +VPL+    
Sbjct  235  KVRWIRLVYAEFDEFTRDAELLVSLKEERESFDYVEGFVFVNSDDTVNGWPSVPLDPAQV  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P ++P+ AG VLYCLE+ALHY N+D  S ++   +RL+  L +  KL F V+VSY++F
Sbjct  295  FDPAHLPQTAGSVLYCLEVALHYNNSDPRSAVDAVVDRLLERLGFVSKLNFPVDVSYVDF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVK  EEHARANG WD+PHPWLN+F+S
Sbjct  355  LLRVKLVEEHARANGMWDSPHPWLNMFVS  383



>ref|XP_010261926.1| PREDICTED: cytokinin dehydrogenase 7 [Nelumbo nucifera]
Length=526

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 166/217 (76%), Gaps = 11/217 (5%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG GDI VCSET N+ELF+ VLGGLGQFGIITRARV LQ APD
Sbjct  171  AFRYGPQTSNVTELEVVTGKGDILVCSETQNAELFFGVLGGLGQFGIITRARVPLQTAPD  230

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR----DESFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
             VRWIR+VY  F++F  DAE L+TR     ESFDYVEGF FVNSDD VNGW +VPL SD 
Sbjct  231  RVRWIRLVYVEFKEFAGDAEFLITRPEGEGESFDYVEGFAFVNSDDRVNGWPSVPLRSDQ  290

Query  350  QLNPTYIPKDAGPVLYCLEMAL-------HYKNNDHPSTINKKAERLVGGLRYCKKLRFE  508
            + +P+ IP  AGPVLYCLE+AL       +   +D PST+++     +G LR+C+ L+FE
Sbjct  291  RFDPSLIPGTAGPVLYCLELALHHHNMNNNNDKDDDPSTVDEVMGHNLGRLRFCRDLKFE  350

Query  509  VNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            ++ SYM FLLRVK+ E+ A+ANG WD PHPWLNL +S
Sbjct  351  LDTSYMEFLLRVKRVEQEAKANGIWDAPHPWLNLLVS  387



>ref|XP_010669322.1| PREDICTED: cytokinin dehydrogenase 7 [Beta vulgaris subsp. vulgaris]
Length=531

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 173/208 (83%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I +CSE+ +S+LF++VLGGLGQFG+ITRAR+ LQ APD
Sbjct  186  AFRYGPQTSNVTELEVVTGRGEIVICSESVHSDLFFAVLGGLGQFGVITRARIPLQKAPD  245

Query  182  MVRWIRVVYSAFEDFTQDAESLVT--RDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIR+VY+ F++F++DAE LV+  +D+SFDY+EGFVFVNSDDP+NGW +V L+SD   
Sbjct  246  MVRWIRLVYAEFDEFSRDAEFLVSQPKDDSFDYLEGFVFVNSDDPINGWPSVTLDSDQWF  305

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            NP ++P  +G VLYCLE+ALH+ ++ HPS ++ + +RL+  LR+ K LRFEV+VSYM FL
Sbjct  306  NPDFLPTSSGSVLYCLELALHFHHHHHPSHVDSEVDRLIKRLRFVKGLRFEVDVSYMEFL  365

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVKK E+ A  +G W  PHPWLNLF+S
Sbjct  366  LRVKKVEQQATVSGIWAAPHPWLNLFVS  393



>ref|XP_007136881.1| hypothetical protein PHAVU_009G081800g [Phaseolus vulgaris]
 gb|ESW08875.1| hypothetical protein PHAVU_009G081800g [Phaseolus vulgaris]
Length=520

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 160/208 (77%), Gaps = 3/208 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR+GPQTSNVTELEVVTG G+   CS T NSELF+  LGGLGQFGIITRARV+LQ AP+M
Sbjct  172  FRYGPQTSNVTELEVVTGKGETLCCSLTQNSELFFGALGGLGQFGIITRARVVLQQAPEM  231

Query  185  VRWIRVVYSAFEDFTQDA-ESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            VRWIRVVYS FE++  DA   +   +E FDYVEGFV VNSDDP NGW TVPL  +   +P
Sbjct  232  VRWIRVVYSEFEEYAGDAELLVEEVEECFDYVEGFVLVNSDDPANGWPTVPLEPEQVFDP  291

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHP--STINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
             +IP  AGPVLYCLE+ LHY N DHP  S ++   +RL+G LR+ + L+F+ +V+Y  FL
Sbjct  292  VHIPSTAGPVLYCLELGLHYGNADHPYRSRVDMDVDRLLGRLRFIQGLKFQTDVTYTEFL  351

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+A+GTWD PHPWLNLF+S
Sbjct  352  LRVKRVEEDAKASGTWDAPHPWLNLFVS  379



>ref|XP_010049279.1| PREDICTED: cytokinin dehydrogenase 7 [Eucalyptus grandis]
Length=534

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 161/208 (77%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQTSNVTELEVVTG G+   CS + NSELF++VLGGLGQFGIIT+A+++LQPAPD
Sbjct  176  AFRHGPQTSNVTELEVVTGQGETLTCSRSDNSELFFAVLGGLGQFGIITKAKILLQPAPD  235

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F +FT+DAESLVTR   ++FDY+EGF FVNSDDPVNGW TVPL    + 
Sbjct  236  MVRWIRVVYADFGEFTRDAESLVTRPDGDTFDYIEGFAFVNSDDPVNGWPTVPLEPGQRF  295

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P+ +  DAG VLYCLE+ LH++ ++ PS ++    +L+G L + + L F  +V Y +FL
Sbjct  296  DPSRLSPDAGSVLYCLELGLHHQRSNPPSDVDSVVGKLLGRLGFVEGLEFRRDVGYADFL  355

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRV+  E  A+A G WD PHPWLNLF+S
Sbjct  356  LRVQNAERDAKATGLWDAPHPWLNLFVS  383



>ref|XP_011460257.1| PREDICTED: cytokinin dehydrogenase 7-like [Fragaria vesca subsp. 
vesca]
Length=493

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 164/209 (78%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNVTELEVVTG G+I VCSET +SELF+SVLGGLGQFG+ITRAR++LQPAPD
Sbjct  145  SFRYGPQISNVTELEVVTGKGEICVCSETQHSELFFSVLGGLGQFGVITRARILLQPAPD  204

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR---DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            MVR IR+VY+ F+ FT+DAESLVTR    ++FDY+EGF   N+D P +G  +VPL+ D  
Sbjct  205  MVRRIRLVYTEFDAFTRDAESLVTRRRDHDTFDYIEGFALPNNDCP-DGLPSVPLSRDQV  263

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             + T +PK+AG VLY LE+A HY+++D  S ++   +R + GL + + LRF+V++ Y  F
Sbjct  264  FDRTRLPKEAGSVLYYLELAHHYRSSDSISDVDMGVDRRLRGLGFVEGLRFQVDLGYEEF  323

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LLRVKK EE  RA+G WD+PHPWLN+F+S
Sbjct  324  LLRVKKEEEIGRASGIWDSPHPWLNIFVS  352



>ref|XP_010917178.1| PREDICTED: cytokinin dehydrogenase 11-like [Elaeis guineensis]
Length=530

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 157/208 (75%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNVTELEVVTG+G+  VCS   NS LF++VLGGLGQFG+ITRAR+ L PAP 
Sbjct  182  AFRHGPQISNVTELEVVTGDGERVVCSAAANSNLFFAVLGGLGQFGVITRARIPLHPAPH  241

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD--ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MV+WIRVVY+ FED+++DAE LV R   ++ DYVEGF FVNS DPV+GW +VPL+     
Sbjct  242  MVKWIRVVYNRFEDYSRDAEWLVIRSDPDACDYVEGFAFVNSADPVDGWPSVPLSPASPF  301

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P  IP  +GPVLYCLE+ALH+ + +H  TI+++A  ++  LRY   L F V  +Y++FL
Sbjct  302  DPALIPAGSGPVLYCLEVALHFNHAEH-GTIDQRAGEMLRRLRYIPGLEFAVEATYVDFL  360

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ EE ARANG+W  PHPWLN+ ++
Sbjct  361  SRVKRAEEAARANGSWAAPHPWLNILVA  388



>ref|XP_008786614.1| PREDICTED: cytokinin dehydrogenase 11-like [Phoenix dactylifera]
Length=539

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNVTELEVVTG+G   VCS   +S+LF++VLGGLGQFG+ITRAR+ L PAP 
Sbjct  191  AFRHGPQISNVTELEVVTGDGKRVVCSAGSSSDLFFAVLGGLGQFGVITRARIPLHPAPH  250

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            +V+WIRVVY+ FED+++DAE LVTR E    DYVEGF FVNS DPVNGW  VPL+     
Sbjct  251  LVKWIRVVYNRFEDYSRDAEWLVTRPEPDGCDYVEGFAFVNSADPVNGWPLVPLSPASPF  310

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P  IP  +GPVLYCLE+ALH+ N+D    I ++A+ ++  LRY + L F V  +Y++FL
Sbjct  311  DPALIPAGSGPVLYCLELALHF-NHDERGAIEQRADEILRRLRYIRGLEFAVEATYVDFL  369

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ EE ARANG+W  PHPWLNL ++
Sbjct  370  SRVKRVEEAARANGSWAAPHPWLNLLVA  397



>ref|XP_006849648.1| hypothetical protein AMTR_s00024p00226830 [Amborella trichopoda]
 gb|ERN11229.1| hypothetical protein AMTR_s00024p00226830 [Amborella trichopoda]
Length=531

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 158/208 (76%), Gaps = 2/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ  NV E+EVVTG+G++  CSE  N ELF+ VLGGLGQFGIITRAR++LQ APD
Sbjct  186  SFRYGPQVVNVEEMEVVTGSGEVVRCSERENGELFFGVLGGLGQFGIITRARILLQKAPD  245

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F+DF++D E LVTR   ESFDY+EGFVF NSD PVNG  +VPL      
Sbjct  246  MVRWIRVVYADFDDFSRDQELLVTRASSESFDYIEGFVFTNSDHPVNGCHSVPLLPHQTF  305

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +   IP +AGPVLYCLE+ALH+ N D   TI K+  +++  L++ + L+F  +++Y +FL
Sbjct  306  DLNLIPANAGPVLYCLEIALHFANRDDAKTIEKRVSQMLEPLKFRRGLKFSCDLTYYDFL  365

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK  EE A+ANGTWD PHPWLNLFIS
Sbjct  366  QRVKSNEEAAKANGTWDAPHPWLNLFIS  393



>ref|XP_010932426.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 11-like 
[Elaeis guineensis]
Length=530

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV ELEVVTGNG+  VCS   + +LF++ LGGLGQFG+ITRAR+ L PAP 
Sbjct  182  AFRHGPQIANVLELEVVTGNGERVVCSAAAHPDLFFAALGGLGQFGVITRARIPLLPAPR  241

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MV+W+RVVY  FE+++ DAE LVTR E  +FDYVEGFVFVNS D VNGW +VP + D   
Sbjct  242  MVKWMRVVYDRFEEYSGDAEWLVTRPEPDAFDYVEGFVFVNSADSVNGWPSVPFSPDSPF  301

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P  IP  +GPVLYCLE+ALH+ N     TI+++A  ++  LRY + L F V  +Y++FL
Sbjct  302  DPAIIPAGSGPVLYCLEVALHF-NQHECDTIDQRACAMMRPLRYIRGLEFAVEATYVDFL  360

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RVK+ E+ ARANGTW  PHPWLNL ++
Sbjct  361  SRVKRAEDAARANGTWAAPHPWLNLLMA  388



>ref|XP_009408414.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 11-like 
[Musa acuminata subsp. malaccensis]
Length=528

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NVTELEVVTG+G+  VCS +  S+LF++VLGGLGQFG ITRAR+ L PAP 
Sbjct  176  AFRHGPQVANVTELEVVTGDGERLVCSPSTASDLFFAVLGGLGQFGFITRARIPLVPAPK  235

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVN-SDDPVNGWSTVPLNSDHQ  352
            MVRWIRVVY AF+++ +DAE LVTRD+S  FDYVEGFVF N + DPV+GWS+VP+     
Sbjct  236  MVRWIRVVYGAFDEYARDAEWLVTRDDSAAFDYVEGFVFRNDASDPVSGWSSVPIPPGSA  295

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P   P D+ P+LYCLE+ALHY ++     ++++A+ ++  LR+ + L F  +VSY+ F
Sbjct  296  FDPARXPADSSPILYCLELALHY-DHIQADNVDERAKEMLRPLRFLRGLEFAADVSYVEF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            L RV + EE ARA+GTW TPHPWLNL +S
Sbjct  355  LSRVGRVEEEARASGTWATPHPWLNLLVS  383



>ref|XP_006660189.1| PREDICTED: cytokinin dehydrogenase 11-like, partial [Oryza brachyantha]
Length=432

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 153/208 (74%), Gaps = 4/208 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNV +LEVVTG+G+  VCS + + +LF++VLGGLGQFG+ITRAR+ L PAP 
Sbjct  73   SFRYGPQVSNVAQLEVVTGDGECHVCSRSADPDLFFAVLGGLGQFGVITRARIPLSPAPQ  132

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD--ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             VRW RVVY++F D+  DAE LVTR   E+FDYVEGF FV SDDPVNGW +VP+    + 
Sbjct  133  TVRWTRVVYASFADYAADAEWLVTRPAHEAFDYVEGFAFVRSDDPVNGWPSVPIPDGARF  192

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P+ +P  AGPVLYCLE+AL+ +++ H   ++K+   ++  L+Y + L F   V Y+ FL
Sbjct  193  DPSLLPAGAGPVLYCLEVALYQQHHHH--DMDKRVGEMMQQLKYVRGLEFAAGVGYVEFL  250

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RV + E+ AR NG+W  PHPWLNLFIS
Sbjct  251  SRVNRVEDEARRNGSWAAPHPWLNLFIS  278



>ref|XP_004973628.1| PREDICTED: cytokinin dehydrogenase 11-like [Setaria italica]
Length=518

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 152/213 (71%), Gaps = 7/213 (3%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNV ELEVVTG+GD  VCS + + +LF++VLGGLGQFG+ITRAR+ L+ AP 
Sbjct  166  SFRYGPQVSNVAELEVVTGDGDCRVCSPSSHPDLFFAVLGGLGQFGVITRARIPLRRAPR  225

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             VRW RVVY++F D+T DAE LVTR  +E+FDYVEGF FVNSDDPVNGW +VP+    + 
Sbjct  226  AVRWTRVVYASFADYTADAEWLVTRPPEEAFDYVEGFAFVNSDDPVNGWPSVPIPGGARF  285

Query  356  NPTYIPKDAGPVLYCLEMALHYK-----NNDHPSTINKKAERLVGGLRYCKKLRFEVNVS  520
            + + +P  AGPVLYCLE+AL+        +D          R++  L+Y + L F   V 
Sbjct  286  DASLLPAGAGPVLYCLEVALYQYPDGAVEDDEDKAAAAAVSRMMAPLKYVRGLEFAAGVG  345

Query  521  YMNFLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            Y++FL RV + EE AR NG+WD PHPWLNLF+S
Sbjct  346  YVDFLSRVNRVEEEARRNGSWDAPHPWLNLFVS  378



>ref|XP_002445610.1| hypothetical protein SORBIDRAFT_07g022530 [Sorghum bicolor]
 gb|EES15105.1| hypothetical protein SORBIDRAFT_07g022530 [Sorghum bicolor]
Length=520

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 153/216 (71%), Gaps = 10/216 (5%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNV ELEVVTG+G+  VCS + + +LF++VLGGLGQFG+ITRAR+ L  AP 
Sbjct  160  SFRYGPQVSNVAELEVVTGDGEYRVCSRSSHPDLFFAVLGGLGQFGVITRARIPLHKAPK  219

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             VRW RVVY++F D+T DAE LVTR  D +FDYVEGF FVNSDDPVNGW +VP+    + 
Sbjct  220  AVRWTRVVYASFADYTADAEWLVTRDPDAAFDYVEGFAFVNSDDPVNGWPSVPIPGGARF  279

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDH--------PSTINKKAERLVGGLRYCKKLRFEV  511
            + + +P  AGPVLYCLE+AL+  +  H           +   + R++  L+Y + L F  
Sbjct  280  DASLLPAGAGPVLYCLEVALYQYDAHHRPDDDDDEDQGVASVSRRMMARLKYVRGLEFAA  339

Query  512  NVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            +V Y++FL RV + EE AR NG+WD PHPWLNLF+S
Sbjct  340  DVGYVDFLSRVNRVEEEARRNGSWDAPHPWLNLFVS  375



>gb|KJB65481.1| hypothetical protein B456_010G096700 [Gossypium raimondii]
Length=345

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG GDI VCSET N ELF+  LGGLGQFGIITRARV LQPAPD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGDITVCSETQNPELFFGALGGLGQFGIITRARVKLQPAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ FE+FT+DAE LV++  DESFDYVEGFVF N+DDPVNGW +V LN D + 
Sbjct  232  MVRWIRVVYAEFEEFTRDAELLVSQKEDESFDYVEGFVFCNNDDPVNGWPSVQLNPDQEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTIN  451
            NP ++P+ AGPVLYCLE+  HY+N+D PST++
Sbjct  292  NPAHLPQTAGPVLYCLELGFHYRNSDQPSTVD  323



>ref|XP_009414109.1| PREDICTED: cytokinin dehydrogenase 11-like [Musa acuminata subsp. 
malaccensis]
Length=524

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 155/209 (74%), Gaps = 4/209 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV ELEVVTG+G+  VCS +  S+LF++ LGGLGQFG+ITRAR+ L PAP 
Sbjct  176  AFRHGPQVANVAELEVVTGDGERRVCSPSLCSDLFFAALGGLGQFGVITRARIPLVPAPK  235

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNS-DDPVNGWSTVPLNSDHQ  352
            MVRWIRVVY  FE++  DAE LVTR   E+FDYVEGF FVN   DPVNGW +VP+     
Sbjct  236  MVRWIRVVYKGFEEYAGDAEWLVTRADSEAFDYVEGFAFVNDVSDPVNGWGSVPILPGSV  295

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
             +P  IP ++ P+LYCLE+ALH+ N+   + ++++A+ ++  LRY + L F  +VSY++F
Sbjct  296  FDPAKIPAESEPILYCLELALHH-NHSGAAGVDERAKEMMWPLRYMRGLVFAADVSYVDF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            L RV + EE ARANGTW TPHPWLN+ +S
Sbjct  355  LSRVGRSEEEARANGTWATPHPWLNILVS  383



>ref|XP_008784471.1| PREDICTED: cytokinin dehydrogenase 11-like [Phoenix dactylifera]
Length=531

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV ELEVV GNG+  VCS     +LF++ LGGLGQFG+ITRARV L   P 
Sbjct  182  AFRHGPQIANVLELEVVIGNGERVVCSAAARPDLFFATLGGLGQFGVITRARVPLLLVPC  241

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE--SFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MV+WIRVVY  FE++++DAE LVTR E  +FDYVEGF FVNS D VNGW +VPL+ D   
Sbjct  242  MVKWIRVVYDRFEEYSRDAEWLVTRPEPAAFDYVEGFAFVNSADSVNGWPSVPLSPDSPF  301

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
             P  IP  +GPVLYCLE+ALH+ +++    I+++A  L+  LRY + L F   + Y++FL
Sbjct  302  EPARIPAGSGPVLYCLEVALHFNHHER-DAIDQRAGGLLRPLRYIRGLEFAAELPYVDFL  360

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
             RV++ E+ ARANGTW TPHPWLNL ++
Sbjct  361  SRVQRAEDAARANGTWATPHPWLNLLVA  388



>gb|EEE68814.1| hypothetical protein OsJ_27576 [Oryza sativa Japonica Group]
Length=435

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 151/211 (72%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNV +LEVVTG+G+  VCS + + +LF++VLGGLGQFG+ITRAR+ L PAP 
Sbjct  78   SFRYGPQVSNVAQLEVVTGDGECHVCSRSADPDLFFAVLGGLGQFGVITRARIPLSPAPQ  137

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             VRW RVVY++F D+  DAE LVTR   E+FDYVEGF FV SDDPVNGW TVP+      
Sbjct  138  TVRWTRVVYASFADYAADAEWLVTRPPHEAFDYVEGFAFVRSDDPVNGWPTVPIPDGAHF  197

Query  356  NPTYIPKDAGPVLYCLEMALHYK---NNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + + +P +AGPVLYCLE+AL+ +    +     ++K+   ++  L+Y + L F   V Y+
Sbjct  198  DASLLPANAGPVLYCLEVALYQRGGGGDGGGDDMDKRVGEMMRQLKYVRGLEFAAGVGYV  257

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            +FL RV + E+ AR NG+W  PHPWLNLFIS
Sbjct  258  DFLSRVNRVEDEARRNGSWAAPHPWLNLFIS  288



>ref|NP_001146838.1| cytokinin dehydrogenase 10 [Zea mays]
 gb|ACJ06785.1| cytokinin dehydrogenase 10 [Zea mays]
 tpg|DAA48773.1| TPA: cytokinin dehydrogenase 10 isoform 1 [Zea mays]
 tpg|DAA48774.1| TPA: cytokinin dehydrogenase 10 isoform 2 [Zea mays]
Length=525

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 153/217 (71%), Gaps = 12/217 (6%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNV ELEVVTG+G+  VCS + + +LF++VLGGLGQFG+ITRAR+ L  AP 
Sbjct  171  SFRYGPQVSNVAELEVVTGDGERRVCSPSSHPDLFFAVLGGLGQFGVITRARIPLHRAPQ  230

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             VRW RVVY++  D+T DAE LVTR  D +FDYVEGF FVNSDDPVNGW +VP+    + 
Sbjct  231  AVRWTRVVYASIADYTADAEWLVTRPPDAAFDYVEGFAFVNSDDPVNGWPSVPIPGGARF  290

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKA---------ERLVGGLRYCKKLRFE  508
            +P+ +P  AGPVLYCLE+AL Y+    P  ++             R++  L++ + L F 
Sbjct  291  DPSLLPAGAGPVLYCLEVAL-YQYAHRPDDVDDDDEEDQAAVTVSRMMAPLKHVRGLEFA  349

Query  509  VNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
             +V Y++FL RV + EE AR NG+WD PHPWLNLF+S
Sbjct  350  ADVGYVDFLSRVNRVEEEARRNGSWDAPHPWLNLFVS  386



>sp|Q6Z955.1|CKX11_ORYSJ RecName: Full=Cytokinin dehydrogenase 11; AltName: Full=Cytokinin 
oxidase 11; Short=OsCKX11; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD09964.1| putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
Length=518

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 151/211 (72%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNV +LEVVTG+G+  VCS + + +LF++VLGGLGQFG+ITRAR+ L PAP 
Sbjct  161  SFRYGPQVSNVAQLEVVTGDGECHVCSRSADPDLFFAVLGGLGQFGVITRARIPLSPAPQ  220

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             VRW RVVY++F D+  DAE LVTR   E+FDYVEGF FV SDDPVNGW TVP+      
Sbjct  221  TVRWTRVVYASFADYAADAEWLVTRPPHEAFDYVEGFAFVRSDDPVNGWPTVPIPDGAHF  280

Query  356  NPTYIPKDAGPVLYCLEMALHYK---NNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + + +P +AGPVLYCLE+AL+ +    +     ++K+   ++  L+Y + L F   V Y+
Sbjct  281  DASLLPANAGPVLYCLEVALYQRGGGGDGGGDDMDKRVGEMMRQLKYVRGLEFAAGVGYV  340

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            +FL RV + E+ AR NG+W  PHPWLNLFIS
Sbjct  341  DFLSRVNRVEDEARRNGSWAAPHPWLNLFIS  371



>gb|KJB54571.1| hypothetical protein B456_009G040700 [Gossypium raimondii]
Length=340

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQTSNVTELEVVTG G+I VCSET NSELF+ VLGGLGQFGIITRAR+ LQ APD
Sbjct  172  AFRYGPQTSNVTELEVVTGKGEITVCSETLNSELFFGVLGGLGQFGIITRARIKLQQAPD  231

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRD--ESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVYS FE+FT+DAE LVT+   ESFDYVEGFVF N+DDP NGW +VPL+  H+ 
Sbjct  232  MVRWIRVVYSEFEEFTRDAEFLVTQKEGESFDYVEGFVFCNNDDPFNGWPSVPLDPGHEF  291

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPS  442
            NPT+I + AG VLYCLE+A HY+N+DHP+
Sbjct  292  NPTHISQTAGSVLYCLEVAFHYRNSDHPT  320



>gb|AFK79782.1| cytokinin oxidase/dehydrogenase, partial [Hordeum vulgare subsp. 
vulgare]
Length=233

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = +2

Query  26   SNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDMVRWIRVV  205
            SNV ELEVVTG G+  VCS + + +LF++VLGGLGQFG+ITRAR+ L PAP  VRW RVV
Sbjct  1    SNVVELEVVTGEGECRVCSPSSHPDLFFAVLGGLGQFGVITRARIPLSPAPRTVRWARVV  60

Query  206  YSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPTYIPK-  376
            Y++F ++  DAE LVTR  + +FDYVEGF FV SDDPVNGW +VP+ +  + +P+ +P  
Sbjct  61   YASFAEYAADAEWLVTRPSESAFDYVEGFAFVRSDDPVNGWPSVPIPAGARFDPSLLPAG  120

Query  377  DAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRVKKGE  556
            + GP+LYCLE+AL+      P  ++++   ++  L+Y + L +  +V Y+ FL RV + E
Sbjct  121  EPGPLLYCLEVALYQHQQQQPDDVDERMGEMMRRLKYVRGLEYAADVGYVEFLSRVNRVE  180

Query  557  EHARANGTWDTPHPWLNLFIS  619
            E AR +G+WD PHPWLNLF+S
Sbjct  181  EEARRSGSWDAPHPWLNLFVS  201



>ref|XP_010235198.1| PREDICTED: cytokinin dehydrogenase 11 [Brachypodium distachyon]
Length=513

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 145/206 (70%), Gaps = 3/206 (1%)
 Frame = +2

Query  8    RFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDMV  187
            R+GPQ SNV ELEVVTG+G   VCS + +S+LF++VLGGLGQFG+ITRAR+ L PAP  V
Sbjct  163  RYGPQVSNVAELEVVTGDGKRHVCSPSSHSDLFFAVLGGLGQFGVITRARIPLSPAPQTV  222

Query  188  RWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            +W RVVY++F ++  DAE LVTR  + + DYVEGF FV SDDPVNGW +VP+       P
Sbjct  223  KWTRVVYASFAEYAADAEWLVTRPAESALDYVEGFAFVRSDDPVNGWPSVPIPGGAHFEP  282

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            + +P  AGPVLYCLE+AL Y++      ++++   ++  L+Y + L F   V Y+ FL R
Sbjct  283  SLLPAGAGPVLYCLEVAL-YQHRHRQDDVDERMGAMMRQLKYVRGLEFAAEVGYVEFLSR  341

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            V   EE AR NG+W  PHPWLNLFIS
Sbjct  342  VNHVEEEARRNGSWAAPHPWLNLFIS  367



>gb|ADB81979.1| cytokinin oxidase/dehydrogenase 3 [Triticum aestivum]
Length=516

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 152/209 (73%), Gaps = 3/209 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            +FR+GPQ SNV ELEVVTG G+  VCS + + +LF++VLGGLGQFG+ITRAR+ L PAP 
Sbjct  166  SFRYGPQVSNVAELEVVTGEGECRVCSHSAHPDLFFAVLGGLGQFGVITRARIPLSPAPQ  225

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
             V+W RVVY++F ++  DAE LVTR  + +FDYVEGF FV SDDPVNGW +VP+ +  + 
Sbjct  226  TVKWARVVYASFAEYAADAEWLVTRPAESAFDYVEGFAFVRSDDPVNGWPSVPIPAGARF  285

Query  356  NPT-YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
            +P+  +  ++GP+LYCLE+AL+   +  P  ++++   ++  L+Y + L +  +V Y+ F
Sbjct  286  DPSLLLAGESGPLLYCLEVALYQHPHQQPDDVDERMREMMRRLKYVRGLEYAADVRYVEF  345

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFIS  619
            L RV + EE AR +G+W  PHPWLNLF+S
Sbjct  346  LSRVNRVEEEARRSGSWAAPHPWLNLFVS  374



>gb|KCW81798.1| hypothetical protein EUGRSUZ_C031572, partial [Eucalyptus grandis]
Length=328

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 125/153 (82%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQTSNVTELEVVTG G+   CS + NSELF++VLGGLGQFGIIT+A+++LQPAPD
Sbjct  176  AFRHGPQTSNVTELEVVTGQGETLTCSRSDNSELFFAVLGGLGQFGIITKAKILLQPAPD  235

Query  182  MVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F +FT+DAESLVTR   ++FDY+EGF FVNSDDPVNGW TVPL    + 
Sbjct  236  MVRWIRVVYADFGEFTRDAESLVTRPDGDTFDYIEGFAFVNSDDPVNGWPTVPLEPGQRF  295

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINK  454
            +P+ +  DAG VLYCLE+ LH++ ++ PS ++ 
Sbjct  296  DPSRLSPDAGSVLYCLELGLHHQRSNPPSDVDS  328



>ref|XP_006854620.1| hypothetical protein AMTR_s00030p00163490 [Amborella trichopoda]
 gb|ERN16087.1| hypothetical protein AMTR_s00030p00163490 [Amborella trichopoda]
Length=434

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 137/216 (63%), Gaps = 12/216 (6%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ S V ++E+VTG G++  CS T   +LFY  LGGLGQFGIIT+AR+ +QPAP 
Sbjct  186  AFRHGPQISTVLQMEIVTGKGEVITCSHTEEEDLFYGALGGLGQFGIITKARIAIQPAPQ  245

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES----FDYVEGFVFVNSDDPVNGWSTVPLNS--  343
              RWIR +Y  FE+F  D E L++   S    FDY+EGFV    DDP++GW T+P N+  
Sbjct  246  RTRWIRAIYEEFEEFKGDQEMLISMPSSSHHVFDYIEGFVACIGDDPIDGWDTIPPNTMI  305

Query  344  -----DHQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFE  508
                 DH  +  +    +  V YCLE+A++Y   D    I+KK + +VG LR+   + + 
Sbjct  306  THHTYDHH-HAAWNSSSSSTVRYCLELAINYNTADSTHDIDKKMKAMVGSLRFSGGVVYS  364

Query  509  VNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            V+VSY++FL RV   E  ARA GTWD PHPWLN+ +
Sbjct  365  VDVSYLDFLSRVSYSEARARAIGTWDAPHPWLNILV  400



>emb|CDM86341.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY  LGGLGQFGIITRAR+ LQPAP 
Sbjct  183  AFRQGPQVSNVNQLEIVTGRGDVVTCSPDENSDLFYGALGGLGQFGIITRARIALQPAPK  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E+L++ DE+FDY+EGFV +N    +N W T        +  
Sbjct  243  MVRWIRVLYSDFASFTEDQEALISADETFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  301

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLEM  ++ + +    + ++   L+  LRY +   F  +V+Y+ FL R
Sbjct  302  SHFQSD-GKVLYCLEMTKNF-DPEEADIMEQEVGVLLSRLRYIQSTLFHTHVTYLEFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  360  VHSSELKLRAQGLWEVPHPWLNLLI  384



>gb|KFK36997.1| hypothetical protein AALP_AA4G199000 [Arabis alpina]
Length=551

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 138/206 (67%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LEVVTG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L+PAP 
Sbjct  205  AFKNGPQINNVYQLEVVTGKGEVVTCSEKRNSELFYSVLGGLGQFGIITRARISLRPAPH  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++ +FDY+EGFV  N  D +N W +    +D     
Sbjct  265  MVKWIRVLYSEFSAFSKDQEHLISKENAFDYLEGFVIFNRTDLLNNWRSSFSPNDSTQAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+A  Y N +  +++N++ E+L+  L Y     F   VSY+ FL R
Sbjct  325  QF--KSDGKTLYCLEVA-KYFNPEEANSMNQETEKLLSELHYIPSTLFTSEVSYIEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            V   E+  RA G W+ PHPWLNL IS
Sbjct  382  VHIAEKKLRAKGLWEVPHPWLNLLIS  407



>ref|XP_008464595.1| PREDICTED: cytokinin dehydrogenase 1 isoform X2 [Cucumis melo]
Length=479

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++ VCSE  N++LF++VLGGLGQFGIITRAR+ L+ AP 
Sbjct  200  AFRHGPQISNVYQLEVVTGKGEVVVCSENQNADLFHAVLGGLGQFGIITRARISLEKAPK  259

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ ++ FDY+EGFVF+N    +N W +   N    L  
Sbjct  260  MVKWIRVLYSDFSKFTRDQEYLISSNDQFDYIEGFVFINRTGLLNNWRS-SFNPKEPLQA  318

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G + +CLEMA  Y N D    +NKK E L+  L Y     F   V+Y++FL R
Sbjct  319  SKFNSD-GKIFFCLEMA-KYFNPDEIDFMNKKVESLMSELSYIPSTLFTSEVTYLDFLDR  376

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  377  VHVSENKLRAKGLWEVPHPWLNLLI  401



>gb|EMS67590.1| Cytokinin dehydrogenase 4 [Triticum urartu]
Length=418

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY  LGGLGQFGIITRAR+ L+PAP 
Sbjct  76   AFRQGPQVSNVNQLEIVTGRGDVVTCSPEENSDLFYGALGGLGQFGIITRARIALEPAPK  135

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E+L++ +E+FDY+EGFV +N    +N W T        +  
Sbjct  136  MVRWIRVLYSDFASFTEDQEALISAEETFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  194

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLEM  ++ + D    + ++   L+  LRY +   F  +V+Y+ FL R
Sbjct  195  SHFQSD-GKVLYCLEMTKNF-DPDEADIMEQEVGVLLSRLRYIQSTLFHTDVTYLEFLDR  252

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  253  VHSSELKLRAQGLWEVPHPWLNLLI  277



>gb|KHN37061.1| Cytokinin dehydrogenase 7 [Glycine soja]
Length=289

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = +2

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRVVY+ F DFT+DAE LVT  E   FDYVEGFVFVNSDDP NGW TVP+  +   
Sbjct  1    MVRWIRVVYTEFGDFTRDAEWLVTLREGDGFDYVEGFVFVNSDDPCNGWITVPVGPNQYF  60

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P  IP  AGPVLYCLE+ALHY+N DHPS ++ + +RL+G LR+ + L+F V+V+YM FL
Sbjct  61   DPVRIPSIAGPVLYCLELALHYRNQDHPSAVDMEVDRLLGRLRFVEGLKFSVDVTYMEFL  120

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ANG WD PHPWLN+F+S
Sbjct  121  LRVKRVEEDAKANGIWDAPHPWLNMFVS  148



>ref|XP_006421171.1| hypothetical protein CICLE_v10006491mg [Citrus clementina]
 gb|ESR34411.1| hypothetical protein CICLE_v10006491mg [Citrus clementina]
Length=545

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ +NV +LEVVTG GD+  CSE  N++LF+ VLGGLGQFGIITRAR+ L+PAP 
Sbjct  204  AFLHGPQINNVYQLEVVTGKGDVLTCSEQQNADLFHGVLGGLGQFGIITRARISLEPAPK  263

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E L++ + SFDY+EGFV +N    +N W +   N    L  
Sbjct  264  MVRWIRVLYSEFSIFTKDQEHLISSESSFDYIEGFVIINRTGLLNNWRS-SFNPRDPLQA  322

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLEMA H+ N D    ++KK E L+  L +     F+ +VSY++FL R
Sbjct  323  SKFNSD-GKVLYCLEMAKHF-NPDEAGIMDKKTESLLSKLSFIPSTLFQSDVSYVDFLDR  380

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G W+ PHPWLNL I
Sbjct  381  VHVSEIKLREKGLWEVPHPWLNLLI  405



>ref|XP_006293839.1| hypothetical protein CARUB_v10022823mg [Capsella rubella]
 gb|EOA26737.1| hypothetical protein CARUB_v10022823mg [Capsella rubella]
Length=626

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 137/205 (67%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L+PAP 
Sbjct  265  AFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSVLGGLGQFGIITRARIFLEPAPH  324

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++++FDYVEGFV +N  D +N W +    +D     
Sbjct  325  MVKWIRVLYSDFSAFSRDQEHLISKEKTFDYVEGFVIINRTDLLNNWRSSFSPNDSTQAS  384

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  S++N++  +L+  L Y +   F   V Y+ FL R
Sbjct  385  KF--KSDGKTLYCLEV-VKYFNPEEASSMNQETSKLLSELNYIRSTLFSSEVPYIEFLDR  441

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  442  VHIAERKLRAKGLWEVPHPWLNLLI  466



>gb|EAZ14789.1| hypothetical protein OsJ_04719 [Oryza sativa Japonica Group]
Length=410

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CS   NS+LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  68   AFRHGPQVSNVNQLEIVTGRGEVVTCSHEVNSDLFYAALGGLGQFGIITRARIALEPAPK  127

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  +++FDY+EGFV +N    +N W T        +  
Sbjct  128  MVRWIRVLYSDFETFTEDQEKLIASEKTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  186

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLE+ +++ N+D    + ++   L+  LRY     F  +V+Y+ FL R
Sbjct  187  SQFQSD-GRVLYCLELTMNF-NHDEADIMEQEVGALLSRLRYISSTLFYTDVTYLEFLDR  244

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  245  VHTSELKLRAQGLWEVPHPWLNLLI  269



>ref|XP_006645310.1| PREDICTED: cytokinin dehydrogenase 4-like [Oryza brachyantha]
Length=527

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  185  AFRHGPQVSNVNQLEIVTGRGDVVTCSHEENSDLFYAALGGLGQFGIITRARIALEPAPK  244

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+T +++FDY+EGFV +N    +N W +        +  
Sbjct  245  MVRWIRVLYSDFETFTEDQEMLITAEKTFDYIEGFVIINRTGILNNWRS-SFKPQDPVQA  303

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLEM  ++ N+D    + ++   L+  LRY     F  +V+Y+ FL R
Sbjct  304  SQFQSD-GRVLYCLEMTKNF-NHDEAGIMEQEVGALLSRLRYISSTLFYTDVTYLEFLDR  361

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  362  VHTSELKLRAQGLWEVPHPWLNLLI  386



>ref|XP_008464594.1| PREDICTED: cytokinin dehydrogenase 1 isoform X1 [Cucumis melo]
Length=542

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++ VCSE  N++LF++VLGGLGQFGIITRAR+ L+ AP 
Sbjct  200  AFRHGPQISNVYQLEVVTGKGEVVVCSENQNADLFHAVLGGLGQFGIITRARISLEKAPK  259

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ ++ FDY+EGFVF+N    +N W +   N    L  
Sbjct  260  MVKWIRVLYSDFSKFTRDQEYLISSNDQFDYIEGFVFINRTGLLNNWRS-SFNPKEPLQA  318

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G + +CLEMA  Y N D    +NKK E L+  L Y     F   V+Y++FL R
Sbjct  319  SKFNSD-GKIFFCLEMA-KYFNPDEIDFMNKKVESLMSELSYIPSTLFTSEVTYLDFLDR  376

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  377  VHVSENKLRAKGLWEVPHPWLNLLI  401



>ref|XP_006491496.1| PREDICTED: cytokinin dehydrogenase 1-like [Citrus sinensis]
Length=549

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ +NV +LEVVTG GD+  CSE  N++LF+ VLGGLGQFGIITRAR+ L+PAP 
Sbjct  208  AFLHGPQINNVYKLEVVTGKGDVLTCSEQQNADLFHGVLGGLGQFGIITRARISLEPAPK  267

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E L++ + SFDY+EGFV +N    +N W +   N    L  
Sbjct  268  MVRWIRVLYSEFSIFTKDQEHLISSESSFDYIEGFVIINRTGLLNNWRS-SFNPRDPLQA  326

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLEMA H+ N D    ++KK E L+  L +     F+ +VSY++FL R
Sbjct  327  SKFNSD-GKVLYCLEMAKHF-NPDEAGIMDKKTESLLSKLSFIPSTLFQSDVSYVDFLDR  384

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G W+ PHPWLNL I
Sbjct  385  VHVSEIKLREKGLWEVPHPWLNLLI  409



>ref|XP_003605865.1| Cytokinin oxidase [Medicago truncatula]
 gb|AES88062.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=528

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 135/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LE+VTG G++  CSE  N ELF SVLGGLGQFGIITRAR++L+PAP 
Sbjct  187  AFKHGPQISNVQQLEIVTGTGEVVNCSEKQNEELFQSVLGGLGQFGIITRARILLEPAPS  246

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F +FT+D E L++ + +FDY+EGFV +N    +N W +   N    +  
Sbjct  247  MVKWIRVLYSDFTEFTRDQERLISEENAFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  305

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G  L+CLE+A  Y N    + +N+  ER +  L Y +   F+  V+Y+ FL R
Sbjct  306  SHFKSD-GKTLFCLELA-KYFNFQQINIVNQDVERHLSRLNYIRSTLFQTEVTYVEFLDR  363

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  364  VHVSEVKLRSKGLWDVPHPWLNLFI  388



>ref|XP_004971217.1| PREDICTED: cytokinin dehydrogenase 4-like [Setaria italica]
Length=522

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  180  AFRHGPQVSNVNQLEIVTGRGDVVTCSPEENSDLFYAALGGLGQFGIITRARIALEPAPK  239

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E L+    +FDY+EGFV +N    +N W T        +  
Sbjct  240  MVRWIRVLYSDFASFTEDQEMLIMAKNTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  298

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLE+  ++ +ND   T+ ++   L+  LRY +   F  +V+Y+ FL R
Sbjct  299  SRFQSD-GRVLYCLELTKNFNSND-AGTMEQEVTALLSKLRYIRSTLFHTDVTYLEFLDR  356

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  357  VHTSEVKLRAQGLWEVPHPWLNLLI  381



>ref|XP_010090224.1| Cytokinin dehydrogenase 1 [Morus notabilis]
 gb|EXB39093.1| Cytokinin dehydrogenase 1 [Morus notabilis]
Length=542

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 136/214 (64%), Gaps = 21/214 (10%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LEVVTG G++  CSE  N++LFY+VLGGLGQFGIITRAR+ L+PAP 
Sbjct  184  AFKHGPQISNVYQLEVVTGKGEVVTCSENQNADLFYAVLGGLGQFGIITRARISLEPAPK  243

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            M++WIRV+YS F  F++D E L++  +SF+Y+EGFV +N    +N W +           
Sbjct  244  MIKWIRVLYSDFSSFSKDQEHLISSQDSFNYIEGFVIINRTGLLNTWRS-----------  292

Query  362  TYIPKD---------AGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVN  514
            ++ PKD          G  LYCLEMAL++  N+  S +NKK ERL+  L Y     F   
Sbjct  293  SFDPKDPIRASQFNSEGRTLYCLEMALYFSPNEVDS-VNKKLERLLSELSYIHSTLFLSE  351

Query  515  VSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            VSY+ FL RV   E   R  G W+ PHPWLNL +
Sbjct  352  VSYLEFLNRVHFSERKLRQKGLWEIPHPWLNLLV  385



>ref|XP_002988125.1| hypothetical protein SELMODRAFT_127173 [Selaginella moellendorffii]
 gb|EFJ10917.1| hypothetical protein SELMODRAFT_127173 [Selaginella moellendorffii]
Length=539

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 138/209 (66%), Gaps = 6/209 (3%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV ELEVVTGNG+I  CS   +++LF++VLGGLGQFGIIT+A++ L+ AP 
Sbjct  189  AFRYGPQISNVLELEVVTGNGEIVRCSPVDHADLFFAVLGGLGQFGIITKAKINLERAPQ  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE----SFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
             V+WIR +YS F+ FT+D E L+ R +    SFDYVEG V VN++ P N +  +P +   
Sbjct  249  KVKWIRALYSDFKAFTRDQELLIARPKDSPNSFDYVEGSVIVNNNHPSNEYKPIPFHG-Q  307

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
             LN + IP  AGPVLYCLE+  +Y + D  +TI++    L+  L +   L F  + SY  
Sbjct  308  TLNASLIPPSAGPVLYCLELTKNY-DEDESATIDETVSSLLAPLGHVPSLVFSKDASYFE  366

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            FL RV  GE   R  G WD PHPW+NL +
Sbjct  367  FLNRVHDGEIRLRKKGLWDVPHPWMNLLV  395



>gb|EMT32653.1| Cytokinin dehydrogenase 1 [Aegilops tauschii]
Length=466

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY  LGGLGQFGIITRAR+ L+PAP 
Sbjct  71   AFRQGPQVSNVNQLEIVTGRGDVVTCSPEENSDLFYGALGGLGQFGIITRARIALEPAPK  130

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E+L++ + +FDY+EGFV +N    +N W T        +  
Sbjct  131  MVRWIRVLYSDFASFTEDQEALISAERTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  189

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLEM  ++ + D    + ++   L+  LRY +   F  +V+Y+ FL R
Sbjct  190  SHFQSD-GKVLYCLEMTKNF-DPDEADIMEQEVGVLLSRLRYIQSTLFHTDVTYLEFLDR  247

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  248  VHSSELKLRAQGLWEVPHPWLNLLI  272



>ref|XP_010523651.1| PREDICTED: cytokinin dehydrogenase 1 [Tarenaya hassleriana]
Length=551

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 137/210 (65%), Gaps = 13/210 (6%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LEVVTG G++  CSE  NSELF+ VLGGLGQFGIITRAR+ L+PAP+
Sbjct  204  AFKHGPQINNVYQLEVVTGKGEVLTCSEKQNSELFHGVLGGLGQFGIITRARISLEPAPN  263

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++R+  FDY+EGFV +N    +N W +         NP
Sbjct  264  MVKWIRVLYSEFSAFSRDQEHLISRENGFDYIEGFVIINRTGLLNNWRS-------SFNP  316

Query  362  TYIPKDA-----GPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
             Y  + +     G  LYCLE+A  Y N +  + +N++++RL+  L Y +   F   VSY+
Sbjct  317  KYSNQASQFNTDGKTLYCLEVA-KYFNQEDGAFVNQESDRLLSELNYIQSTLFSSEVSYI  375

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
             FL RV   E   RA G W+ PHPWLNL I
Sbjct  376  EFLDRVHISEIKLRAQGLWEVPHPWLNLLI  405



>ref|XP_010505935.1| PREDICTED: cytokinin dehydrogenase 1 [Camelina sativa]
Length=577

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 137/205 (67%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF++GPQ +NV +LE+VTG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L+PAP 
Sbjct  205  AFKYGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSVLGGLGQFGIITRARISLEPAPH  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++++FDYVEGFV +N  D +N W +    +D     
Sbjct  265  MVKWIRVLYSDFSVFSRDQEHLISKEKTFDYVEGFVIINRTDLLNNWRSSFRPNDSTEAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  ++++K+  +L+  L Y     F   V Y+ FL R
Sbjct  325  KF--KSDGKTLYCLEV-VKYFNTEEANSMHKETGKLLSELNYIPSTLFTSEVPYIEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  382  VHIAERKLRAKGLWEVPHPWLNLLI  406



>dbj|BAK61871.1| cytokinin oxidase [Citrus unshiu]
Length=604

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 22/196 (11%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV +L+VVTGNGD+  CSE+   ELF++VLGGLGQFGIITRARV+LQ APD
Sbjct  175  AFRYGPQISNVAQLDVVTGNGDMVTCSESRQPELFFNVLGGLGQFGIITRARVLLQSAPD  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVT---RDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
             VRWIR+VY+ F++FT+DAE LV+     ESFDYVEGFVFVNSDD VNGW +VPL+    
Sbjct  235  KVRWIRLVYAEFDEFTRDAELLVSLKEERESFDYVEGFVFVNSDDTVNGWPSVPLDPAQV  294

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLV-------------------G  475
             +P ++P+ AG VLYCLE+ALHY N+D  S ++    + V                    
Sbjct  295  FDPAHLPQTAGSVLYCLEVALHYNNSDPRSAVDAVDAKCVSFEDVDHGFSSWVPQRIVPA  354

Query  476  GLRYCKKLRFEVNVSY  523
                 K+LRF+ +VSY
Sbjct  355  DSEKVKRLRFQGHVSY  370


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 17/86 (20%)
 Frame = +2

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            TYI +D       L++ +HY   D          RL+  L +  KL F+V+VSY++FLLR
Sbjct  398  TYIVRD-------LKLTIHYNVVD----------RLLERLGFVSKLNFQVDVSYVDFLLR  440

Query  542  VKKGEEHARANGTWDTPHPWLNLFIS  619
            VK+ EEHARANG WD+PHPWLN+F+S
Sbjct  441  VKQVEEHARANGMWDSPHPWLNMFVS  466



>ref|XP_002972678.1| hypothetical protein SELMODRAFT_98722 [Selaginella moellendorffii]
 gb|EFJ25899.1| hypothetical protein SELMODRAFT_98722 [Selaginella moellendorffii]
Length=539

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 138/209 (66%), Gaps = 6/209 (3%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV ELEVVTGNG+I  CS   +++LF++VLGGLGQFGIIT+A++ L+ AP 
Sbjct  189  AFRYGPQISNVLELEVVTGNGEIVRCSPVDHADLFFAVLGGLGQFGIITKAKINLERAPQ  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDE----SFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
             V+WIR +YS F+ FT+D E L+ R +    SFDYVEG V VN++ P N +  +P +   
Sbjct  249  KVKWIRALYSDFKAFTRDQELLIARPKHSPNSFDYVEGSVIVNNNHPSNEYKPIPFHG-Q  307

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
             LN + IP  AGPVLYCLE+  +Y + D  +TI++    L+  L +   L F  + SY  
Sbjct  308  TLNASLIPPSAGPVLYCLELTKNY-DEDESATIDETVSSLLAPLGHVPSLVFSKDASYFE  366

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            FL RV  GE   R  G WD PHPW+NL +
Sbjct  367  FLNRVHDGEIRLRKKGLWDVPHPWMNLLV  395



>gb|AFW83998.1| cytokinin oxidase 3, mRNA [Zea mays]
Length=502

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   N++LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  160  AFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFYAALGGLGQFGIITRARIALEPAPK  219

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  + SFDYVEGFV +N    +N W          +  
Sbjct  220  MVRWIRVLYSDFESFTEDQEMLIMAENSFDYVEGFVIINRTGVLNNWRA-SFKPQDPVEA  278

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLE+  ++ N+D   T+ ++   L+  LR+ +   F  +V+Y+ FL R
Sbjct  279  SHFQSD-GRVLYCLELTKNF-NSDDTDTMEQEVTVLLSRLRFIQSTLFHTDVTYLEFLDR  336

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  337  VHTSELKLRAQGLWEVPHPWLNLLI  361



>ref|XP_006411418.1| hypothetical protein EUTSA_v10016470mg [Eutrema salsugineum]
 gb|ESQ52871.1| hypothetical protein EUTSA_v10016470mg [Eutrema salsugineum]
Length=551

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 136/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L+PAP 
Sbjct  205  AFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSVLGGLGQFGIITRARIALRPAPH  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++ +FDYVEGFV +N  D +N W +    +D     
Sbjct  265  MVKWIRVLYSDFSAFSRDQEHLISKENTFDYVEGFVIINRTDLLNNWRSSFSPNDSTQAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+A ++   +  +++N++ E+L+  L Y     F   V Y+ FL R
Sbjct  325  QF--KSDGKTLYCLEVAKYFI-PEEANSMNQETEKLLSELNYIPSTLFSSEVPYIEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  382  VHIAERKLRAKGLWEVPHPWLNLLI  406



>ref|XP_009391556.1| PREDICTED: cytokinin dehydrogenase 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 136/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CS   N++LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  175  AFRHGPQISNVHQLEIVTGKGELLNCSAEENADLFYAALGGLGQFGIITRARIALEPAPK  234

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++  E+FDY+EGFV +N    +N W +   N  + +  
Sbjct  235  MVKWIRVLYSDFASFTEDQEMLISLKETFDYIEGFVIINRTGLLNNWRS-SFNPQNPVQA  293

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G +L+CLEM  ++ + D+  T+N++ E L+  LRY     F+  VSY+ FL R
Sbjct  294  SEFDSD-GRILFCLEMTKNF-DQDNAETVNQQVEALLSKLRYIPSTLFQSEVSYLEFLDR  351

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  352  VHVSEVKLRSKGLWEVPHPWLNLLI  376



>gb|EAY77168.1| hypothetical protein OsI_05138 [Oryza sativa Indica Group]
Length=525

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CS   NS+LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  183  AFRHGPQVSNVNQLEIVTGRGEVVTCSHEVNSDLFYAALGGLGQFGIITRARIALEPAPK  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  +++FDY+EGFV +N    +N W T        +  
Sbjct  243  MVRWIRVLYSDFETFTEDQEKLIASEKTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  301

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLE+ +++ N+D    + ++   L+  LRY     F  +V+Y+ FL R
Sbjct  302  SQFQSD-GRVLYCLELTMNF-NHDEADIMEQEVGALLSRLRYISSTLFYTDVTYLEFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  360  VHTSELKLRAQGLWEVPHPWLNLLI  384



>ref|XP_003565050.1| PREDICTED: cytokinin dehydrogenase 4 [Brachypodium distachyon]
Length=523

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY  LGGLGQFGIITRAR+ L+PAP 
Sbjct  181  AFRQGPQVSNVNQLEIVTGRGDVVTCSPEENSDLFYGALGGLGQFGIITRARIALEPAPR  240

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E +++ +++FDY+EGFV +N    +N W T        +  
Sbjct  241  MVRWIRVLYSDFTSFTEDQEMMISAEKTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  299

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLEM  ++ N+D   ++ ++   L+  LRY +   F  +V+Y+ FL R
Sbjct  300  SQFQSD-GRVLYCLEMTKNF-NHDEADSMEQEVGVLLSRLRYIQSTLFHTDVTYLEFLDR  357

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  358  VHSSELKLRAQGLWEVPHPWLNLLI  382



>ref|NP_001045353.1| Os01g0940000 [Oryza sativa Japonica Group]
 sp|Q5JLP4.1|CKX4_ORYSJ RecName: Full=Cytokinin dehydrogenase 4; AltName: Full=Cytokinin 
oxidase 4; Short=OsCKX4; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD87612.1| putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF07267.1| Os01g0940000 [Oryza sativa Japonica Group]
Length=529

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CS   NS+LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  187  AFRHGPQVSNVNQLEIVTGRGEVVTCSHEVNSDLFYAALGGLGQFGIITRARIALEPAPK  246

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  +++FDY+EGFV +N    +N W T        +  
Sbjct  247  MVRWIRVLYSDFETFTEDQEKLIASEKTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  305

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G VLYCLE+ +++ N+D    + ++   L+  LRY     F  +V+Y+ FL R
Sbjct  306  SQFQSD-GRVLYCLELTMNF-NHDEADIMEQEVGALLSRLRYISSTLFYTDVTYLEFLDR  363

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  364  VHTSELKLRAQGLWEVPHPWLNLLI  388



>gb|AFW83999.1| LOW QUALITY PROTEIN: cytokinin oxidase 3 [Zea mays]
Length=525

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   N++LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  183  AFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFYAALGGLGQFGIITRARIALEPAPK  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  + SFDYVEGFV +N    +N W          +  
Sbjct  243  MVRWIRVLYSDFESFTEDQEMLIMAENSFDYVEGFVIINRTGVLNNWRA-SFKPQDPVEA  301

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLE+  ++ N+D   T+ ++   L+  LR+ +   F  +V+Y+ FL R
Sbjct  302  SHFQSD-GRVLYCLELTKNF-NSDDTDTMEQEVTVLLSRLRFIQSTLFHTDVTYLEFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  360  VHTSELKLRAQGLWEVPHPWLNLLI  384



>emb|CAE55201.1| cytokinin oxidase 3 [Zea mays]
Length=525

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   N++LFY+ LGGLGQFGIITRAR+ L+PAP 
Sbjct  183  AFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFYAALGGLGQFGIITRARIALEPAPK  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  + SFDYVEGFV +N    +N W          +  
Sbjct  243  MVRWIRVLYSDFESFTEDQEMLIMAENSFDYVEGFVIINRTGVLNNWRA-SFKPQDPVEA  301

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLE+  ++ N+D   T+ ++   L+  LR+ +   F  +V+Y+ FL R
Sbjct  302  SHFQSD-GRVLYCLELTKNF-NSDDTDTMEQEVTVLLSRLRFIQSTLFHTDVTYLEFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  360  VHTSELKLRAQGLWEVPHPWLNLLI  384



>gb|AFK79777.1| cytokinin oxidase/dehydrogenase, partial [Hordeum vulgare subsp. 
vulgare]
Length=477

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY  LGGLGQFGIITRAR+ L+PAP 
Sbjct  135  AFRQGPQVSNVNQLEIVTGRGDVVTCSPEENSDLFYGALGGLGQFGIITRARIALEPAPK  194

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E+L++  ++FDY+EGFV +N    +N W T        +  
Sbjct  195  MVRWIRVLYSDFASFTEDQEALISTAKTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  253

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLEM  ++ + D    + ++   L+  LRY +   F  +V+Y+ FL R
Sbjct  254  SHFQSD-GKVLYCLEMTKNF-DPDEADIMEQEVGVLLSRLRYIQSTLFHTDVTYLEFLDR  311

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  312  VHSSELKLRAQGLWEVPHPWLNLLI  336



>ref|XP_004513273.1| PREDICTED: cytokinin dehydrogenase 6-like [Cicer arietinum]
Length=665

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LE+VTG G++  CS+  N ELF+SVLGGLGQFGIITRAR++L+PAP 
Sbjct  324  AFKHGPQISNVQQLEIVTGTGEVVNCSKDQNGELFHSVLGGLGQFGIITRARILLEPAPS  383

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT D E L++ + +FDY+EGFV +N    +N W +   N    L  
Sbjct  384  MVKWIRVLYSDFTAFTNDQERLISEENAFDYIEGFVIINRTGLLNNWRS-SFNPQDPLQA  442

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            T+   D G  L+CLE+A  Y N      +N++ ER +  L Y +   F+  V+Y+ FL R
Sbjct  443  THFKSD-GKTLFCLELA-KYFNFQEMDIVNQEVERHLSHLNYIQSTLFQTEVTYVEFLDR  500

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  501  VHVSEIKLRSKGLWDVPHPWLNLFI  525



>pdb|4ML8|A Chain A, Structure Of Maize Cytokinin Oxidase/dehydrogenase 2 
(zmcko2)
 pdb|4ML8|B Chain B, Structure Of Maize Cytokinin Oxidase/dehydrogenase 2 
(zmcko2)
 pdb|4ML8|C Chain C, Structure Of Maize Cytokinin Oxidase/dehydrogenase 2 
(zmcko2)
 pdb|4ML8|D Chain D, Structure Of Maize Cytokinin Oxidase/dehydrogenase 2 
(zmcko2)
 pdb|4MLA|A Chain A, Structure Of Maize Cytokinin Oxidase/dehydrogenase 2 
(zmcko2)
 pdb|4MLA|B Chain B, Structure Of Maize Cytokinin Oxidase/dehydrogenase 2 
(zmcko2)
Length=501

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY+ LGGLGQFGIITRAR+ L+PAP+
Sbjct  162  AFRHGPQVSNVNQLEIVTGRGDVVTCSPEDNSDLFYAALGGLGQFGIITRARIALEPAPE  221

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  + SFDY+EGFV +N    +N W          +  
Sbjct  222  MVRWIRVLYSDFESFTEDQEMLIMAENSFDYIEGFVIINRTGILNNWRA-SFKPQDPVQA  280

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLE+  ++ + D   T+ ++   L+  LR+ +   F  +V+Y+ FL R
Sbjct  281  SHFQSD-GRVLYCLELTKNFNSGD-TDTMEQEVAVLLSRLRFIQSTLFHTDVTYLEFLDR  338

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA   W+ PHPWLNL I
Sbjct  339  VHTSELKLRAQSLWEVPHPWLNLLI  363



>ref|XP_002284560.2| PREDICTED: cytokinin dehydrogenase 1-like [Vitis vinifera]
 emb|CBI33379.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +LEVVTG GDI  CSET N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFRHGPQINNVYQLEVVTGKGDIITCSETQNADLFYGVLGGLGQFGIITRARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++   SFDY+EGFV +N    +N W +   N    L  
Sbjct  263  MVKWIRVLYSEFSIFSKDQEHLISFKNSFDYIEGFVIINRTGLLNTWRS-SFNPGEPLQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N D    +N+  E L+  L Y     F   V Y++FL R
Sbjct  322  SQFNSD-GRTLYCLEMA-KYFNPDETHIVNQVIESLLSELSYIPSTLFLSEVPYVDFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  380  VHVSEIKLRAKGLWEVPHPWLNLLI  404



>ref|NP_001105526.1| cytokinin oxidase 2 precursor [Zea mays]
 emb|CAE55200.1| cytokinin oxidase 2 [Zea mays]
 tpg|DAA55878.1| TPA: cytokinin oxidase 2 [Zea mays]
Length=519

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY+ LGGLGQFGIITRAR+ L+PAP+
Sbjct  177  AFRHGPQVSNVNQLEIVTGRGDVVTCSPEDNSDLFYAALGGLGQFGIITRARIALEPAPE  236

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  + SFDY+EGFV +N    +N W          +  
Sbjct  237  MVRWIRVLYSDFESFTEDQEMLIMAENSFDYIEGFVIINRTGILNNWRA-SFKPQDPVQA  295

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLE+  ++ + D   T+ ++   L+  LR+ +   F  +V+Y+ FL R
Sbjct  296  SHFQSD-GRVLYCLELTKNFNSGD-TDTMEQEVAVLLSRLRFIQSTLFHTDVTYLEFLDR  353

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA   W+ PHPWLNL I
Sbjct  354  VHTSELKLRAQSLWEVPHPWLNLLI  378



>emb|CCH15046.1| cytokinin oxidase/dehydrogenase 1, partial [Eleusine coracana]
Length=463

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY+ LGGLGQFGIITRA++ L+PAP 
Sbjct  144  AFRHGPQVSNVHQLEIVTGRGDVLTCSPEENSDLFYAALGGLGQFGIITRAKIALEPAPK  203

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS F  FT+D E L+  + +FDY+EGFV +N    +N W T        +  
Sbjct  204  MVRWIRVLYSDFASFTEDQEMLIMAENTFDYIEGFVIINRTGILNNWRT-SFKPQDPVQA  262

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +   D G VLYCL++ +++ N D    + ++   L+  LRY +   F  +V+Y+ FL R
Sbjct  263  GHFQSD-GRVLYCLKLTMNF-NTDEADIMEQEVSALLSRLRYIRSTLFHTDVTYVEFLDR  320

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL +
Sbjct  321  VHTSEVKLRAQGLWEVPHPWLNLLV  345



>ref|XP_010508710.1| PREDICTED: cytokinin dehydrogenase 1-like [Camelina sativa]
Length=580

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 137/205 (67%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF++GPQ +NV +LE+VTG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L+PA  
Sbjct  205  AFKYGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSVLGGLGQFGIITRARISLEPALH  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++++FDYVEGFV +N  D +N W +    +D     
Sbjct  265  MVKWIRVLYSDFSVFSRDQEYLISKEKTFDYVEGFVIINRTDLLNNWRSSFRPNDSTEAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  ++++K+ ++L+  L Y     F   V Y+ FL R
Sbjct  325  KF--KSDGKTLYCLEV-VKYFNTEEANSMHKETDKLLSELNYIPSTLFSSEVPYIEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  382  VHIAERKLRAKGLWEVPHPWLNLLI  406



>dbj|BAL04493.1| cytokinin oxidase [Pisum sativum]
Length=536

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 136/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV ++E+VTG G++  CSE  N+ELFYSVLGGLGQFGIIT+AR+ L+PAP 
Sbjct  194  AFRHGPQISNVLKMEIVTGTGEVVNCSEKQNNELFYSVLGGLGQFGIITKARIKLEPAPV  253

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L+  +++FDY+EGFV  N    VN W  +  N    +  
Sbjct  254  MVKWIRVLYSDFTAFTRDQEQLIFAEKAFDYIEGFVIKNRTGLVNNWR-LSFNPQDPVQA  312

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N +  S +N++ E+ +  L Y +   F+  V+Y++FL R
Sbjct  313  SKFKSD-GRTLFCLELA-KYFNLEESSEVNQEVEKHLSHLNYIQSTIFQTEVTYIDFLDR  370

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  371  VHISEVKLRSKGLWDVPHPWLNLFI  395



>ref|XP_010672924.1| PREDICTED: cytokinin dehydrogenase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=542

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +LEVVTG GDI  CSE  N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  201  AFRHGPQINNVYQLEVVTGKGDIVNCSEKQNADLFYGVLGGLGQFGIITRARISLEPAPK  260

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+W RV+YS F  FT+D E L++ D +FDY+EGFV +N    VN W +   +    L  
Sbjct  261  MVKWNRVLYSDFNLFTKDQEQLISSDNTFDYIEGFVIINRTGLVNNWRST-FSPKEPLQA  319

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    + G  LYCLEMA  Y N +  + IN+K E ++  L Y     F+  VSY++FL R
Sbjct  320  SQFSSE-GKTLYCLEMA-KYFNPEDANIINQKVEYILSKLNYIPYTVFQSEVSYVDFLNR  377

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G WD PHPWLNL +
Sbjct  378  VHISEIKLREKGLWDVPHPWLNLLV  402



>ref|XP_008811766.1| PREDICTED: cytokinin dehydrogenase 4-like [Phoenix dactylifera]
Length=535

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +L+VVTG G+I  CS   N++LF+ VLGGLGQFGIITRAR+ L+PAP 
Sbjct  187  AFRHGPQISNVHQLQVVTGTGEITNCSTKENADLFFGVLGGLGQFGIITRARIALEPAPK  246

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ +++FDY+EGFV +N    +N W +   N    +  
Sbjct  247  MVKWIRVLYSDFTSFTEDQEMLISEEKTFDYIEGFVIINRTGLLNNWRS-SFNPKDPVQA  305

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
                 D G +L+CLEM  ++ N D    +N++ E L+  LRY     F+  VSYM FL R
Sbjct  306  GQFNSD-GKILFCLEMTKNF-NPDETEMMNQEVETLLSKLRYIPSTLFQSEVSYMEFLDR  363

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  364  VHVSEVKLRSQGLWEVPHPWLNLLI  388



>ref|XP_004142714.1| PREDICTED: cytokinin dehydrogenase 1-like [Cucumis sativus]
 ref|XP_004162818.1| PREDICTED: cytokinin dehydrogenase 1-like [Cucumis sativus]
 gb|KGN54512.1| hypothetical protein Csa_4G343590 [Cucumis sativus]
Length=542

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++ VCSE  N++LF++VLGGLGQFGIITRAR+ L+ AP 
Sbjct  200  AFRHGPQISNVYQLEVVTGKGEVVVCSENQNADLFHAVLGGLGQFGIITRARISLEKAPK  259

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+W+RV+YS F  FT+D E L++ ++ FDY+EGFV +N    +N W +   N    L  
Sbjct  260  MVKWMRVLYSDFSKFTRDQEYLISSNDRFDYIEGFVLINRTGLLNNWRS-SFNPKEPLQA  318

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G + +CLE+A  Y N D    +NKK E L+  L Y     F   V+Y++FL R
Sbjct  319  SKFNSD-GKIFFCLEIA-KYFNPDEIDFMNKKVESLMSELSYIPSTLFTSEVTYLDFLDR  376

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  377  VHVSENKLRAKGLWEIPHPWLNLLI  401



>ref|NP_181682.1| cytokinin dehydrogenase 1 [Arabidopsis thaliana]
 sp|O22213.1|CKX1_ARATH RecName: Full=Cytokinin dehydrogenase 1; AltName: Full=Cytokinin 
oxidase 1; Short=AtCKX1; Short=CKO 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB84333.1| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AEC09992.1| cytokinin dehydrogenase 1 [Arabidopsis thaliana]
Length=575

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 136/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  NSELF+SVLGGLGQFGIITRAR+ L+PAP 
Sbjct  205  AFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFFSVLGGLGQFGIITRARISLEPAPH  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++++FDYVEGFV +N  D +N W +    +D     
Sbjct  265  MVKWIRVLYSDFSAFSRDQEYLISKEKTFDYVEGFVIINRTDLLNNWRSSFSPNDSTQAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  S+++++  +L+  L Y     F   V Y+ FL R
Sbjct  325  RF--KSDGKTLYCLEV-VKYFNPEEASSMDQETGKLLSELNYIPSTLFSSEVPYIEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  382  VHIAERKLRAKGLWEVPHPWLNLLI  406



>ref|XP_006438909.1| hypothetical protein CICLE_v10031210mg [Citrus clementina]
 gb|ESR52149.1| hypothetical protein CICLE_v10031210mg [Citrus clementina]
Length=530

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LEVVTG G+I  CSE  NSELF+SVLGGLGQFGIITRAR+ L+PAPD
Sbjct  189  AFQHGPQISNVHQLEVVTGKGEIINCSEKQNSELFHSVLGGLGQFGIITRARISLEPAPD  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F +D E L++ +++FDY+EGFV VN    +N W +     D     
Sbjct  249  MVKWIRVLYSDFVTFARDQEYLISAEKTFDYIEGFVIVNRTGLLNNWRSSFDPQDPVQAS  308

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  L+CLE+A  Y N D    +N++ E  +  L Y     F   VSY+ FL R
Sbjct  309  QF--KSGGQTLFCLELA-KYINKDEKDLVNQEVESSLSVLNYIPSTLFLSEVSYIEFLDR  365

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNLFI
Sbjct  366  VHVSEVKLRSKGLWEVPHPWLNLFI  390



>ref|NP_001105163.1| cytokinin oxidase 3 precursor [Zea mays]
 emb|CAE55202.1| cytokinin oxidase 3 [Zea mays]
Length=525

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   N++LFY+ LG LGQFGIITRAR+ L+PAP 
Sbjct  183  AFRHGPQVSNVNQLEIVTGRGDVVTCSPDDNADLFYAALGDLGQFGIITRARIALEPAPK  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MVRWIRV+YS FE FT+D E L+  + SFDYVEGFV +N    +N W          +  
Sbjct  243  MVRWIRVLYSDFESFTEDQEMLIMAENSFDYVEGFVIINRTGVLNNWRA-SFKPQDPVEA  301

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G VLYCLE+  ++ N+D   T+ ++   L+  LR+ +   F  +V+Y+ FL R
Sbjct  302  SHFQSD-GRVLYCLELTKNF-NSDDTDTMEQEVTVLLSRLRFIQSTLFHTDVTYLEFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  360  VHTSELKLRAQGLWEVPHPWLNLLI  384



>emb|CDY35410.1| BnaA03g19500D [Brassica napus]
Length=545

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF++GPQ +NV +LE++TG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L PAP 
Sbjct  198  AFKYGPQINNVYQLEIITGKGEVMTCSEKQNSELFYSVLGGLGQFGIITRARIALGPAPH  257

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+T+   FDYVEGFV VN  D ++ W +    +D     
Sbjct  258  MVKWIRVLYSDFSAFSRDQEHLITKKNGFDYVEGFVTVNRTDLLDNWRSSFSPNDSIGAS  317

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+  ++K  +  ST N + E+L+  L Y     F   V+Y+ FL R
Sbjct  318  QF--KSEGKTLYCLEVVKYFKLEEANST-NLEVEKLLSELSYIPSTLFSSEVTYIEFLDR  374

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  375  VHIAEIKLRAKGLWEVPHPWLNLLI  399



>ref|XP_010938664.1| PREDICTED: cytokinin dehydrogenase 4 isoform X1 [Elaeis guineensis]
Length=527

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 136/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +L+VVTG G+I  CS   N++LF+ VLGGLGQFGIITRAR+ L+ AP+
Sbjct  187  AFRHGPQISNVHQLQVVTGRGEIMNCSAEENADLFHGVLGGLGQFGIITRARIALERAPE  246

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ +++FDY+EGFV +N    +N W +   N    +  
Sbjct  247  MVKWIRVLYSDFTSFTEDQEMLISAEKTFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  305

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G +L+CLEM  ++ N D    +N++ E L+  LRY   + F+  VSY+ FL R
Sbjct  306  SQFNSD-GRILFCLEMTKNF-NPDESDMLNQEVETLLSKLRYIPSMLFQSEVSYLEFLDR  363

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNLFI
Sbjct  364  VHVSEVKLRSQGLWEVPHPWLNLFI  388



>dbj|BAG16373.1| cytokinin oxidase family protein [Brassica oleracea var. italica]
Length=524

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  N ELF+SVLGGLGQFGIITRAR+ L PAP 
Sbjct  192  AFKHGPQINNVYQLEIVTGKGEVVTCSEKLNPELFHSVLGGLGQFGIITRARISLGPAPH  251

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+++ + FDYVEGFV +N  D +N W +    +D     
Sbjct  252  MVKWIRVLYSNFSTFSRDQEHLISKKKGFDYVEGFVSINRTDLLNNWRSSFSPNDSTEAS  311

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE A+ Y N +  +++N++ E+L+  L Y     F   V Y+ FL R
Sbjct  312  QF--KSDGKTLYCLE-AVKYFNKEEANSMNQETEKLLSELSYIPSTLFSSVVPYIEFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V  GE   RA G W+ PHPWLNL +
Sbjct  369  VHHGEIKLRAKGLWEVPHPWLNLLV  393



>emb|CDP13849.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG GD+  CSE  +++LF+SVLGGLGQFGIIT+AR+ L+PAP 
Sbjct  96   AFRHGPQISNVHQLEVVTGKGDVVNCSEKQHADLFHSVLGGLGQFGIITKARISLEPAPK  155

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++ + +FDY+EG V +N  D +N W +     D     
Sbjct  156  MVKWIRVLYSDFSTFSRDQELLISAEHTFDYIEGLVIINRTDVLNSWRSSFSPQDPAQAS  215

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +I    G  L+CLE+  ++ N D   T NK+ E L+  L Y +       VSY+ FL R
Sbjct  216  KFISD--GRTLFCLELTKNF-NPDEVDTANKEVENLLSKLSYIQSTLLMTEVSYVEFLDR  272

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNL I
Sbjct  273  VHTSELKLRSKGMWDVPHPWLNLLI  297



>ref|XP_007131444.1| hypothetical protein PHAVU_011G014000g [Phaseolus vulgaris]
 gb|ESW03438.1| hypothetical protein PHAVU_011G014000g [Phaseolus vulgaris]
Length=533

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LE+VTG G++  CS+ HN ELF+SVLGGLGQFGIITRAR++L+PAP 
Sbjct  192  AFKHGPQISNVQQLEIVTGTGELVNCSKEHNGELFHSVLGGLGQFGIITRARIILEPAPT  251

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ +++FDY+EGFV +N    +N W +   N    +  
Sbjct  252  MVKWIRVLYSDFTAFTRDQERLISSEQTFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  310

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G  L+CLEMA  Y N +     N++ E  +  L Y     F   V+Y++FL R
Sbjct  311  SHFKSD-GRTLFCLEMA-KYFNVEEIDAANQEVEEHLSRLSYIPSTLFSTEVTYVDFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNL I
Sbjct  369  VHVSEVKLRSKGLWDIPHPWLNLLI  393



>ref|XP_002879935.1| ATCKX1/CKX1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56194.1| ATCKX1/CKX1 [Arabidopsis lyrata subsp. lyrata]
Length=564

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 136/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  NSELF+SVLGGLGQFGIITRAR+ L+PAP 
Sbjct  205  AFKHGPQINNVYQLEIVTGKGEVVTCSEKKNSELFFSVLGGLGQFGIITRARISLEPAPQ  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++++FDYVEGFV +N  D +N W +    +D     
Sbjct  265  MVKWIRVLYSDFSAFSRDQEHLISKEKTFDYVEGFVIINRTDLLNNWRSSFSPNDSTQAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  ++++++  +L+  L Y     F   V Y+ FL R
Sbjct  325  RF--KSDGKTLYCLEV-VKYFNPEEANSMHQETGKLLSELNYIPSTLFSSEVPYIEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  382  VHIAERKLRAKGLWEVPHPWLNLLI  406



>ref|XP_010517646.1| PREDICTED: cytokinin dehydrogenase 1-like [Camelina sativa]
Length=574

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 136/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF++GPQ +NV +LE+VTG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L+PA  
Sbjct  205  AFKYGPQINNVYQLEIVTGKGEVVTCSEKRNSELFYSVLGGLGQFGIITRARISLEPALH  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++++++FDYVEGFV +N  D +N W +    +D     
Sbjct  265  MVKWIRVLYSDFSVFSRDQEHLISKEKTFDYVEGFVIINRTDLLNNWRSSFRPNDSTEAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  ++++++  +L+  L Y     F   V Y+ FL R
Sbjct  325  KF--KSDGKTLYCLEV-VKYFNTEEANSMHQETGKLLSELNYIPSTLFSSEVPYIEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  382  VHIAERKLRAKGLWEVPHPWLNLLI  406



>ref|XP_002304773.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE79752.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=517

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV ++EVVTG G++  CSE  NS+LF+SVLGGLGQFGIITRAR+ L+PAPD
Sbjct  176  AFRHGPQISNVHQMEVVTGKGEVLNCSEKQNSDLFHSVLGGLGQFGIITRARISLEPAPD  235

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F  D E L+  + +FDY+EGFV +N    +N W +   N    +  
Sbjct  236  MVKWIRVLYSDFTTFATDQERLIGAENTFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  294

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A  Y N D    +N++   L+  LRY     F+  V Y+ FL R
Sbjct  295  SQFHSD-GRTLYCLELA-KYFNRDRADALNEEVGNLLSQLRYITSTLFQTEVPYIEFLDR  352

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  353  VHVSEVKLRSKGLWEVPHPWLNLLI  377



>gb|ACU22904.1| unknown [Glycine max]
Length=490

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CSE  N ELF+SVLGGLGQFGIITRAR+ L+PAP 
Sbjct  211  AFRHGPQISNVQKLEIVTGTGEVVNCSEEQNGELFHSVLGGLGQFGIITRARIFLEPAPA  270

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y+ F  F +D E L+  +++FDYVEGFV +N    +N WS+   N    +  
Sbjct  271  MVKWIRVLYADFTAFIRDQEKLIFAEKAFDYVEGFVIINRTGLLNNWSS-SFNPQDPVQA  329

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A +Y N +    +N++ E+ +  L Y     F   V+Y++FL R
Sbjct  330  SEFKSD-GRTLFCLELAKYY-NLEETLLVNQEVEKHLSRLNYIPSTLFLTEVTYVDFLDR  387

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  388  VHTSEVKLRSKGLWDVPHPWLNLFI  412



>gb|KDO83251.1| hypothetical protein CISIN_1g008291mg [Citrus sinensis]
Length=571

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LEVVTG G+I  CSE  NSELF+SVLGGLGQFGIITRAR+ L+PAPD
Sbjct  230  AFQHGPQISNVHQLEVVTGKGEIINCSEKQNSELFHSVLGGLGQFGIITRARISLEPAPD  289

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F +D E L++ +++FDY+EGFV VN    +N W +   +    +  
Sbjct  290  MVKWIRVLYSDFATFARDQEYLISAEKTFDYIEGFVMVNRTGLLNNWRS-SFDPQDPVQA  348

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N D    +N++ E  +  L Y     F   VSY+ FL R
Sbjct  349  SQFKSD-GQTLFCLELA-KYINKDEKDLVNQEVESSLSVLNYIPSTLFLSEVSYIEFLDR  406

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNLFI
Sbjct  407  VHVSEVKLRSKGLWEVPHPWLNLFI  431



>ref|XP_008443336.1| PREDICTED: cytokinin dehydrogenase 1-like [Cucumis melo]
Length=567

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LFYSVLGGLGQFGIITRAR+ L+ AP+
Sbjct  205  AFRHGPQISNVHQLEVVTGKGEVVTCSEQENSDLFYSVLGGLGQFGIITRARISLESAPE  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIR +YS F  F++D E L++   SFDY+EGFV +N    +N W +     D     
Sbjct  265  MVKWIRTLYSDFAIFSKDQEHLISSKYSFDYIEGFVLINRTGILNNWRSSFDPKDPVQAS  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +I       LYCLEMA+++ N +   T+NK+ E+L+  L Y     F   V Y  FL R
Sbjct  325  QFITDRT--TLYCLEMAMYF-NFEDKETLNKRVEKLLSQLSYIPATLFLSEVPYEEFLDR  381

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E+  RA G W+ PHPWLNL I
Sbjct  382  VHTSEKKLRAKGLWEVPHPWLNLMI  406



>ref|XP_011042115.1| PREDICTED: cytokinin dehydrogenase 6-like [Populus euphratica]
Length=517

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV ++EVVTG G++  CSE  NS+LF+SVLGGLGQFGIITRAR+ L+PAPD
Sbjct  176  AFRHGPQISNVHQMEVVTGKGEVLNCSEKQNSDLFHSVLGGLGQFGIITRARISLEPAPD  235

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F  D E L+  + +FDY+EGFV +N    +N W +   +    +  
Sbjct  236  MVKWIRVLYSDFTTFATDQERLIGAESTFDYIEGFVIINRTSLLNNWRS-SFDPQDPVQA  294

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A  Y N D    +N++   L+  LRY     F+  V Y+ FL R
Sbjct  295  SQFQSD-GRTLYCLELA-KYFNRDRADALNEEVGNLLSQLRYITSTLFQTEVPYIEFLDR  352

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  353  VHVSEVKLRSKGLWEVPHPWLNLLI  377



>ref|XP_002456917.1| hypothetical protein SORBIDRAFT_03g045410 [Sorghum bicolor]
 gb|EES02037.1| hypothetical protein SORBIDRAFT_03g045410 [Sorghum bicolor]
Length=523

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 131/210 (62%), Gaps = 13/210 (6%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS   NS+LFY  LGGLGQFGII RAR+ L+PAP 
Sbjct  181  AFRHGPQVSNVNQLEIVTGRGDVVTCSPEDNSDLFYGALGGLGQFGIIIRARIALEPAPK  240

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTV-----PLNSD  346
            MVRWIRV+YS FE FT+D E L+  + SFDY+EGFV +N    +N W        P+ + 
Sbjct  241  MVRWIRVLYSDFETFTEDQEMLIMAENSFDYIEGFVIINRTGILNNWRASFKPQDPVQAS  300

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            H        K  G VLYCLE+  ++ N+D    + ++   ++  LR+ +   F  +V+Y+
Sbjct  301  HF-------KSDGRVLYCLELTKNF-NSDDADIMEQEVTVVLSRLRFIQSTLFHTDVTYL  352

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
             FL RV   E   RA G W+ PHPWLNL I
Sbjct  353  EFLDRVHTSELKLRAQGLWEVPHPWLNLLI  382



>ref|XP_010921880.1| PREDICTED: cytokinin dehydrogenase 9-like [Elaeis guineensis]
Length=530

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +L+VVTG G++  CS   N++LFY VLGGLGQFGIIT AR+ L+PAP 
Sbjct  187  AFRHGPQISNVHQLQVVTGRGEVMNCSTKENADLFYGVLGGLGQFGIITSARIALEPAPK  246

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F +FT+D E L++ +++FDY+EGFV +N    +N W +   N    +  
Sbjct  247  MVKWIRVLYSDFTNFTEDQEMLISEEKTFDYIEGFVIINRTGLLNNWRS-SFNQKDPIQA  305

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G +L+CLEM  ++ N D    +N++ E L+  LRY     F+  VSY+ FL R
Sbjct  306  SQFNSD-GRILFCLEMTKNF-NPDETDVMNQEVETLLSKLRYIPSTLFQSEVSYVEFLDR  363

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  364  VHISELKLRSQGLWEVPHPWLNLLI  388



>ref|XP_006482960.1| PREDICTED: cytokinin dehydrogenase 6-like [Citrus sinensis]
Length=530

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LEVVTG G+I  CSE  NSELF+SVLGGLGQFGIITRAR+ L+PAPD
Sbjct  189  AFQHGPQISNVHQLEVVTGKGEIINCSEKQNSELFHSVLGGLGQFGIITRARISLEPAPD  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F +D E L++ +++FDY+EGFV VN    +N W +     D     
Sbjct  249  MVKWIRVLYSDFVTFARDQEYLISAEKTFDYIEGFVIVNRTGLLNNWRSSFDPQDPVQAS  308

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  L+CLE+A  Y N D    +N++ E  +  L Y     F   VSY+ FL R
Sbjct  309  QF--KSGGQTLFCLELA-KYINKDEKDLVNQEVESSLSVLNYIPSTLFLSEVSYIEFLDR  365

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   ++ G W+ PHPWLNLFI
Sbjct  366  VHVSEVKLQSKGLWEVPHPWLNLFI  390



>ref|XP_009336587.1| PREDICTED: cytokinin dehydrogenase 1-like [Pyrus x bretschneideri]
 ref|XP_009336591.1| PREDICTED: cytokinin dehydrogenase 1-like [Pyrus x bretschneideri]
Length=558

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +L+VVTG G++ +CS++ NS+LFY VLGGLGQFGIIT+AR+ L+PAP 
Sbjct  203  AFRHGPQINNVYQLQVVTGKGEVRMCSKSKNSDLFYGVLGGLGQFGIITQARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+  + SFDY+EGFV +N    +N W +   N    +  
Sbjct  263  MVKWIRVLYSDFSAFSKDQEYLIASENSFDYIEGFVIINRTGLLNNWRS-SFNPKDPMQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N D  + I++  E L+  L Y     F   VSY+ FL R
Sbjct  322  SQFDSD-GKTLYCLEMA-KYFNPDETNVIDQITESLLLELHYIPSTLFLSEVSYVQFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RANG WD PHPW+NL +
Sbjct  380  VHVSELKLRANGLWDVPHPWMNLLV  404



>gb|KHN39533.1| Cytokinin dehydrogenase 6 [Glycine soja]
Length=533

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CSE  N ELF+SVLGGLGQFGIITRAR+ L+PAP 
Sbjct  192  AFRHGPQISNVQKLEIVTGTGEVVNCSEEQNGELFHSVLGGLGQFGIITRARIFLEPAPA  251

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y+ F  F +D E L+  +++FDYVEGFV +N    +N WS+   N    +  
Sbjct  252  MVKWIRVLYADFTAFIRDQEKLIFAEKAFDYVEGFVIINRTGLLNNWSS-SFNPQDPVQA  310

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A +Y N +    +N++ E+ +  L Y     F   V+Y++FL R
Sbjct  311  SEFKSD-GRTLFCLELAKYY-NLEETLLVNQEVEKHLSRLNYIPSTLFLTEVTYVDFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  369  VHTSEVKLRSKGLWDVPHPWLNLFI  393



>ref|XP_003538221.1| PREDICTED: cytokinin dehydrogenase 6 [Glycine max]
Length=552

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CSE  N ELF+SVLGGLGQFGIITRAR+ L+PAP 
Sbjct  211  AFRHGPQISNVQKLEIVTGTGEVVNCSEEQNGELFHSVLGGLGQFGIITRARIFLEPAPA  270

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y+ F  F +D E L+  +++FDYVEGFV +N    +N WS+   N    +  
Sbjct  271  MVKWIRVLYADFTAFIRDQEKLIFAEKAFDYVEGFVIINRTGLLNNWSS-SFNPQDPVQA  329

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A +Y N +    +N++ E+ +  L Y     F   V+Y++FL R
Sbjct  330  SEFKSD-GRTLFCLELAKYY-NLEETLLVNQEVEKHLSRLNYIPSTLFLTEVTYVDFLDR  387

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  388  VHTSEVKLRSKGLWDVPHPWLNLFI  412



>ref|XP_002977614.1| hypothetical protein SELMODRAFT_106833 [Selaginella moellendorffii]
 gb|EFJ21618.1| hypothetical protein SELMODRAFT_106833 [Selaginella moellendorffii]
Length=500

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 139/206 (67%), Gaps = 3/206 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +L+VVTGNGD   CS T NS+LFY+VLGGLGQFGIIT+AR+ L+ AP 
Sbjct  150  AFRHGPQISNVLQLQVVTGNGDTVTCSATRNSDLFYAVLGGLGQFGIITKARIPLEEAPA  209

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES-FDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
              R+ R+VY+ F  F +D E L++ +E   +YVEG V  + DDP  G+++VP + +  ++
Sbjct  210  RARYKRLVYTDFGAFQKDIERLISLNEDVVNYVEGIVIPSCDDPYQGYNSVPFDGE-AID  268

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P+ IP  +GPVLYC+E+A +Y N+   + +  + ERL+G L +   L F  +++Y +FL 
Sbjct  269  PSLIPDSSGPVLYCIEIAKYY-NHGQEAFMEDRLERLLGSLSFVPGLTFTTDLTYFDFLN  327

Query  539  RVKKGEEHARANGTWDTPHPWLNLFI  616
            RV   EE  R    WD PHPWL LF+
Sbjct  328  RVHGVEEVLRKVKQWDVPHPWLALFV  353



>ref|XP_004159659.1| PREDICTED: cytokinin dehydrogenase 1-like [Cucumis sativus]
Length=558

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 135/216 (63%), Gaps = 25/216 (12%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LFYSVLGGLGQFGIITRAR+ L+ AP 
Sbjct  205  AFRHGPQISNVHQLEVVTGRGEVVTCSEQENSDLFYSVLGGLGQFGIITRARISLELAPK  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIR +YS F  F++D E L++   SFDY+EGFV +N    +N W +           
Sbjct  265  MVKWIRTLYSDFAIFSKDQEHLISSKYSFDYIEGFVLINRTGILNNWRS-----------  313

Query  362  TYIPKDAGPV-----------LYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFE  508
            ++ PKD  PV           LYCLEMA+++ N++   T+NK+ E+L+  L Y     F 
Sbjct  314  SFDPKD--PVQASQFVTDRTTLYCLEMAMYF-NSEEKETMNKRVEKLLLQLSYIPATLFL  370

Query  509  VNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
              V Y  FL RV   E+  RA G W+ PHPWLNL I
Sbjct  371  SEVPYEEFLDRVHISEKKLRAKGLWEVPHPWLNLMI  406



>emb|CDY23844.1| BnaC04g01930D [Brassica napus]
Length=596

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  N ELF+SVLGGLGQFGIITRAR+ L PAP 
Sbjct  192  AFKHGPQINNVYQLEIVTGKGEVVTCSEKLNPELFHSVLGGLGQFGIITRARISLGPAPH  251

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+++ + FDYVEGFV +N  D +N W +    +D     
Sbjct  252  MVKWIRVLYSNFSTFSRDQEHLISKMKGFDYVEGFVSINRTDLLNNWRSSFSPNDSTEAS  311

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE A+ Y N +  +++N++ E+L+  L Y     F   V Y+ FL R
Sbjct  312  QF--KSDGKTLYCLE-AVKYFNKEETNSMNQETEKLLSELSYIPSTLFSSVVPYIEFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V  GE   RA G W+ PHPWLNL +
Sbjct  369  VHHGEIKLRAKGLWEVPHPWLNLLV  393



>ref|XP_009417944.1| PREDICTED: cytokinin dehydrogenase 4-like [Musa acuminata subsp. 
malaccensis]
Length=525

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CS   N+ LF++ LGGLGQFG+ITRAR+ L+PAP+
Sbjct  183  AFRHGPQISNVHQLEIVTGKGELLTCSTEENAALFHAALGGLGQFGVITRARIALEPAPE  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++  E+FDY+EGFV +N    +N W +   N    +  
Sbjct  243  MVKWIRVLYSDFSSFTEDQEKLISARETFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  301

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G +L+CLEM  ++ N D    ++++ E L+  LRY     F+  V+Y+ FL R
Sbjct  302  SRFDSD-GRILFCLEMTKNF-NRDEADVMHQRVEALLSRLRYIPSTLFQSEVTYLEFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  360  VHVSEVKLRSKGLWEVPHPWLNLLI  384



>ref|XP_004136791.1| PREDICTED: cytokinin dehydrogenase 1-like [Cucumis sativus]
Length=567

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 135/216 (63%), Gaps = 25/216 (12%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LFYSVLGGLGQFGIITRAR+ L+ AP 
Sbjct  205  AFRHGPQISNVHQLEVVTGRGEVVTCSEQENSDLFYSVLGGLGQFGIITRARISLELAPK  264

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIR +YS F  F++D E L++   SFDY+EGFV +N    +N W +           
Sbjct  265  MVKWIRTLYSDFAIFSKDQEHLISSKYSFDYIEGFVLINRTGILNNWRS-----------  313

Query  362  TYIPKDAGPV-----------LYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFE  508
            ++ PKD  PV           LYCLEMA+++ N++   T+NK+ E+L+  L Y     F 
Sbjct  314  SFDPKD--PVQASQFVTDRTTLYCLEMAMYF-NSEEKETMNKRVEKLLLQLSYIPATLFL  370

Query  509  VNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
              V Y  FL RV   E+  RA G W+ PHPWLNL I
Sbjct  371  SEVPYEEFLDRVHISEKKLRAKGLWEVPHPWLNLMI  406



>emb|CDY14777.1| BnaC04g47740D [Brassica napus]
Length=546

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 134/206 (65%), Gaps = 5/206 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  NSELF SVLGGLGQFGIITRAR+ L PAP 
Sbjct  191  AFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFQSVLGGLGQFGIITRARISLGPAPL  250

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGW-STVPLNSDHQLN  358
            MV+WIR +YS F  F++D E L++++ +FDYVEGFV +N  D +N W S+   N   + N
Sbjct  251  MVKWIRALYSDFSAFSRDQEHLISKENAFDYVEGFVIINRTDILNNWRSSFTPNDSTEAN  310

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
                 K  G  LYCLE+ + Y N+   +++N++ E+++  L Y     F   V Y+ FL 
Sbjct  311  QF---KSDGKTLYCLEV-VKYFNSKEANSMNQETEKVLSELSYIPSTLFSSEVPYIEFLD  366

Query  539  RVKKGEEHARANGTWDTPHPWLNLFI  616
            RV   E   RA G W+ PHPWLNL I
Sbjct  367  RVHIAEIKLRAKGLWEVPHPWLNLLI  392



>ref|XP_006654329.1| PREDICTED: cytokinin dehydrogenase 9-like [Oryza brachyantha]
Length=521

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   NS+LF++ LGGLGQFGIITRAR+ L+PAP+M
Sbjct  181  FRHGPQISNVNELEIVTGRGDIITCSPEQNSDLFHAALGGLGQFGIITRARIPLEPAPEM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+YS F  FT D E L++ +++FDY+EGFV +N    +N W +   N    +  +
Sbjct  241  VRWIRVLYSDFTSFTADQEMLISAEKTFDYIEGFVIINRTGILNNWRS-SFNPQDPVQAS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D G VL+CLEM  ++  ND    + ++   L+  L Y     F  +V+Y+ FL RV
Sbjct  300  QFESD-GKVLFCLEMTKNFNPND-ADIMEQEVNTLLSKLTYIPPSLFHTDVTYIEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLN+ I
Sbjct  358  HSSEMKLRAKGMWEVPHPWLNIII  381



>ref|XP_010231472.1| PREDICTED: cytokinin dehydrogenase 9 [Brachypodium distachyon]
Length=521

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV E+E+VTG GD+  CS   NS+LF++ LGGLGQFGIITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNEMEIVTGRGDVVTCSPEQNSDLFHAALGGLGQFGIITRARIALEPAPQM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+Y  F  FT+D E L++ +++FDY+EGFV +N +  +N W +     D      
Sbjct  241  VRWIRVLYLDFTSFTEDQEMLLSAEKTFDYIEGFVIINREGILNNWRSSFNPQDPVRASQ  300

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
            + P +   VL+CLEM  ++ N +   T+ ++   L+  LRY     F  +V+YM FL RV
Sbjct  301  FEPDEE--VLFCLEMTKNF-NPEEADTMEQEVNALLSQLRYTPPSLFHTDVTYMEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLNL I
Sbjct  358  HYSEMKLRAKGMWEVPHPWLNLII  381



>ref|XP_009141995.1| PREDICTED: cytokinin dehydrogenase 1-like [Brassica rapa]
 emb|CDY06917.1| BnaA04g23980D [Brassica napus]
Length=536

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  NSELF SVLGGLGQFGIITRAR+ L PAP 
Sbjct  189  AFKHGPQINNVYQLEIVTGKGEVVTCSEKRNSELFQSVLGGLGQFGIITRARISLGPAPL  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIR +YS F  F++D E L+++  +FDYVEGFV +N  D +N W +    +D     
Sbjct  249  MVKWIRTLYSDFSAFSRDQEHLISKKNAFDYVEGFVIINRTDILNNWRSSFTPNDSTEAS  308

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N++   ++N++ E+L+  L Y +   F   V Y+ FL R
Sbjct  309  QF--KSDGKTLYCLEV-VKYFNSEEAHSMNQEMEKLLSELSYIQSTLFSSEVPYIEFLDR  365

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G W+ PHPWLNL I
Sbjct  366  VHIAEIKLREKGLWEVPHPWLNLLI  390



>ref|NP_001244907.1| cytokinin oxidase/dehydrogenase-like 5 precursor [Solanum lycopersicum]
 dbj|BAM09007.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=543

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LEVVTG G++  CS+  N++LFY VLGGLGQFGIITRAR+ LQPAP 
Sbjct  200  AFKHGPQINNVYQLEVVTGKGEVITCSKEQNADLFYGVLGGLGQFGIITRARIALQPAPK  259

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  F+ D E L++  +SFDYVEGFV +N    +N W +     D  L  
Sbjct  260  KVKWIRVLYSDFSTFSNDQEQLISSKDSFDYVEGFVIINKTGLLNNWRSTFNPKDPLLAT  319

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +     G VLYCLE+A ++   + P+T ++  + L+  L Y K   F+  VSY+ FL R
Sbjct  320  KF--SSEGKVLYCLEVAKYFNPEETPNT-DQNIDVLLSKLSYIKSTLFQSEVSYVEFLDR  376

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   +  G WD PHPWLNL I
Sbjct  377  VHVSEMKLQEKGLWDVPHPWLNLLI  401



>ref|XP_008360505.1| PREDICTED: cytokinin dehydrogenase 1-like [Malus domestica]
Length=557

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +L+VVTG G++ +CS++ N++LFY VLGGLGQFGIIT+AR+ L+PAP 
Sbjct  203  AFRHGPQINNVYQLQVVTGKGEVRMCSKSKNADLFYGVLGGLGQFGIITQARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+  + SFDY+EGFV +N    +N W +   N    +  
Sbjct  263  MVKWIRVLYSDFSAFSKDQEYLIASENSFDYIEGFVIINRTGLLNNWRS-SFNPKDPMQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N D  + I++  E L+  L Y     F   VSY+ F+ R
Sbjct  322  SQFDSD-GKTLYCLEMA-KYFNPDETNVIDQITESLLLELHYIPSTLFLSEVSYVQFVER  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RANG WD PHPW+NL +
Sbjct  380  VHVSELKLRANGLWDVPHPWMNLLV  404



>ref|XP_001776926.1| predicted protein [Physcomitrella patens]
 gb|EDQ58329.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 142/208 (68%), Gaps = 5/208 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTG-NGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAP  178
            +F FGP+ SNV +L+VVTG N  +  CS T  S+LF+ VLGGLGQFGIIT AR++L+PA 
Sbjct  177  SFLFGPEISNVLQLDVVTGQNAALVKCSPTKKSDLFHGVLGGLGQFGIITSARIILEPAH  236

Query  179  DMVRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQ  352
            + VRWIR +Y+ F  FT+D E LVT+  + +FDY+EGFV + + D  +GW++VP ++  +
Sbjct  237  EKVRWIRAMYTDFATFTRDQEMLVTQAPESAFDYIEGFVVLKNKDSSHGWNSVPFDA-KK  295

Query  353  LNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNF  532
            ++P+ IP++ G VLYC+E+   +  N H  T+NK  ER+V  L +   L F ++V Y  F
Sbjct  296  IDPSIIPEEGGSVLYCIELVKKFSPN-HMDTLNKTVERMVAPLSFIPTLIFTIDVPYEKF  354

Query  533  LLRVKKGEEHARANGTWDTPHPWLNLFI  616
            L R+ + E    + G W+ PHPWLNLF+
Sbjct  355  LNRLHEVEISLDSQGLWNVPHPWLNLFV  382



>ref|XP_003599606.1| Cytokinin dehydrogenase [Medicago truncatula]
 gb|AES69857.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=547

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV ++E+VTG G++  CSE  N ELFYSVLGGLGQFGIITRAR++L+PAP 
Sbjct  210  AFRHGPQISNVQKMEIVTGTGEVVNCSEEQNGELFYSVLGGLGQFGIITRARILLEPAPT  269

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L+  +++FDY+EGFV  N    +N W  +  N    +  
Sbjct  270  MVKWIRVLYSDFTAFTKDQEKLIFAEKAFDYIEGFVIKNRTGLLNNWR-LSFNPQDPVQA  328

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N +    +N+  ++ +  L +     F+  V+Y++FL R
Sbjct  329  SKFKSD-GRTLFCLELA-KYFNMEETLEVNQDIQKHLSHLNFIPSTLFQTEVTYVDFLDR  386

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  387  VHISEVKLRSKGLWDVPHPWLNLFI  411



>ref|XP_009133497.1| PREDICTED: cytokinin dehydrogenase 1-like [Brassica rapa]
Length=545

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF++GPQ +NV +LE++TG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L PAP 
Sbjct  198  AFKYGPQINNVYQLEIITGKGEVMTCSEKQNSELFYSVLGGLGQFGIITRARIALGPAPH  257

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+T+   FDYVEGFV VN  D ++ W +    +D     
Sbjct  258  MVKWIRVLYSDFSAFSRDQEHLITKKNGFDYVEGFVTVNRTDLLDNWRSSFSPNDSIGAS  317

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+  ++   +  ST N + E+L+  L Y     F   V Y+ FL R
Sbjct  318  QF--KSEGKTLYCLEVVKYFILEEANST-NLEVEKLLSELSYIPSTLFSSEVPYIEFLDR  374

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  375  VHIAEIKLRAKGLWEVPHPWLNLLI  399



>ref|XP_011075363.1| PREDICTED: cytokinin dehydrogenase 1 [Sesamum indicum]
Length=541

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LEVVTG G++A CSE  N++LF++VLGGLGQFGIIT+AR+ LQPAP 
Sbjct  199  AFQHGPQINNVYQLEVVTGRGEVATCSEEQNTDLFHAVLGGLGQFGIITQARIALQPAPK  258

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIR +YS F  FT+D E L++   +FDYVEGFV +N    +N W +   N    +  
Sbjct  259  MVKWIRALYSDFSIFTKDQELLISSKNAFDYVEGFVIINRTGLLNNWRS-SFNPKDPVQA  317

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
                 D G +L+CLE+A +Y N +    I+++ E L+  L Y +   F+  VSY++FL R
Sbjct  318  NQFTSD-GKILFCLEVAKYY-NPEESECIDQEIETLLSALNYIRSTLFQSEVSYVDFLDR  375

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G W+ PHPWLNL I
Sbjct  376  VHVSEIKLREKGLWEVPHPWLNLLI  400



>ref|XP_010279585.1| PREDICTED: cytokinin dehydrogenase 9-like [Nelumbo nucifera]
Length=548

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N++LF+ VLGGLGQFGII RAR+ L+PAP 
Sbjct  207  AFRHGPQISNVYQLEVVTGKGEVVSCSEKQNADLFHGVLGGLGQFGIIARARIALEPAPK  266

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ + +FDY+EGFV +N    +N W +   N    L  
Sbjct  267  MVKWIRVLYSDFSMFTRDQEYLISAENTFDYIEGFVIINRTGLLNNWRSF-FNPQDPLKA  325

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLEM  ++ N D    +N++ E L+  L Y     F   VSY+ FL R
Sbjct  326  SQFKSD-GRTLFCLEMTKNF-NPDETDVMNQEVESLLSQLNYIPSTLFASEVSYVEFLDR  383

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  384  VHMSEIKLRSKGLWEVPHPWLNLLI  408



>gb|KHN14944.1| Cytokinin dehydrogenase 1 [Glycine soja]
Length=545

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEV+TG G++  CS   N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIFQLEVITGKGEVVTCSGNRNADLFYGVLGGLGQFGIITRARISLEPAPM  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT D E L++ + +FDY+EGFV +N    +N W +   +  + L  
Sbjct  263  MVKWIRVLYSEFSTFTMDQEYLISLNNTFDYIEGFVIINRTGILNNWRS-SFDPKNPLQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N D    +N+  ++L+  L Y     F   VSY+ FL R
Sbjct  322  SQFSSD-GKTLYCLEMA-KYFNPDEAEAMNQSVDQLLSKLSYIPSTLFLSEVSYVEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  380  VHVSENKLRAQGLWEVPHPWLNLLI  404



>ref|XP_002513118.1| Cytokinin dehydrogenase, putative [Ricinus communis]
 gb|EEF49621.1| Cytokinin dehydrogenase, putative [Ricinus communis]
Length=530

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEV+TG G++  CSE  N +LF+ VLGGLGQFGIITRAR+ L+PAPD
Sbjct  189  AFRHGPQISNVHQLEVITGTGEVVNCSEKQNGDLFHGVLGGLGQFGIITRARISLEPAPD  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F +D ESL++ + +FDY+EGFV +N    +N W +   N    L  
Sbjct  249  MVKWIRVLYSDFNTFARDQESLISAENTFDYIEGFVIINRTGLLNNWRS-SFNPQDPLQA  307

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A ++K  D    +N++   L+  LRY     F   V Y+ FL R
Sbjct  308  SQFESD-GRTLFCLELAKYFK-KDKTDKLNEEIMNLLSQLRYIPSTLFLSEVPYIEFLDR  365

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL +
Sbjct  366  VHVSEVKLRSKGLWEVPHPWLNLLV  390



>ref|XP_003553393.1| PREDICTED: cytokinin dehydrogenase 1-like isoform X1 [Glycine 
max]
Length=545

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEV+TG G++  CS   N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIFQLEVITGKGEVVTCSGNRNADLFYGVLGGLGQFGIITRARISLEPAPM  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT D E L++ + +FDY+EGFV +N    +N W +   +  + L  
Sbjct  263  MVKWIRVLYSEFSTFTMDQEYLISLNNTFDYIEGFVIINRTGILNNWRS-SFDPKNPLQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N D    +N+  ++L+  L Y     F   VSY+ FL R
Sbjct  322  SQFSSD-GKTLYCLEMA-KYFNPDEAEAMNQSVDQLLSKLSYIPSTLFLSEVSYVEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  380  VHVSENKLRAQGLWEVPHPWLNLLI  404



>ref|XP_008796239.1| PREDICTED: cytokinin dehydrogenase 9-like [Phoenix dactylifera]
Length=528

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV +L+VVTG G+I  CS   N++LFY VLGGLGQFGIIT AR+ L+PAP M
Sbjct  189  FRHGPQISNVHQLQVVTGEGEIVNCSAEENADLFYGVLGGLGQFGIITSARIALEPAPKM  248

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            V+WIRV+YS F  FT+D E L++ +++FDY+EGFV +N    +N W +   N    +  +
Sbjct  249  VKWIRVLYSDFTSFTEDQEMLISAEKTFDYIEGFVMINRTGLLNNWRS-SFNPQDPVQAS  307

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D G +L+CLEM  ++ N D    +N++   L+  LRY     F   VSY+ FL RV
Sbjct  308  QFNSD-GRILFCLEMTKNF-NPDESDVMNQEVGTLLSKLRYIPSTLFRSEVSYLEFLDRV  365

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   R+ G W+ PHPWLNLFI
Sbjct  366  HVSEVKLRSQGLWEVPHPWLNLFI  389



>ref|XP_011033192.1| PREDICTED: cytokinin dehydrogenase 1-like [Populus euphratica]
Length=540

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 129/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEVVTG G++  C+E  N+ELFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIYQLEVVTGKGEVVTCTEKQNAELFYGVLGGLGQFGIITRARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y  F  F+ D E L++  +SFDY+EG V +N    +N W +     D     
Sbjct  263  MVKWIRVLYDEFSKFSNDQERLISSKDSFDYIEGLVIINRTGLLNNWRSSFNPRDPLQAS  322

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +I +  G  LYCLE+A  Y N D     N+K E L+  L Y    RF   VSY+ FL R
Sbjct  323  RFISE--GKTLYCLEIA-KYFNPDESDITNQKTESLLSELSYISSPRFLSEVSYVEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E + R+ G W+ PHPW+NL I
Sbjct  380  VHLSEINLRSKGLWEIPHPWINLLI  404



>ref|XP_006368582.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|ERP65151.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=530

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LF+ VLGGLGQFGIITRAR+ L+PAPD
Sbjct  189  AFRHGPQISNVNQLEVVTGKGEVLNCSEKQNSDLFHGVLGGLGQFGIITRARISLEPAPD  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F  D E L+  + +FDY+EGFV +N    +N W +   +    +  
Sbjct  249  MVKWIRVLYSDFTTFVTDQERLIGAESTFDYIEGFVIINRTSLLNNWRS-SFDPQDPVQA  307

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A  Y N D    +N++   L+  L Y     F   VSY+ FL R
Sbjct  308  SQFQSD-GRTLYCLELA-KYFNRDRIDALNEEVGNLLSQLSYMASTLFLTEVSYLEFLDR  365

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  366  VHVSEVKLRSKGLWEVPHPWLNLLI  390



>ref|XP_007149023.1| hypothetical protein PHAVU_005G034000g [Phaseolus vulgaris]
 gb|ESW21017.1| hypothetical protein PHAVU_005G034000g [Phaseolus vulgaris]
Length=538

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 135/205 (66%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CSE  N +LF+ VLGGLGQFGIIT+AR++L+PAP 
Sbjct  197  AFRHGPQISNVQKLEIVTGTGEVVNCSEEQNGDLFHGVLGGLGQFGIITKARIVLEPAPT  256

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y+ F  FT+D E L+  +++FDYVEGFV +N    +N W +   N    +  
Sbjct  257  MVKWIRVLYADFTAFTRDQEKLIFAEKAFDYVEGFVIINRTGLLNNWRS-SFNPQDPVQA  315

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A +Y N +    +N+K E+ +  L +     F+  V+Y++FL R
Sbjct  316  SKFKSD-GRTLFCLELAKYY-NLEETLVVNQKVEKHLSHLNHIPSTLFQTEVTYVDFLDR  373

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNLFI
Sbjct  374  VHISEIKLRSKGLWDVPHPWLNLFI  398



>ref|XP_011037797.1| PREDICTED: cytokinin dehydrogenase 6-like [Populus euphratica]
Length=530

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LF+ VLGGLGQFGIITRAR+ L+PAPD
Sbjct  189  AFRHGPQISNVNQLEVVTGKGEVLNCSEKQNSDLFHGVLGGLGQFGIITRARISLEPAPD  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  F  D E L+  + +FDY+EGFV +N    +N W +   +    +  
Sbjct  249  KVKWIRVLYSDFTTFATDQERLIGAESTFDYIEGFVIINRTSLLNNWRS-SFDPQDPVQA  307

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A  Y N D    +N++   L+  LRY     F   VSY+ FL R
Sbjct  308  SQFQSD-GRTLYCLELA-KYFNRDRIDALNEEVGNLLSQLRYMASTLFLTEVSYLEFLDR  365

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  366  VHVSEVKLRSKGLWEVPHPWLNLLI  390



>ref|NP_001244203.1| cytokinin dehydrogenase 1-like [Glycine max]
 gb|AFC97133.1| cytokinin dehydrogenase 1 [Glycine max]
 gb|KHN07334.1| Cytokinin dehydrogenase 1 [Glycine soja]
Length=545

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 129/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEV+TG G++  CS   N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIFQLEVITGKGEVVTCSGNRNADLFYGVLGGLGQFGIITRARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E LV+ + +FDY+EGFV +N    +N W +   +  +QL  
Sbjct  263  MVKWIRVLYSEFSTFTRDQEYLVSLNNTFDYIEGFVIINRTGILNNWRS-SFDPKNQLQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G   YCLEMA  Y N      +N+    L+  L Y     F   VSY+ FL R
Sbjct  322  SQFSSD-GKTFYCLEMA-KYFNPGEAEAMNQSVAYLLSKLSYIPSTLFLSEVSYVEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E+  RA G W+ PHPWLNL I
Sbjct  380  VHVSEKKLRAQGLWEVPHPWLNLLI  404



>gb|KJB74440.1| hypothetical protein B456_011G295400 [Gossypium raimondii]
Length=527

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LFYSVLGGLGQFGIITRAR+ L+PAP+
Sbjct  186  AFRHGPQISNVYQLEVVTGKGEVVNCSEKQNSDLFYSVLGGLGQFGIITRARISLEPAPE  245

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIR+VY+ F  FT+D E L++   +FDYVEGFV +N    +N W +   N    L  
Sbjct  246  MVKWIRMVYTDFATFTRDQEKLISGQSTFDYVEGFVIINRTGLLNNWRS-SFNPQDPLQA  304

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N++    +N++ +  +  L +     F   V YM FL R
Sbjct  305  SQFKSD-GRTLFCLELA-KYFNHEDMVLVNQEIKTSLSQLNHIPSTLFISEVPYMEFLDR  362

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNLFI
Sbjct  363  VHISEIKLRSRGLWEVPHPWLNLFI  387



>ref|XP_002323274.1| hypothetical protein POPTR_0016s04340g [Populus trichocarpa]
 gb|EEF05035.1| hypothetical protein POPTR_0016s04340g [Populus trichocarpa]
Length=540

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 129/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEVVTG G++  C+E  N+ELFYSVLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIYQLEVVTGKGEVVTCTEKQNAELFYSVLGGLGQFGIITRARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y  F  F+ D E L++  +SFDY+EG V +N    +N W +   N    L  
Sbjct  263  MVKWIRVLYDEFSKFSNDQERLISSKDSFDYIEGLVIINRTGLLNNWRS-SFNPKDPLQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    + G  LYCLE+A  Y + D    +N+K E L+  L Y     F   VSY+ FL R
Sbjct  322  SRFTSE-GKTLYCLEIA-KYFSPDESDIMNQKTESLLSELSYISSTLFLSEVSYVEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPW+NL I
Sbjct  380  VHLSEIKLRSKGLWEIPHPWMNLLI  404



>ref|XP_006402274.1| hypothetical protein EUTSA_v10005878mg [Eutrema salsugineum]
 gb|ESQ43727.1| hypothetical protein EUTSA_v10005878mg [Eutrema salsugineum]
Length=536

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 130/205 (63%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G+I  CSE  NS+LF+ VLGGLGQFGIITRAR+ L+PAP 
Sbjct  191  AFRHGPQISNVHQLEVVTGKGEILNCSERQNSDLFHGVLGGLGQFGIITRARIALEPAPA  250

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+W+RV+Y  F  F +D E L++ D+ FDY+EGFV +N    +N W  +    +  L  
Sbjct  251  MVKWMRVLYLDFSAFAKDQERLISADKRFDYIEGFVIINRTGLLNNWR-LSFTPEDPLQA  309

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+  ++K +D+   +N++ +  +  L Y     F   V+Y  FL R
Sbjct  310  SQFKSD-GRTLYCLEVGKYFKMDDNKDVMNQEVKEWLSELSYVSSTLFSTEVTYEEFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E+  R+ G W+ PHPWLNL +
Sbjct  369  VHVSEKKLRSKGQWEVPHPWLNLLV  393



>gb|EAY97807.1| hypothetical protein OsI_19727 [Oryza sativa Indica Group]
Length=521

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GD+  CS   NS+LF++ LGGLGQFG+ITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGRGDVITCSPKQNSDLFHAALGGLGQFGVITRARIPLEPAPKM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRW+RV+Y  F  FT+D E L++ +++FDY+EGFV +N    +N W +   N    +  +
Sbjct  241  VRWLRVLYLDFTSFTEDQEMLISAEKTFDYIEGFVIINRTGILNNWRS-SFNPQDPVRSS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D G VL+CLEM  ++ N D    + ++   L+  LRY     F  +V+Y+ FL RV
Sbjct  300  QFESD-GKVLFCLEMTKNF-NPDEADVMEQEVNTLLSQLRYMPSSLFHTDVTYIEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLN+ I
Sbjct  358  HSSEMKLRAKGMWEVPHPWLNIII  381



>ref|XP_011088157.1| PREDICTED: cytokinin dehydrogenase 6-like [Sesamum indicum]
Length=526

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++ VCSE  N++LF++VLGGLGQFGIITRAR+ L+PAP 
Sbjct  185  AFRHGPQISNVHQLEVVTGKGEVVVCSEEKNADLFHAVLGGLGQFGIITRARISLEPAPK  244

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F +D E L++ + +FDY+EG V VN    +N W       D +   
Sbjct  245  MVKWIRVLYSDFSTFARDQEHLISAENTFDYIEGLVIVNKTGLINNWRASFNPEDPEQAS  304

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             ++    G  L+CLE+  ++ N D  + INK+ + L+  L Y     F   VSY+ FL R
Sbjct  305  QFV--SDGRTLFCLELTKNF-NPDEATKINKEIKSLLSQLSYIPSTLFVTEVSYVEFLDR  361

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL +
Sbjct  362  VHAAELKLRSKGLWELPHPWLNLLV  386



>ref|NP_001055371.2| Os05g0374200 [Oryza sativa Japonica Group]
 sp|Q75K78.1|CKX9_ORYSJ RecName: Full=Cytokinin dehydrogenase 9; AltName: Full=Cytokinin 
oxidase 9; Short=OsCKX9; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAT01339.1| putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
 gb|AAT58842.1| putative cytokinin dehydrogenase [Oryza sativa Japonica Group]
 gb|EEE63503.1| hypothetical protein OsJ_18319 [Oryza sativa Japonica Group]
 dbj|BAF17285.2| Os05g0374200 [Oryza sativa Japonica Group]
Length=521

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GD+  CS   NS+LF++ LGGLGQFG+ITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGRGDVITCSPEQNSDLFHAALGGLGQFGVITRARIPLEPAPKM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRW+RV+Y  F  FT+D E L++ +++FDY+EGFV +N    +N W +   N    +  +
Sbjct  241  VRWLRVLYLDFTSFTEDQEMLISAEKTFDYIEGFVIINRTGILNNWRS-SFNPQDPVRSS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D G VL+CLEM  ++ N D    + ++   L+  LRY     F  +V+Y+ FL RV
Sbjct  300  QFESD-GKVLFCLEMTKNF-NPDEADVMEQEVNTLLSQLRYMPSSLFHTDVTYIEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLN+ I
Sbjct  358  HSSEMKLRAKGMWEVPHPWLNIII  381



>dbj|BAM74647.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=533

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G + VCSE  N++LF++VLGGLGQFG+ITRAR+ L+PAP 
Sbjct  192  AFRHGPQISNVYQLEVVTGKGAVVVCSEEKNADLFHAVLGGLGQFGVITRARIPLEPAPK  251

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ + +FDY+EG   VN    VN W +   N +  +  
Sbjct  252  MVKWIRVLYSDFSTFTRDQEHLISAENTFDYIEGLAIVNRTGLVNNWRS-SFNPEDPVRA  310

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+  ++ N D  + ++K+ + L+  L Y     F   VSY++FL R
Sbjct  311  SQFVSD-GRTLFCLELTKNF-NPDEAADVDKEIKSLLSQLNYIPSTLFVTEVSYIDFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNL +
Sbjct  369  VHLAEHKLRSKGLWDIPHPWLNLLV  393



>ref|XP_002975207.1| hypothetical protein SELMODRAFT_174721 [Selaginella moellendorffii]
 gb|EFJ23992.1| hypothetical protein SELMODRAFT_174721 [Selaginella moellendorffii]
Length=504

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 138/209 (66%), Gaps = 5/209 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +L+VVTGNGD   CS T NS+LFY+VLGGLGQFGIIT+AR+ L+ AP+
Sbjct  150  AFRHGPQISNVLQLQVVTGNGDTVTCSATRNSDLFYAVLGGLGQFGIITKARIPLEEAPE  209

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES-FDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
              R+ R+VY+ F  F +D E L++ +E   +YVEG V  + DDP  G+++VP + +  ++
Sbjct  210  RARYKRLVYTDFGAFQKDIERLISLNEDVVNYVEGIVIPSCDDPYQGYNSVPFDGE-AID  268

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHP---STINKKAERLVGGLRYCKKLRFEVNVSYMN  529
            P+ IP  +GPVLYC+E+A +Y +        T  ++ E L+G L +   L F  +++Y +
Sbjct  269  PSLIPDSSGPVLYCIEIAKYYNHGQEALMEDTCLQRLETLLGSLSFVPGLTFTTDLTYFD  328

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            FL RV   EE  R    WD PHPWL LF+
Sbjct  329  FLNRVHGVEEVLRKIKQWDVPHPWLALFV  357



>ref|XP_010907734.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=540

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 137/212 (65%), Gaps = 12/212 (6%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTG G+I  CS+  NSELFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  183  AFHHGPQISNVYELDVVTGKGEILTCSKEQNSELFYGVLGGLGQFGIITRARIALEPAPR  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E L++     R E FDYVEGFV V+ +  +N W +   +  
Sbjct  243  RVRWIRVLYSNFTTFTRDQEHLISLHTAHRSERFDYVEGFVIVD-EGLINNWRSSFFSPR  301

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDH--PSTINKKAERLVGGLRYCKKLRFEVNVS  520
            + +  + I  + G VLYCLEM    KN+D    S ++++ E L+  L +     F  ++ 
Sbjct  302  NPVKISSIGSNGG-VLYCLEMT---KNHDESAASLLDQEVEALLKKLEFVPASVFMTDLP  357

Query  521  YMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            Y +FL RV KGE   RA G WD PHPWLNLF+
Sbjct  358  YADFLDRVHKGELKLRAKGMWDVPHPWLNLFV  389



>ref|XP_010547318.1| PREDICTED: cytokinin dehydrogenase 6-like [Tarenaya hassleriana]
Length=510

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N++LFY+VLGGLGQFGIIT+AR+ L+PAPD
Sbjct  169  AFRHGPQISNVIQLEVVTGTGEVVNCSEKQNNDLFYAVLGGLGQFGIITQARISLEPAPD  228

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+Y  F+ F +D E L++ D +FDY+EGFV +N    +N W +   N    +  
Sbjct  229  KVKWIRVLYLDFQTFKRDQEHLISADNTFDYIEGFVIINKTGLLNNWRS-SYNPQDPVKA  287

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D    LYCLE+A  Y N D    IN++ E  +  L Y +  +F   VSY  FL R
Sbjct  288  SQFNSDE-RTLYCLELA-KYFNLDEADEINEEVEESLSQLSYIRSTQFLSEVSYEAFLDR  345

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  346  VHVSETKLRSKGLWEVPHPWLNLLI  370



>ref|XP_010938665.1| PREDICTED: cytokinin dehydrogenase 4 isoform X2 [Elaeis guineensis]
Length=531

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 7/209 (3%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVT----GNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQ  169
            AFR GPQ SNV +L+VVT    G G+I  CS   N++LF+ VLGGLGQFGIITRAR+ L+
Sbjct  187  AFRHGPQISNVHQLQVVTVLCAGRGEIMNCSAEENADLFHGVLGGLGQFGIITRARIALE  246

Query  170  PAPDMVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDH  349
             AP+MV+WIRV+YS F  FT+D E L++ +++FDY+EGFV +N    +N W +   N   
Sbjct  247  RAPEMVKWIRVLYSDFTSFTEDQEMLISAEKTFDYIEGFVIINRTGLLNNWRS-SFNPQD  305

Query  350  QLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMN  529
             +  +    D G +L+CLEM  ++ N D    +N++ E L+  LRY   + F+  VSY+ 
Sbjct  306  PVQASQFNSD-GRILFCLEMTKNF-NPDESDMLNQEVETLLSKLRYIPSMLFQSEVSYLE  363

Query  530  FLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            FL RV   E   R+ G W+ PHPWLNLFI
Sbjct  364  FLDRVHVSEVKLRSQGLWEVPHPWLNLFI  392



>emb|CDY22528.1| BnaC03g23380D [Brassica napus]
Length=532

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 130/210 (62%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF++GPQ +NV +LE+VTG G++  CSE  NSELFYSVLGGLGQFGIITRAR+ L PAP 
Sbjct  198  AFKYGPQINNVCQLEIVTGKGEVMTCSEKQNSELFYSVLGGLGQFGIITRARIALGPAPH  257

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+T+   FDYVEGFV VN  D ++ W +    +D     
Sbjct  258  MVKWIRVLYSDFSAFSRDQEHLITKKNGFDYVEGFVTVNRTDLLDNWRSSFSPNDSIGAS  317

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKK-----AERLVGGLRYCKKLRFEVNVSYM  526
             +  K  G  LYCLE+  ++   +  S   ++      E+L+  L Y     F   V Y+
Sbjct  318  QF--KSEGKTLYCLEIVKYFNTEEVNSVPQERFPLQETEKLLSELSYIPSTLFSSEVPYI  375

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
             FL RV   E   RA G W+ PHPWLNL I
Sbjct  376  EFLDRVHIAEIKLRAKGLWEVPHPWLNLLI  405



>ref|XP_002439706.1| hypothetical protein SORBIDRAFT_09g018640 [Sorghum bicolor]
 gb|EES18136.1| hypothetical protein SORBIDRAFT_09g018640 [Sorghum bicolor]
Length=522

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 131/206 (64%), Gaps = 7/206 (3%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   NS+LF++ LGGLGQFGIITRAR++L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGKGDIITCSPERNSDLFHAALGGLGQFGIITRARIVLEPAPKM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+YS F  F +D E L++ + +FDY+EGFV +N    +N W +    S    +P 
Sbjct  241  VRWIRVLYSDFTSFAEDQEMLISAERTFDYIEGFVIINRTGILNNWRS----SFSPQDPV  296

Query  365  YIP--KDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            +    K  G VL+CLEM  +Y N +    + ++   L+  LR+     F  +V+Y+ FL 
Sbjct  297  WASQFKSDGRVLFCLEMTKNY-NPEESDNMEQEVNSLLHQLRHMPPSLFHTDVTYIEFLD  355

Query  539  RVKKGEEHARANGTWDTPHPWLNLFI  616
            RV   E   RA G W+ PHPWLNL +
Sbjct  356  RVHSSEVKLRAKGMWEVPHPWLNLMV  381



>gb|AII20187.1| cytokinin oxidase/dehydrogenase-like 7 [Nicotiana tabacum]
Length=552

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LEVVTG G++  CSE  N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  209  AFKHGPQINNVYQLEVVTGKGEVITCSEEQNADLFYGVLGGLGQFGIITRARIALEPAPK  268

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  F+ D E L++ + SFDY+EGFV +N    +N W +     D  L  
Sbjct  269  KVKWIRVLYSDFSTFSYDQEHLISLENSFDYIEGFVIINRTGLLNNWRSTFNPKDPLLAK  328

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +     G VLYCLE+A  Y N +  +  ++  + L+  L Y +   F+  VSY++FL R
Sbjct  329  EF--SSEGKVLYCLEVA-KYFNPEETTKTDQNVDVLLSKLNYIQSTLFQSEVSYVDFLDR  385

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G WD PHPWLNL I
Sbjct  386  VHVSEMKLREKGLWDIPHPWLNLLI  410



>ref|XP_010067774.1| PREDICTED: cytokinin dehydrogenase 6-like [Eucalyptus grandis]
 gb|KCW65970.1| hypothetical protein EUGRSUZ_G03270 [Eucalyptus grandis]
Length=548

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 133/210 (63%), Gaps = 13/210 (6%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEV+TG G++  CS   N +LF+SVLGGLGQFGIIT+AR+ L+PAPD
Sbjct  207  AFRHGPQISNVHQLEVITGKGEVVKCSANQNEDLFHSVLGGLGQFGIITQARISLEPAPD  266

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTV-----PLNSD  346
             V+WIR++YS F+ FT+D E L++ + +FDY+EGFV +N    +N W +      PL + 
Sbjct  267  KVKWIRMLYSDFDTFTRDQEHLISSENTFDYIEGFVIINRTGLLNNWRSSFSPQDPLQAS  326

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            H        K  G  L+CLE+A  Y N     TI ++ ERL+  L Y     F   VSY+
Sbjct  327  HF-------KSDGRTLFCLEVA-KYFNLGQTDTIIEEVERLLSPLNYISSTLFLSEVSYI  378

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV   E   R+ G W+ PHPWLNL I
Sbjct  379  DFLDRVHVSEVKLRSKGLWEVPHPWLNLLI  408



>ref|XP_001777489.1| predicted protein [Physcomitrella patens]
 gb|EDQ57664.1| predicted protein, partial [Physcomitrella patens]
Length=492

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 139/206 (67%), Gaps = 4/206 (2%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GP+ SNV +LEVVTG G +  C+ T NSELF++VLGGLGQFGIIT+AR++L+ AP  
Sbjct  154  FRHGPEVSNVLQLEVVTGKGLVVECTPTKNSELFFAVLGGLGQFGIITKARIVLEKAPQR  213

Query  185  VRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRW+R +Y+ F  F +D E L++    ++FDYVEGFV VN+++ +NGW +VP     +++
Sbjct  214  VRWMRTLYTDFVTFKKDQELLISSATSKTFDYVEGFVVVNNENAINGWGSVPF-VHSEIS  272

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
               IP  A  ++YCLE+   Y   D   T++++ E ++  L + ++L F+ + +Y  FL 
Sbjct  273  EAMIPPSASAIMYCLEVIKAYSAAD-VQTLDEEIESMLAPLNFHRELLFKTDTTYFKFLD  331

Query  539  RVKKGEEHARANGTWDTPHPWLNLFI  616
            RV + E   R+ G W+ PHPWLN+F+
Sbjct  332  RVHELELQLRSRGLWEIPHPWLNIFV  357



>ref|XP_004514814.1| PREDICTED: cytokinin dehydrogenase 6-like [Cicer arietinum]
Length=554

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV ++E+VTG G++  CS+  N ELFYSVLGGLGQFGIIT+AR++L+PAP 
Sbjct  213  AFRHGPQISNVLKMEIVTGTGEVVNCSKEENVELFYSVLGGLGQFGIITKARILLEPAPT  272

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y+ F  FT+D E L+  ++ FDY+EGFV  N    +N W +   N    +  
Sbjct  273  MVKWIRVLYADFTAFTRDQEKLIFAEKGFDYIEGFVIKNRTGLLNNWRS-SFNPQDPVQA  331

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A  Y N+     +N+  E+ +  L Y     F+  ++Y++FL R
Sbjct  332  SKFKSD-GRTLYCLELA-KYFNHQETFAVNQDVEKHLSHLNYIPSTLFQTEITYVDFLDR  389

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNL I
Sbjct  390  VHISEVKLRSKGLWDVPHPWLNLLI  414



>ref|XP_007219000.1| hypothetical protein PRUPE_ppa004120mg [Prunus persica]
 gb|EMJ20199.1| hypothetical protein PRUPE_ppa004120mg [Prunus persica]
Length=529

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N +LF+SVLGGLGQFGIITRAR+ L+ AP 
Sbjct  188  AFRHGPQISNVHQLEVVTGKGEVINCSEEQNEDLFHSVLGGLGQFGIITRARISLEAAPA  247

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  FTQD E L++ + +FDYVEGFV +N    +N W +   NS   +  
Sbjct  248  RVKWIRVLYSDFAAFTQDQEHLISSENTFDYVEGFVIINRTGLLNNWRS-SFNSKDPVQA  306

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N D    IN++ E  +  L Y +   F   V+Y++FL R
Sbjct  307  SQFKSD-GRTLFCLELA-KYFNLDKTDLINEEVENFLSRLSYIRSTLFMSEVAYIDFLDR  364

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+   WD PHPWLNL I
Sbjct  365  VHVSEIKLRSKDLWDVPHPWLNLLI  389



>gb|KJB76264.1| hypothetical protein B456_012G081000 [Gossypium raimondii]
Length=518

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LFYSVLGGLGQFGIITRAR+ L+PAP 
Sbjct  176  AFRHGPQISNVRQLEVVTGKGEVVNCSEKQNSDLFYSVLGGLGQFGIITRARISLEPAPK  235

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y+ F  F +D E L++ + +FDY+EGFV +N    +N W +   NS+     
Sbjct  236  MVKWIRVLYTDFATFAKDQEMLISGESTFDYIEGFVIINRTGLLNNWRS-SFNSNDSAQT  294

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G  L+CLE+A  Y N +  + +N++    +  L +     F+  V Y+ FL R
Sbjct  295  SHFKSD-GRTLFCLELA-KYFNPEEMAIVNQEIMTSLSQLNHIPSTLFQSQVPYIEFLDR  352

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  353  VHISEIKLRSKGLWEVPHPWLNLLI  377



>gb|EYU27005.1| hypothetical protein MIMGU_mgv1a004144mg [Erythranthe guttata]
Length=542

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++ VCSE  N++LF+ VLGGLGQFGIITRAR+ L+ AP 
Sbjct  192  AFRHGPQISNVRQLEVVTGKGEVVVCSEEKNADLFHGVLGGLGQFGIITRARISLETAPK  251

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F +D E L++ +++FDYVEG V VN    +N W +     D +   
Sbjct  252  MVKWIRVLYSDFSTFVRDQEHLISSEKTFDYVEGLVIVNKTGLINNWRSSFNPQDPEQAS  311

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             ++    G  L+CLE+  ++ + D  +  +K+ ERL+  L Y +   F   V+Y+ FL R
Sbjct  312  RFVSD--GKTLFCLELTKNF-DPDEDTDTDKEIERLLSELSYIESTLFVTEVTYVEFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNL +
Sbjct  369  VHAAEMKLRSKGLWDLPHPWLNLLV  393



>ref|XP_006843486.1| hypothetical protein AMTR_s00053p00208790 [Amborella trichopoda]
 gb|ERN05161.1| hypothetical protein AMTR_s00053p00208790 [Amborella trichopoda]
Length=514

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 137/205 (67%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR+GPQ SNV +LEVVTG G++  CS   N++LF++VLGGLGQFGIIT+AR+ L+PAP+
Sbjct  177  AFRYGPQISNVYQLEVVTGKGEVVNCSAQKNADLFHAVLGGLGQFGIITKARIALEPAPE  236

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ ++ FDYVEGFV +N +  +N W +     ++ +  
Sbjct  237  MVKWIRVLYSDFSLFTKDQELLISLEKGFDYVEGFVIINRNGILNNWRSSFFTPENPIQA  296

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    + G  LYCLE+A ++  N+  +T +++ E L+  L +     F   + Y++FL R
Sbjct  297  SRFNSN-GRTLYCLEIAKNFDFNNANAT-DQEVESLLAQLSFIPSTLFSSELPYLDFLDR  354

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  355  VHASEVKLRAQGLWEVPHPWLNLLI  379



>ref|XP_003539919.1| PREDICTED: cytokinin dehydrogenase 6-like [Glycine max]
Length=538

 Score =   199 bits (506),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G++  CS  +N +LF+SVLGGLGQFGIITRAR++L+PAP 
Sbjct  197  AFRHGPQISNVQQLEIVTGTGEVVNCSAENNGDLFHSVLGGLGQFGIITRARIVLEPAPA  256

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ + +FDY+EGFV +N    +N W  +  N    +  
Sbjct  257  MVKWIRVLYSDFTAFTRDQERLISAENTFDYIEGFVIINRTGLLNNWR-LSFNPQDPVQA  315

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G  L+CLEMA  Y N +     N++ E  +  L Y     F   V++++FL R
Sbjct  316  SHFKSD-GRTLFCLEMA-KYFNVEEIDAANQEVEEHLSRLSYIPSTLFSTEVTFVDFLDR  373

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNL I
Sbjct  374  VHISEVKLRSKGLWDVPHPWLNLLI  398



>ref|XP_009767664.1| PREDICTED: cytokinin dehydrogenase 1-like [Nicotiana sylvestris]
Length=552

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LEVVTG G++  CSE  N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  209  AFKHGPQINNVYQLEVVTGKGEVITCSEEQNADLFYGVLGGLGQFGIITRARIALEPAPK  268

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  F+ D E L++ + SFDY+EGFV +N    +N W +     D  L  
Sbjct  269  KVKWIRVLYSDFSTFSYDQEHLISLENSFDYIEGFVIINRTGLLNNWRSTFNPKDPLLAK  328

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +     G VLYCLE+A  Y N +  +  ++  + L+  L Y +   F+  VSY++FL R
Sbjct  329  EF--SSEGKVLYCLEVA-KYFNPEETTKTDQNVDALLSKLNYIQSTLFQSEVSYVDFLDR  385

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   +  G WD PHPWLNL I
Sbjct  386  VHVSEMKLQEKGLWDVPHPWLNLLI  410



>gb|KJB35953.1| hypothetical protein B456_006G134800 [Gossypium raimondii]
Length=542

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ  NV +LEVVTG G++  CS+  N++LFY VLGGLGQFGIITRAR+ L PA  
Sbjct  204  AFRHGPQIDNVYQLEVVTGRGEVVTCSDKENADLFYGVLGGLGQFGIITRARISLGPAEK  263

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F+ D E L++ + SFDY+EGFV +N    +N W +   N    +  
Sbjct  264  MVKWIRVLYSEFSTFSNDQEHLISSNNSFDYIEGFVMINRTGLLNNWRS-SFNPKDPIQA  322

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G +LYCLEM + Y N +    +N+  E+L+  L Y     F   VSY+ FL R
Sbjct  323  SQFSSD-GKILYCLEM-VKYFNPEKIDVLNQDIEKLLSELNYIPSTLFLSEVSYVEFLDR  380

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  381  VHLSEIKLRSKGLWEVPHPWLNLLI  405



>ref|XP_003625100.1| Cytokinin oxidase [Medicago truncatula]
 gb|AES81318.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=544

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +N+ +LE+VTG G++  CSE  N++LF+ VLGGLGQFGIITRAR+ L+PAP 
Sbjct  202  AFRHGPQINNIFQLEIVTGKGEVVTCSENRNADLFHGVLGGLGQFGIITRARISLEPAPK  261

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++  +  DY+EGFV +N    +NGW  +  +    L  
Sbjct  262  MVKWIRVLYSDFSKFTRDQEYLISLKDKIDYIEGFVIINRTGILNGWR-LSFDPKDPLQA  320

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G   YCLEMA  Y N D    +N+  + L+  L Y     F   VSY+ FL R
Sbjct  321  SQFNSD-GKTFYCLEMA-KYFNPDEADVMNQDVDHLLSQLSYIPPTLFLSEVSYVEFLDR  378

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E+  RA G W+  HPWLNL I
Sbjct  379  VHVSEKKLRAQGLWEVHHPWLNLLI  403



>ref|XP_004143695.1| PREDICTED: cytokinin dehydrogenase 6-like [Cucumis sativus]
 ref|XP_004173066.1| PREDICTED: cytokinin dehydrogenase 6-like [Cucumis sativus]
Length=547

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS+  NS+LFYSVLGGLGQFGIITRA+++L+PAP 
Sbjct  206  AFRHGPQISNVHQLEIVTGKGDVVNCSKEQNSDLFYSVLGGLGQFGIITRAKILLEPAPT  265

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y  F  F+++ E L++   +FDY+EGFV +N    +N W +   N    +  
Sbjct  266  MVKWIRVLYLDFTTFSREQELLISAQNTFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G +LYCLE+A ++ + +  + IN++  RL+  L Y     F   V+Y+ FL R
Sbjct  325  SQFKSD-GKILYCLELAKYFHHTE-GNIINQEVTRLLSQLSYIPSTLFISEVTYVEFLDR  382

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V+      ++ G W+ PHPWLNL I
Sbjct  383  VQVSAVKLQSKGLWEVPHPWLNLLI  407



>ref|XP_010932835.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
 ref|XP_010932844.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=535

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 137/210 (65%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV E++V+TG G+I  CSE  NSELF+ VLGGLGQFGIITRAR+ L+PAP 
Sbjct  182  AFHHGPQISNVYEVDVITGKGEIVTCSEEQNSELFHGVLGGLGQFGIITRARLALEPAPQ  241

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E L++     R E FDYVEGFV V+ +  +N W +   +  
Sbjct  242  RVRWIRVLYSNFTTFTRDQELLISLHGTHRSERFDYVEGFVIVD-EGLINNWRSSFFSPR  300

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + +N + I  + G VLYCLEM  +Y ++     ++++ E L+  L +     F  ++ Y+
Sbjct  301  NSVNISSIGTNGG-VLYCLEMTKNY-DDSTADFVDQEVEALLKRLEFIPASVFTTDLPYV  358

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV K E   RA G WD PHPWLNLF+
Sbjct  359  DFLDRVHKAELKLRAKGLWDVPHPWLNLFV  388



>ref|XP_010269658.1| PREDICTED: cytokinin dehydrogenase 1-like [Nelumbo nucifera]
Length=544

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N +LFY VLGGLGQFGIITRA + L+PAP 
Sbjct  203  AFRHGPQISNVYQLEVVTGKGEVVSCSENQNEDLFYGVLGGLGQFGIITRATIALEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F +D E L++ + +FDY+EGFV +N    +N W +   N    L  
Sbjct  263  MVKWIRVLYSDFSIFVKDQEYLISAENTFDYIEGFVIINRTGLLNNWRS-SFNPQDPLQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLEM  ++ N D    +N++ E L+  L Y     F   VSY+ FL R
Sbjct  322  SRFNSD-GRTLFCLEMTKNF-NPDETDAMNQEVESLLSQLNYIPSTLFVSEVSYLEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   ++ G W+ PHPWLNL I
Sbjct  380  VHVSELKLQSKGLWEIPHPWLNLLI  404



>ref|XP_008796604.1| PREDICTED: cytokinin dehydrogenase 5-like [Phoenix dactylifera]
Length=554

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 135/210 (64%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTG G+I  CSE  NSELFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  183  AFHHGPQISNVYELDVVTGMGEILTCSEEENSELFYGVLGGLGQFGIITRARIALEPAPR  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E L++     R E FDYVEGFV V+ +  +N W +   +  
Sbjct  243  RVRWIRVLYSNFTTFTRDQEHLISLHSAHRSERFDYVEGFVIVD-EGLINNWRSSFFSPR  301

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + +  + I  + G VLYCLEM  +Y +      ++++ E L+  L +     F  ++ Y+
Sbjct  302  NPVKISSIGANGG-VLYCLEMTKNY-DESTAGLVDQEVEALLTKLEFIPASVFTTDLPYV  359

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV K E   RA G WD PHPWLNLF+
Sbjct  360  DFLDRVHKAELKLRAKGMWDVPHPWLNLFV  389



>ref|XP_001784400.1| predicted protein [Physcomitrella patens]
 gb|EDQ50805.1| predicted protein, partial [Physcomitrella patens]
Length=480

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 143/206 (69%), Gaps = 10/206 (5%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            F FGP+ SNV +L+V         CS T N++LF+ VLGGLGQFGIIT AR++L+PA + 
Sbjct  150  FLFGPEISNVLQLDVSVK------CSPTQNADLFHGVLGGLGQFGIITSARIILEPAHEK  203

Query  185  VRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIRV+Y+ F  FT+D E LV++  + +FDY+EGFV + ++D +NGW++VP +S  +++
Sbjct  204  VRWIRVMYTDFAAFTRDQEMLVSQPPESAFDYIEGFVVLKTEDSINGWNSVPFDS-KKID  262

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P+ IP++ G VLY +E+  ++ +ND   T+N+  ER++  L +   L F ++VSY  FL 
Sbjct  263  PSVIPEEGGSVLYYIELVKNFSSNDT-DTVNETVERMLAPLSFIPALVFTIDVSYEKFLN  321

Query  539  RVKKGEEHARANGTWDTPHPWLNLFI  616
            R+   E +  ++G WD PHPWLNLF+
Sbjct  322  RLHDVEVNLDSHGLWDIPHPWLNLFV  347



>emb|CAN76251.1| hypothetical protein VITISV_025507 [Vitis vinifera]
Length=578

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 130/219 (59%), Gaps = 17/219 (8%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +LEVVTG GDI  CSET N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  235  AFRHGPQINNVYQLEVVTGKGDIITCSETQNADLFYGVLGGLGQFGIITRARISLEPAPK  294

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++   SFDY+EGFV +N    +N W +   N    L  
Sbjct  295  MVKWIRVLYSEFSIFSKDQEHLISFKNSFDYIEGFVIINRTGLLNTWRS-SFNPGEPLQA  353

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTIN--------------KKAERLVGGLRYCKKL  499
            +    D G  LYCLEMA  Y N D    +N              +  E L+  L Y    
Sbjct  354  SQFNSD-GRTLYCLEMA-KYFNPDETHIVNQIYEVVLAKLYFLLQVIESLLSELSYIPST  411

Query  500  RFEVNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
             F   V Y++FL RV   E   RA G W+ PHPWLNL I
Sbjct  412  LFLSEVPYVDFLDRVHVSEIKLRAKGLWEVPHPWLNLLI  450



>ref|XP_008387997.1| PREDICTED: cytokinin dehydrogenase 5-like [Malus domestica]
Length=538

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 136/210 (65%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF +GPQ SNV EL+VVTG G +  CSE  NSELF +VLGGLGQFGIITRAR+ L+P+P 
Sbjct  180  AFNYGPQISNVHELDVVTGKGQLLTCSEEQNSELFQAVLGGLGQFGIITRARIALEPSPK  239

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E L++       + FDYVEGFV V+ +  +N W +   ++ 
Sbjct  240  RVRWIRVLYSNFSAFTKDQEFLISLHGQPSSQKFDYVEGFVIVD-EGLINNWRSSFFSAS  298

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + +  T I  + G VLYCLE+  +Y +     TI+K+ E L+  L +     F  ++ Y+
Sbjct  299  NPVKITSIDSEGG-VLYCLEITKNY-DESTADTIDKEIEDLLEKLDFVPTSVFTTDLPYV  356

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV K E   RA G WD PHPWLNLF+
Sbjct  357  DFLDRVHKAELKLRAKGLWDVPHPWLNLFV  386



>ref|XP_009609443.1| PREDICTED: cytokinin dehydrogenase 1-like [Nicotiana tomentosiformis]
Length=552

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LEVVTG G++  CSE  N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  209  AFKHGPQINNVYQLEVVTGKGEVITCSEEKNADLFYGVLGGLGQFGIITRARIALEPAPK  268

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  F+ D E L++ + SFDY+EGFV +N    +N W +     D  L  
Sbjct  269  KVKWIRVLYSDFSTFSYDQEHLISSENSFDYIEGFVIINRTGLLNNWRSTFNPKDPLLAK  328

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +     G VLYCLE+A  Y N +  +  ++  + L+  L Y +   F+  VSY++FL R
Sbjct  329  EF--SSEGKVLYCLEVA-KYFNPEETTKTDQNVDVLLSKLNYIQSTLFQSEVSYVDFLNR  385

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   +  G WD PHPWLNL I
Sbjct  386  VHVSEMKLQEKGLWDIPHPWLNLLI  410



>ref|XP_004962256.1| PREDICTED: cytokinin dehydrogenase 9-like [Setaria italica]
Length=522

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 130/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   NS+LF++ LGGLGQFGIITRAR+ L+ AP M
Sbjct  181  FRHGPQISNVIELEIVTGRGDIITCSPDQNSDLFHAALGGLGQFGIITRARIALERAPKM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+YS F  FT+D E L++ + +FDY+EGFV +N    +N W +   N    +  +
Sbjct  241  VRWIRVLYSDFISFTEDQEMLISAERTFDYIEGFVTINRTGILNNWRS-SFNPQDPVWAS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D G VL+CLEM  +Y N +    + ++   L+  LRY  +  F  +V+Y+ FL RV
Sbjct  300  QFESD-GRVLFCLEMTKNY-NPEEVDNMEQEVNNLLYQLRYIPQSLFHTDVTYIEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLNL I
Sbjct  358  HSSEVKLRAKGMWEVPHPWLNLMI  381



>gb|KJB14468.1| hypothetical protein B456_002G126300 [Gossypium raimondii]
Length=503

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 138/212 (65%), Gaps = 12/212 (6%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTG G++  CSE  N+ELF++VLGGLGQFGIITRAR+ L+PAP 
Sbjct  152  AFNHGPQISNVYELDVVTGKGEVLTCSEDENTELFHAVLGGLGQFGIITRARISLEPAPK  211

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
            MVRWIRV+YS F  FT D E L++      ++ FDYVEGFV V+ +  +N W +  L+  
Sbjct  212  MVRWIRVLYSNFSAFTSDQEHLISLHAEPSNQKFDYVEGFVIVD-EGLINNWRSSLLSPQ  270

Query  347  HQLNPTYIPK--DAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVS  520
               NP  I     +G VLYCLE+A +Y  +    TI+++ E L+  L +     F  ++ 
Sbjct  271  ---NPVKISTLFPSGGVLYCLEIAKNYHEST-AQTIDQEVEFLLKKLNFISTSGFTTDLL  326

Query  521  YMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            Y++FL RV K E   R+ G W+ PHPWLNLFI
Sbjct  327  YVDFLDRVHKAELKLRSKGLWEVPHPWLNLFI  358



>gb|AAN16383.1| cytokinin dehydrogenase 2 [Hordeum vulgare]
 gb|AFK79780.1| cytokinin oxidase/dehydrogenase [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 127/204 (62%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   NS+LF + LGGLGQFGIITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGRGDIVTCSPEQNSDLFRAALGGLGQFGIITRARIALEPAPQM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+Y  F  FT+D E L++ +++FDY+EGFV +N    +N W +   N       +
Sbjct  241  VRWIRVLYLDFMSFTEDQEMLISAEKTFDYIEGFVIINRTGILNNWRS-SFNPQDPERAS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D   VL+CLEM  ++ N +    + ++   L+  LRY     F  +V+Y+ FL RV
Sbjct  300  RFETDR-KVLFCLEMTKNF-NPEEADIMEQEVHALLSQLRYTPASLFHTDVTYIEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLNL I
Sbjct  358  HSSEMKLRAKGLWEVPHPWLNLII  381



>gb|KJB58188.1| hypothetical protein B456_009G198300 [Gossypium raimondii]
 gb|KJB58189.1| hypothetical protein B456_009G198300 [Gossypium raimondii]
 gb|KJB58190.1| hypothetical protein B456_009G198300 [Gossypium raimondii]
Length=423

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 138/210 (66%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTG G++  CSE  NSE+F++VLGGLGQFGIITRAR+ L+PAP 
Sbjct  183  AFNHGPQISNVHELDVVTGKGELLTCSEEQNSEMFHAVLGGLGQFGIITRARISLEPAPQ  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES-----FDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E L++  E      FDYVEGFV V+ +  +N W +   +  
Sbjct  243  RVRWIRVLYSNFSTFTRDQEYLISLHEQPASQKFDYVEGFVIVD-EGLINNWRSSFFSPH  301

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + +  + +  + G VLYCLE+A +Y  +   STI+++ E L+  L +     F  ++ Y+
Sbjct  302  NPVKISSLEPNGG-VLYCLEIAKNYHEST-ASTIDQEVESLLKKLNFIPASVFTTDMPYV  359

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV K E   R+ G W+ PHPWLNLF+
Sbjct  360  DFLDRVHKAELKLRSKGLWEVPHPWLNLFV  389



>ref|XP_008392337.1| PREDICTED: cytokinin dehydrogenase 1-like [Malus domestica]
Length=544

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +L+VVTG G++  CS++ N +LFY VLGGLGQFGIIT+AR+ L+PAP 
Sbjct  203  AFRHGPQINNVYQLQVVTGKGEVITCSKSKNPDLFYGVLGGLGQFGIITQARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y  F  F++D E L+  + SFDY+EGFV +N    +N W +   N    +  
Sbjct  263  MVKWIRVLYLDFSSFSKDQEYLIASENSFDYIEGFVILNRTGLLNNWRS-SFNPKDPMQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N D  + I++  ERL+  L Y     F   VS++ FL R
Sbjct  322  SQFNSD-GKTLYCLEMA-KYFNPDVTNVIDQITERLLLKLHYIPSTLFMSEVSFVEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPW+NL I
Sbjct  380  VHLSELKLRAKGLWEVPHPWMNLLI  404



>dbj|BAH47540.1| cytokinin oxidase [Zinnia violacea]
Length=534

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +L+VVTG G++  C++  NS+LF+ VLGGLGQFGIITRA + L+PAP+
Sbjct  193  AFRHGPQINNVHQLQVVTGTGEVVTCTKEMNSDLFHGVLGGLGQFGIITRAHITLEPAPE  252

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WI+V+Y  F  FT+D E L++ + SFDYVEGFV +N    +N W +   + D     
Sbjct  253  MVKWIKVLYMDFATFTKDQELLISSNTSFDYVEGFVLINRTGLLNNWRSSFKSKDPVQAK  312

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             ++ +  G  +YCLE+A +YK  D   TI++K E L+  L Y     F   VSY+ FL R
Sbjct  313  RFVTE--GKTIYCLEIAKYYKQED-VHTIDQKIESLLSTLNYNDFTLFISEVSYVEFLDR  369

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   +  G WD PHPWLNL +
Sbjct  370  VHVSELKLQEKGLWDVPHPWLNLLV  394



>gb|KHN32384.1| Cytokinin dehydrogenase 6 [Glycine soja]
Length=535

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV  LE+VTG G++  CS  +N +LF+SVLGGLGQFGIITRAR++L+PAP 
Sbjct  194  AFRHGPQISNVQLLEIVTGTGEVVNCSAENNGDLFHSVLGGLGQFGIITRARIVLEPAPA  253

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ + +FDY+EGFV +N    +N W  +  N    +  
Sbjct  254  MVKWIRVLYSDFTAFTRDQERLISAENTFDYIEGFVIINRTGLLNNWR-LSFNPQDPVQA  312

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            ++   D G  L+CLEMA  Y N +     N++ E  +  L Y     F   V++++FL R
Sbjct  313  SHFKSD-GRTLFCLEMA-KYFNVEEIDAANQEVEEHLSRLSYIPSTLFSTEVTFVDFLDR  370

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G WD PHPWLNL I
Sbjct  371  VHISEVKLRSKGLWDVPHPWLNLLI  395



>gb|EMS64767.1| Cytokinin dehydrogenase 9 [Triticum urartu]
Length=560

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   NS+LF++ LGGLGQFGIITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGRGDIITCSPEQNSDLFHAALGGLGQFGIITRARIALEPAPQM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+Y  F  FT+D E L++ +++FDY+EGFV +N    +N W +   N       +
Sbjct  241  VRWIRVLYLDFMSFTEDQEMLISAEKTFDYIEGFVSINRTGILNNWRS-SFNPQDPERAS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D   VL+CLEM  ++ N +    + ++   L+  LRY     F  +V+YM FL RV
Sbjct  300  QFETDR-KVLFCLEMTKNF-NPEEADIMEQEIHALLSQLRYTPPSLFHTDVTYMEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLNL I
Sbjct  358  HSSEIKLRAKGLWEVPHPWLNLII  381



>ref|XP_007203158.1| hypothetical protein PRUPE_ppa024442mg [Prunus persica]
 gb|EMJ04357.1| hypothetical protein PRUPE_ppa024442mg [Prunus persica]
Length=545

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 129/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +LEVVTG G++  CSE  + +LFY VLGGLGQFGIIT+AR+ L+PAP 
Sbjct  204  AFRHGPQINNVYQLEVVTGQGEVITCSENKSPDLFYGVLGGLGQFGIITQARISLEPAPK  263

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++ + SFDY+EGFV +N    +N W +   N    +  
Sbjct  264  MVKWIRVLYSDFSSFTKDQEFLISSENSFDYIEGFVIINRTGLLNNWRS-SFNPKDPMQA  322

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N +    ++++ E L+  L Y     F   VSY+ FL R
Sbjct  323  SKFNSD-GRTLYCLEMA-KYFNPNETDVMDQRTESLLLLLHYIPSTLFLSEVSYVEFLDR  380

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G W+ PHPW+NL I
Sbjct  381  VHLSEIKLRTKGLWEVPHPWMNLLI  405



>dbj|BAG16379.1| cytokinin oxidase family protein [Brassica rapa var. perviridis]
Length=524

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G+   CS+  N ELF+SVLGGLGQFGIITRAR+ L PAP 
Sbjct  183  AFKHGPQINNVYQLEIVTGKGEAVTCSKKLNPELFHSVLGGLGQFGIITRARISLGPAPH  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+++ + FD+VEG V +N  D +N W +    +D     
Sbjct  243  MVKWIRVLYSDFSTFSRDQEHLISKKKGFDFVEGSVTINRTDLLNNWRSSFTPNDSTEAS  302

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  +++N++ E+L+  L Y     F   V Y+ FL R
Sbjct  303  QF--KSDGKTLYCLEV-VKYFNKEEANSMNQETEKLLSELSYIPSTLFSSVVPYIEFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V  GE   RA G W+ PHPWLNL +
Sbjct  360  VHLGEIKLRAKGLWEVPHPWLNLLV  384



>gb|KGN62632.1| hypothetical protein Csa_2G362450 [Cucumis sativus]
Length=434

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 138/216 (64%), Gaps = 16/216 (7%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTGNG+I  CS   N++LF+ VLGGLGQFGIITRAR++L+PAP 
Sbjct  190  AFNHGPQISNVHELDVVTGNGEIVKCSNEENADLFHGVLGGLGQFGIITRARIVLEPAPQ  249

Query  182  MVRWIRVVYSAFEDFTQDAESLVT------RDESFDYVEGFVFVNSDDPVNGWSTVPLNS  343
             VRWIRV+YS FE FT+D E L++       +E FDYVEGFV V+ +  +N W +   + 
Sbjct  250  RVRWIRVLYSNFEAFTKDQEWLISLHSKTNSNEKFDYVEGFVIVD-EGLINNWRSSFFSP  308

Query  344  DHQLNPTYIP-----KDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFE  508
                NP  I      K  G VLYCLE+  +Y  +    T++++ E L+  L Y  +  F 
Sbjct  309  ---ANPVKISSFNKNKSHGAVLYCLEITKNYHESS-SHTLDQEVEALMKELNYIPESVFT  364

Query  509  VNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
             ++ Y++FL RV K E   R+ G WD PHPWLNLF+
Sbjct  365  TDLGYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFV  400



>ref|XP_001777510.1| predicted protein [Physcomitrella patens]
 gb|EDQ57685.1| predicted protein [Physcomitrella patens]
Length=565

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 141/206 (68%), Gaps = 4/206 (2%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            F FGP+ SNV +L+VVTG G    CS T +S+LF+ VLGGLGQFG+IT AR++L+PA + 
Sbjct  210  FLFGPEISNVLQLDVVTGTGHAVTCSPTKHSDLFHGVLGGLGQFGVITSARIVLEPAHEK  269

Query  185  VRWIRVVYSAFEDFTQDAESLVTR--DESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLN  358
            VRWIR +Y+ F  FT+D E L+++    +FDY+EGFV + ++DP NGW++VP ++  +++
Sbjct  270  VRWIRAMYTDFATFTRDQEMLISQPPQHTFDYIEGFVVLKNEDPNNGWNSVPFDAK-KID  328

Query  359  PTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLL  538
            P+ IP++ G VLY +E+A  + + D+   +++  ER++  L +   L F  +V Y  FL 
Sbjct  329  PSMIPEEGGSVLYYIELAKKF-SGDNILGLDQIVERMMAPLSFIPTLVFTTDVPYAKFLN  387

Query  539  RVKKGEEHARANGTWDTPHPWLNLFI  616
            R+   E +  + G WD PHPWLNLF+
Sbjct  388  RLHDVELNLASQGLWDVPHPWLNLFV  413



>ref|XP_008349298.1| PREDICTED: cytokinin dehydrogenase 6-like [Malus domestica]
Length=529

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N +LF+SVLGGLGQFGIITRAR+ L+ AP 
Sbjct  188  AFRHGPQISNVHQLEVVTGKGEVVNCSEEQNEDLFHSVLGGLGQFGIITRARISLEAAPA  247

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  FTQD E L++ + +FDY+EGFV +N    +N W +   NS   +  
Sbjct  248  RVKWIRVLYSDFTAFTQDQEHLMSAENTFDYIEGFVIINRTGLLNNWRS-SFNSKDPVQA  306

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N D    I+++ E  +  L Y +   F   V+Y++FL R
Sbjct  307  SQFKSD-GKTLFCLELA-KYFNLDKTKIIDEEIENSLSQLSYIRSTLFVSEVAYIDFLDR  364

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+   WD PHPWLNL I
Sbjct  365  VHXSEIKLRSKDLWDVPHPWLNLLI  389



>gb|EMT30248.1| Cytokinin dehydrogenase 1 [Aegilops tauschii]
Length=521

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 128/204 (63%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   N++LF++ LGGLGQFGIITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGRGDIITCSPEQNNDLFHAALGGLGQFGIITRARIALEPAPQM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+Y  F  FT+D E L++ +++FDY+EGFV +N    +N W +   N       +
Sbjct  241  VRWIRVLYLDFVSFTEDQEMLISAEKTFDYIEGFVSINRTGILNNWRS-SFNPQDPERAS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D   VL+CLEM  ++ N +    + ++   L+  LRY     F  +V+YM FL RV
Sbjct  300  QFETDR-KVLFCLEMTKNF-NPEEADIMEQEVHALLSQLRYTPASLFHTDVTYMEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLNL +
Sbjct  358  HSSEIKLRAKGLWEVPHPWLNLIV  381



>ref|XP_009352666.1| PREDICTED: cytokinin dehydrogenase 3-like [Pyrus x bretschneideri]
Length=517

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 134/210 (64%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFRFGPQ +NV E++VVTG GD   CS   NSELF+ VLGGLGQFGIITRAR+ L+PAP 
Sbjct  179  AFRFGPQITNVYEMDVVTGQGDFVTCSPQKNSELFFGVLGGLGQFGIITRARISLEPAPK  238

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             V+W+R++YS F  F +D E L++     +  + DY+EG + +N   P N  S+    S 
Sbjct  239  RVKWVRMLYSDFSTFARDQERLISLNGRKQRNALDYLEGSLMLNQGPPDNWRSSFFPQSS  298

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            H    + + K    ++YCLE++ +Y  +   +T+ K+ E L  GL +     FE +VSY+
Sbjct  299  HSRIVSLVTKRG--IIYCLEVSKYYDEHTE-TTVKKELELLFKGLSFLPGFLFEKDVSYV  355

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV+ GEE   + G WD PHPWLNLFI
Sbjct  356  DFLNRVRSGEEKLHSQGQWDVPHPWLNLFI  385



>ref|XP_002534458.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF27923.1| gulonolactone oxidase, putative [Ricinus communis]
Length=540

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 127/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G++  CSE  N++LFY  LGGLGQFGIITRAR+ L+ AP 
Sbjct  203  AFQHGPQINNVYQLEIVTGKGEVLTCSEQLNADLFYGALGGLGQFGIITRARISLERAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             VRWIRV+Y+ F  F+ D E L+  + SFDY+EGFV +N    +N W +   N    L  
Sbjct  263  RVRWIRVLYAEFSKFSNDQEHLIASENSFDYIEGFVIINRTGLLNNWRS-SFNPKDPLQA  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A ++   D    +N+K E L+ GL Y     F   VSY+ FL R
Sbjct  322  SQFISD-GRTLYCLEIAKYFNPEDF-DIMNQKTEDLLSGLSYIPSTLFLSEVSYVEFLDR  379

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPW+NL I
Sbjct  380  VHVSEMKLRAEGLWEVPHPWMNLLI  404



>ref|XP_003534375.1| PREDICTED: cytokinin dehydrogenase 6-like [Glycine max]
Length=534

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV +LE+VTG G++  CS  +N +LF+ VLGGLGQFGIITRAR++L+PAP M
Sbjct  194  FRHGPQISNVQQLEIVTGTGEVLNCSAENNGDLFHGVLGGLGQFGIITRARIVLEPAPTM  253

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            V+WIRV+YS F  FT+D E L++ +++FDY+EGFV +N    +N W  +  N    +  +
Sbjct  254  VKWIRVLYSDFTAFTRDQERLISAEKTFDYIEGFVIINRTGLLNNWR-LSFNPRDPVQAS  312

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
            +   D G  L+CLEMA  Y N +     N++ E  +  L Y     F   V++++FL RV
Sbjct  313  HFKSD-GRTLFCLEMA-KYLNVEEIDAANQEVEEHLSRLSYIPSTLFSTEVTFVDFLDRV  370

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   R+ G WD PHPWLNL I
Sbjct  371  HISEVKLRSKGLWDVPHPWLNLLI  394



>ref|XP_008445865.1| PREDICTED: cytokinin dehydrogenase 6 [Cucumis melo]
Length=547

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 134/205 (65%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG GD+  CS+  NS+LFYSVLGGLGQFGIITRA+++L+PAP 
Sbjct  206  AFRHGPQISNVHQLEIVTGKGDVVNCSKEQNSDLFYSVLGGLGQFGIITRAKILLEPAPT  265

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y  F  F+++ E L++   +FDY+EGFV +N    +N W +   N    +  
Sbjct  266  MVKWIRVLYLDFTTFSREQELLISAQNTFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  324

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G +LYCLE+A ++ + +  + I+++  RL+  L Y     F   V+Y+ FL R
Sbjct  325  SQFKSD-GKILYCLELAKYFHHTEG-NIIDQEVMRLLSQLSYIPSTLFISEVTYVEFLDR  382

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V+      ++ G W+ PHPWLNL I
Sbjct  383  VQVSAVKLQSKGLWEVPHPWLNLLI  407



>gb|KHN17264.1| Cytokinin dehydrogenase 7 [Glycine soja]
Length=286

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 111/148 (75%), Gaps = 5/148 (3%)
 Frame = +2

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES--FDYVEGFVFVNSDDPVNGWSTVPLNSDHQL  355
            MVRWIRV+YS F  FT+DAE LVT  E   FDYVEGFV VNSDDP NGW   P   +   
Sbjct  1    MVRWIRVLYSEFAHFTRDAEWLVTLPEGDGFDYVEGFVLVNSDDPCNGWIMGP---NQYF  57

Query  356  NPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFL  535
            +P  IP  AGP+LYCLE+ALHY+N DHPS ++ + +RL+G LR+ + L+F V+V+YM FL
Sbjct  58   DPLRIPSAAGPLLYCLELALHYRNQDHPSAVDMEVDRLLGRLRFVEGLKFCVDVTYMEFL  117

Query  536  LRVKKGEEHARANGTWDTPHPWLNLFIS  619
            LRVK+ EE A+ANG WD PHPWLN+F+S
Sbjct  118  LRVKRVEEDAKANGIWDAPHPWLNMFVS  145



>ref|XP_004295395.2| PREDICTED: cytokinin dehydrogenase 6-like [Fragaria vesca subsp. 
vesca]
Length=525

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 128/205 (62%), Gaps = 2/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +L+VVTG G+I  CSE  N +LF+ VLGGLGQFGIITRAR++L+ AP 
Sbjct  182  AFRHGPQISNVHQLQVVTGKGEIVTCSEKQNHDLFHGVLGGLGQFGIITRARILLEAAPA  241

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  FT+D E L++   +F+YVEGFV +N    +N W +   +    +  
Sbjct  242  RVKWIRVLYSDFTAFTRDQEHLISIQNTFNYVEGFVIINRTGLLNNWRSYSFSPKDPVQA  301

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A  Y N D    IN++ ++L+  L Y     F   V+Y +FL R
Sbjct  302  SQFKSD-GRTLYCLELA-KYFNLDKTDIINQEVDKLLSQLSYIPSTLFVSQVTYTDFLDR  359

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+   WD PHPW+NL I
Sbjct  360  VHVSEMKLRSKHLWDIPHPWINLLI  384



>ref|XP_007008757.1| Cytokinin oxidase/dehydrogenase 6 isoform 1 [Theobroma cacao]
 gb|EOY17567.1| Cytokinin oxidase/dehydrogenase 6 isoform 1 [Theobroma cacao]
Length=530

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  NS+LFYSVLGGLGQFGIITRAR+ L+PAP+
Sbjct  189  AFRHGPQISNVHQLEVVTGKGEVVNCSEKQNSDLFYSVLGGLGQFGIITRARISLEPAPE  248

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y+ F  F +D E L++ + +FDY+EGFV +N    +N W +   N    +  
Sbjct  249  MVKWIRVLYTDFATFARDQEKLISGESTFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  307

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N +  + +N++ +  +  L +     F   V Y+ FL R
Sbjct  308  SQFKSD-GRTLFCLELA-KYFNPEEMAVVNQEIKNSLSQLNHIPSTLFMSEVPYIEFLDR  365

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL +
Sbjct  366  VHISEIKLRSKGLWEVPHPWLNLLV  390



>ref|XP_010106427.1| Cytokinin dehydrogenase 1 [Morus notabilis]
 gb|EXC10466.1| Cytokinin dehydrogenase 1 [Morus notabilis]
Length=517

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ SNV +LEVVTG GD+  CS+  N +LF+SVLGGLGQFGIITRAR+ L+ AP 
Sbjct  170  AFQHGPQISNVHQLEVVTGKGDVVNCSKEENEDLFHSVLGGLGQFGIITRARISLESAPA  229

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            +V+WIRV+YS F  FT+D E L++ + +FDY+EGFV +N    +N W +     D     
Sbjct  230  IVKWIRVLYSDFAMFTRDQEWLISAENTFDYIEGFVIINRTGLLNNWRSSFNPQDPAQAG  289

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  L+CLE+A  Y N D     N++ E L+G L Y     F+  V+Y+ FL R
Sbjct  290  QF--KSDGRTLFCLELA-KYFNPDETEMANQEVEILLGQLNYISSTLFQSEVTYVEFLDR  346

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL I
Sbjct  347  VHISEVKLRSKGLWEVPHPWLNLLI  371



>ref|XP_002876723.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52982.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=528

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 125/205 (61%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LE+VTG G+I  CS+  NS+LF  VLGGLGQFGIITRAR+ L+PAP 
Sbjct  187  AFRHGPQISNVHQLEIVTGKGEILNCSKRQNSDLFDGVLGGLGQFGIITRARIALEPAPT  246

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+Y  F  F +D E L++ D  FDY+EGFV +N    +N W  +    +  L  
Sbjct  247  MVKWIRVLYLDFSAFAKDQEQLISADNKFDYIEGFVIINRTGLLNNWR-LSFTPEEPLEA  305

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLE+A  Y   D+   IN++ +  +  L Y     F   V+Y  FL R
Sbjct  306  SQFKSD-GRTLYCLELA-KYLKQDNKDVINQEVKETLSELSYVSSTLFSTEVTYEAFLDR  363

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL +
Sbjct  364  VHVSEVKLRSKGQWEVPHPWLNLLV  388



>gb|AAO50082.1| cytokinin dehydrogenase 3 [Hordeum vulgare]
Length=520

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 127/204 (62%), Gaps = 4/204 (2%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   NS+LF++ LGGLGQFGIITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGRGDIITCSPEQNSDLFHAALGGLGQFGIITRARIALEPAPQM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+Y  F   T+D E L++ +++FDY+EGFV +N    +N W +   N       +
Sbjct  241  VRWIRVLYLDFMSLTEDQEMLISAEKTFDYIEGFVSINRTGILNNWRS-SFNPQDPERAS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D   VL+CLEM  ++  N   + I ++   L+  LRY     F  +V+YM FL RV
Sbjct  300  QFETDRK-VLFCLEMTKNF--NPEEAGIMEQIHALLSQLRYTPPSLFHTDVTYMEFLDRV  356

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLNL I
Sbjct  357  HSSEIKLRAKGLWEVPHPWLNLII  380



>ref|XP_008244287.1| PREDICTED: cytokinin dehydrogenase 1 [Prunus mume]
Length=545

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 130/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +LEVVTG G++  CSE ++ +LFY VLGGLGQFGIIT+AR+ L+PAP 
Sbjct  204  AFRHGPQINNVYQLEVVTGQGEVITCSENNSPDLFYGVLGGLGQFGIITQARISLEPAPK  263

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L++ + SFDY+EGFV +N    +N W +   N    +  
Sbjct  264  MVKWIRVLYSDFSSFSKDQEFLISSENSFDYIEGFVIINRTGLLNNWRS-SFNPKDPMQA  322

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N +    ++++ E L+  L Y     F   VSY+ FL R
Sbjct  323  SKFNSD-GRTLYCLEMA-KYFNPNETDVMDQRTESLLLLLHYIPSTLFLSEVSYVEFLDR  380

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G W+ PHPW+NL I
Sbjct  381  VHLSEIKLRTKGLWEVPHPWMNLLI  405



>gb|KDP40485.1| hypothetical protein JCGZ_24484 [Jatropha curcas]
Length=503

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N +LF+ VLGGLGQFGIITRA++ L+PAPD
Sbjct  162  AFRHGPQISNVYQLEVVTGKGEVVNCSEKQNGDLFHGVLGGLGQFGIITRAQISLEPAPD  221

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  F  D E L++ + +FDY+EGFV +N    +N W +   N    +  
Sbjct  222  KVKWIRVLYSDFATFASDQEHLISAEITFDYIEGFVIINRTGLLNNWRS-SFNPQDPVQA  280

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N D    +N++ + L+  LRY     F   V Y+ FL R
Sbjct  281  SQFESD-GRTLFCLELA-KYFNTDKTDVMNEEVKLLLSQLRYIPSTLFLSEVPYVEFLDR  338

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+ G W+ PHPWLNL +
Sbjct  339  VHVSEVKLRSKGLWEVPHPWLNLLV  363



>gb|KHN11723.1| Cytokinin dehydrogenase 6 [Glycine soja]
Length=534

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV +LE+VTG G++  CS  +N +LF+ VLGGLGQFGIITRAR++L+PAP M
Sbjct  194  FRHGPQISNVQQLEIVTGTGEVLNCSAENNGDLFHGVLGGLGQFGIITRARIVLEPAPTM  253

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            V+WIRV+YS F  FT+D E L++ +++FDY+EGFV +N    +N W  +  N    +  +
Sbjct  254  VKWIRVLYSDFTAFTRDQERLISAEKTFDYIEGFVIINRTGLLNNWR-LSFNPRDPVQAS  312

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
            +   D G  L+CLEMA  Y N +     N++ E  +  L Y     F   V++++FL RV
Sbjct  313  HFKSD-GRTLFCLEMA-KYFNVEEIDAANQEVEEHLSRLSYIPSTLFSTEVTFVDFLDRV  370

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   R+ G WD PHPWLNL I
Sbjct  371  HISEVKLRSKGLWDVPHPWLNLLI  394



>ref|XP_009354403.1| PREDICTED: cytokinin dehydrogenase 6-like [Pyrus x bretschneideri]
Length=529

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 129/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N +LF+SVLGGLGQFGIITRAR+ L+ AP 
Sbjct  188  AFRHGPQISNVHQLEVVTGKGEVVNCSEEQNEDLFHSVLGGLGQFGIITRARISLEAAPA  247

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  FTQD E L++ + +FDY+EGFV +N    +N W +   NS   +  
Sbjct  248  RVKWIRVLYSDFTAFTQDQEHLMSAENTFDYIEGFVIINRTGLLNNWRS-SFNSKDPVQA  306

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N D    I+ + E  +  L Y +   F   V+Y++FL R
Sbjct  307  SQFKSD-GKTLFCLELA-KYFNLDKTKIIDAEIENSLSQLSYIRSTLFLSEVAYIDFLDR  364

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+   WD PHPWLNL I
Sbjct  365  VHVSEIKLRSKDLWDVPHPWLNLLI  389



>gb|AAM08400.2|AF490591_1 cytokinin dehydrogenase 2 [Hordeum vulgare]
Length=526

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 126/204 (62%), Gaps = 3/204 (1%)
 Frame = +2

Query  5    FRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPDM  184
            FR GPQ SNV ELE+VTG GDI  CS   NS+LF + LGGLGQFGIITRAR+ L+PAP M
Sbjct  181  FRHGPQISNVNELEIVTGRGDIVTCSPEQNSDLFRAALGGLGQFGIITRARIALEPAPQM  240

Query  185  VRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNPT  364
            VRWIRV+Y  F   T+D E L++ +++FDY+EGFV +N    +N W +   N       +
Sbjct  241  VRWIRVLYLDFMSLTEDQEMLISAEKTFDYIEGFVIINRTGILNNWRS-SFNPQDPERAS  299

Query  365  YIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLRV  544
                D   VL+CLEM  ++ N +    + ++   L+  LRY     F  +V+Y+ FL RV
Sbjct  300  RFETDR-KVLFCLEMTKNF-NPEEADIMEQEVHALLSQLRYTPASLFHTDVTYIEFLDRV  357

Query  545  KKGEEHARANGTWDTPHPWLNLFI  616
               E   RA G W+ PHPWLNL I
Sbjct  358  HSSEMKLRAKGLWEVPHPWLNLII  381



>gb|EYU20769.1| hypothetical protein MIMGU_mgv1a022053mg [Erythranthe guttata]
Length=547

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 131/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ  NV +L+VVTG G++  CSE  N +LF+ VLGGLGQFGIIT+AR+ L+PAP 
Sbjct  204  AFRHGPQIDNVYQLQVVTGRGEVMTCSEKQNEDLFHGVLGGLGQFGIITKARIALEPAPR  263

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+W+R +YS F  FT D E L++ + SFDY+EGFV +N    +N W +     D  L  
Sbjct  264  MVKWVRALYSDFSTFTDDQEHLISSENSFDYIEGFVIINRTGLLNNWRSSFNPKDPILAN  323

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +I +  G VLYCLE+A ++   ++   I++  ++L+  L Y +   F   VSY++FL R
Sbjct  324  RFISE--GRVLYCLEVAKYFSPQEY-DHIDQDVDKLLSKLNYLRSTLFLSEVSYIDFLDR  380

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R  G W+ PHPWLNL +
Sbjct  381  VHVSEMKLREKGLWEVPHPWLNLLV  405



>ref|XP_008444755.1| PREDICTED: cytokinin dehydrogenase 5 [Cucumis melo]
Length=546

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 137/216 (63%), Gaps = 16/216 (7%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTGNG+I  CS   N+ELF+ VLGGLGQFGIITRAR++L+PAP 
Sbjct  191  AFNHGPQISNVHELDVVTGNGEIVKCSNEDNAELFHGVLGGLGQFGIITRARIILEPAPQ  250

Query  182  MVRWIRVVYSAFEDFTQDAESLVT------RDESFDYVEGFVFVNSDDPVNGWSTVPLNS  343
             VRWIRV+YS FE FT+D E L++        E FDYVEGFV V+ +  +N W +   + 
Sbjct  251  RVRWIRVLYSNFEAFTKDQEWLISLHSKTNSKEKFDYVEGFVIVD-EGLINNWRSSFFSP  309

Query  344  DHQLNPTYIP-----KDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFE  508
                NP  I      K  G VLYCLE+  +Y  +    T++++ E L+  L Y  +  F 
Sbjct  310  ---ANPVKISSFSKNKSDGAVLYCLEITKNYHESS-SHTLDQEVEALMKQLNYIPESVFT  365

Query  509  VNVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
             ++ Y++FL RV K E   R+ G WD PHPWLNLF+
Sbjct  366  TDLGYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFV  401



>ref|XP_004303072.1| PREDICTED: cytokinin dehydrogenase 6-like [Fragaria vesca subsp. 
vesca]
Length=529

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 128/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G+I  CSE  N +LF+ VLGGLGQFGIITRAR++L+ AP 
Sbjct  188  AFRHGPQISNVRQLEVVTGKGEIVTCSEKQNDDLFHGVLGGLGQFGIITRARILLEAAPA  247

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  FT+D E L++ + +F+YVEGFV +N    +N W +     D     
Sbjct  248  RVKWIRVLYSDFTAFTRDQEYLISGENTFNYVEGFVIINRTRLLNNWRSSFSPKDPVQAS  307

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+A  Y N D    IN++ ++L+  L Y     F   V+Y +FL R
Sbjct  308  QF--KSDGRTLYCLELA-KYFNLDKTDIINQEVDKLLSKLSYIPSTLFVSEVTYTDFLDR  364

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+   WD PHPWLNL I
Sbjct  365  VHVSEMKLRSKDLWDIPHPWLNLLI  389



>ref|XP_007162153.1| hypothetical protein PHAVU_001G128800g [Phaseolus vulgaris]
 gb|ESW34147.1| hypothetical protein PHAVU_001G128800g [Phaseolus vulgaris]
Length=572

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 127/205 (62%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEV+TG G++  CS   N++LF+ VLGGLGQFGIITRAR+ L+ AP 
Sbjct  230  AFKHGPQINNIFQLEVITGKGEVVTCSGNRNADLFHGVLGGLGQFGIITRARISLETAPK  289

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++   +FDY+EGFV +N    +N W +   +    L  
Sbjct  290  MVKWIRVLYSEFSTFTKDQEHLISLKNTFDYIEGFVIINKTGILNNWRS-SFDPKSPLQA  348

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G   YCLEMA  Y N D    +N+    L+  L Y +   F   VSY+ FL R
Sbjct  349  SQFNSD-GRTFYCLEMA-KYFNPDEAELMNQSINHLLSKLSYIQPTLFRSEVSYVEFLDR  406

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E+  RA G W+ PHPWLNL I
Sbjct  407  VHVSEKKLRAKGLWEVPHPWLNLLI  431



>ref|XP_006604338.1| PREDICTED: cytokinin dehydrogenase 1-like isoform X2 [Glycine 
max]
Length=543

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 129/205 (63%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEV+TG  ++  CS   N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIFQLEVITG--EVVTCSGNRNADLFYGVLGGLGQFGIITRARISLEPAPM  260

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT D E L++ + +FDY+EGFV +N    +N W +   +  + L  
Sbjct  261  MVKWIRVLYSEFSTFTMDQEYLISLNNTFDYIEGFVIINRTGILNNWRS-SFDPKNPLQA  319

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  LYCLEMA  Y N D    +N+  ++L+  L Y     F   VSY+ FL R
Sbjct  320  SQFSSD-GKTLYCLEMA-KYFNPDEAEAMNQSVDQLLSKLSYIPSTLFLSEVSYVEFLDR  377

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G W+ PHPWLNL I
Sbjct  378  VHVSENKLRAQGLWEVPHPWLNLLI  402



>ref|XP_009142753.1| PREDICTED: cytokinin dehydrogenase 1-like [Brassica rapa]
Length=533

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +NV +LE+VTG G+   CS+  N ELF+SVLGGLGQFGIITRAR+ L PAP 
Sbjct  192  AFKHGPQINNVYQLEIVTGKGEAVTCSKKLNPELFHSVLGGLGQFGIITRARISLGPAPH  251

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  F++D E L+++ + FD+VEG V +N  + +N W +    +D     
Sbjct  252  MVKWIRVLYSDFSTFSRDQEHLISKKKGFDFVEGSVTINRTELLNNWRSSFTPNDSTEAS  311

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +  K  G  LYCLE+ + Y N +  +++N++ E+L+  L Y     F   V Y+ FL R
Sbjct  312  QF--KSDGKTLYCLEV-VKYFNKEEANSMNQETEKLLSELSYIPSTLFSSVVPYIEFLDR  368

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V  GE   RA G W+ PHPWLNL +
Sbjct  369  VHLGEIKLRAKGLWEVPHPWLNLLV  393



>ref|XP_009335765.1| PREDICTED: cytokinin dehydrogenase 5 [Pyrus x bretschneideri]
Length=538

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 135/210 (64%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF +GPQ SNV EL+VVTG G +  CSE  NSELF++VLGGLGQFGIITRAR+ L+P+P 
Sbjct  180  AFNYGPQISNVHELDVVTGKGQLLTCSEEQNSELFHAVLGGLGQFGIITRARIALEPSPQ  239

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E L++       + FDYVEGFV V+ +  +N W +   +  
Sbjct  240  RVRWIRVLYSNFSAFTKDQEFLISLHGQPSSQKFDYVEGFVIVD-EGLINNWRSSFFSPS  298

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + +  T I  + G VLYCLE+  +Y +      I+K+ E L+  L +     F  ++ Y+
Sbjct  299  NPVKITSIDSEGG-VLYCLEITKNY-DESTADAIDKEIEDLLEKLNFVPTSVFTTDLPYV  356

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV K E   R+ G WD PHPWLNLF+
Sbjct  357  DFLDRVHKAELKLRSKGLWDVPHPWLNLFV  386



>ref|XP_008375236.1| PREDICTED: cytokinin dehydrogenase 6-like [Malus domestica]
Length=529

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 129/205 (63%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ SNV +LEVVTG G++  CSE  N +LF+SVLGGLGQFGIITRAR+ L+ AP 
Sbjct  188  AFRHGPQISNVHQLEVVTGKGEVVNCSEEQNEDLFHSVLGGLGQFGIITRARIFLEAAPA  247

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
             V+WIRV+YS F  FTQD E L++ + +FDY+EGFV +N    +N W +   NS   +  
Sbjct  248  RVKWIRVLYSDFTAFTQDQEHLMSAENTFDYIEGFVIINRTGLLNNWRS-SFNSKDPVQA  306

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G  L+CLE+A  Y N D    I ++ +  +  L Y +   F   V+Y++FL R
Sbjct  307  SQFKSD-GKTLFCLELA-KYFNLDKXDLITEEVDNSLSQLSYIRSTLFVSEVAYIDFLDR  364

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   R+   WD PHPWLNL I
Sbjct  365  VHVSEIKLRSKDLWDVPHPWLNLLI  389



>gb|KJB58187.1| hypothetical protein B456_009G198300 [Gossypium raimondii]
Length=531

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 138/210 (66%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTG G++  CSE  NSE+F++VLGGLGQFGIITRAR+ L+PAP 
Sbjct  183  AFNHGPQISNVHELDVVTGKGELLTCSEEQNSEMFHAVLGGLGQFGIITRARISLEPAPQ  242

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDES-----FDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E L++  E      FDYVEGFV V+ +  +N W +   +  
Sbjct  243  RVRWIRVLYSNFSTFTRDQEYLISLHEQPASQKFDYVEGFVIVD-EGLINNWRSSFFSPH  301

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + +  + +  + G VLYCLE+A +Y  +   STI+++ E L+  L +     F  ++ Y+
Sbjct  302  NPVKISSLEPNGG-VLYCLEIAKNYHEST-ASTIDQEVESLLKKLNFIPASVFTTDMPYV  359

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV K E   R+ G W+ PHPWLNLF+
Sbjct  360  DFLDRVHKAELKLRSKGLWEVPHPWLNLFV  389



>emb|CDP14175.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 131/215 (61%), Gaps = 23/215 (11%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AFR GPQ +NV +LEVVTG G++  CS+  NS+LF+ VLGGLGQFGIITRAR+ L PAP 
Sbjct  96   AFRHGPQINNVHQLEVVTGTGEVVRCSDDENSDLFHGVLGGLGQFGIITRARIALGPAPT  155

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E L++   SFDY+EGFV +N    VN W +           
Sbjct  156  MVKWIRVLYSDFSIFTEDQEFLISSQNSFDYIEGFVIINRTGLVNDWQS-----------  204

Query  362  TYIPKD---------AGPVLYCLEMALH-YKNNDHPSTINKKAERLVGGLRYCKKLRFEV  511
            ++ PKD          G VL+CLE+A + Y  N++   +N+  E ++  L Y     F+ 
Sbjct  205  SFSPKDPVRSSQLQSEGKVLFCLEVAKYLYPENNY--DVNQNIETILSELNYIPSTLFQS  262

Query  512  NVSYMNFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
             V Y+ FL RV   E   R  G W+ PHPWLNL +
Sbjct  263  EVPYVQFLDRVHISEMKLRKKGLWEIPHPWLNLLV  297



>ref|XP_009408782.1| PREDICTED: cytokinin dehydrogenase 5-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 136/210 (65%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF  GPQ SNV EL+VVTG G++  CSE  NSELF+ VLGGLGQFGIITRAR+ L+ AP 
Sbjct  180  AFHHGPQISNVYELDVVTGKGELITCSEEQNSELFHGVLGGLGQFGIITRARIALETAPH  239

Query  182  MVRWIRVVYSAFEDFTQDAESLVT-----RDESFDYVEGFVFVNSDDPVNGWSTVPLNSD  346
             VRWIRV+YS F  FT+D E LV+     R E FDYVEGFV V+ +  +N W +   +  
Sbjct  240  RVRWIRVLYSDFAAFTRDQELLVSLHGAHRSERFDYVEGFVIVD-EGLINNWRSSFFSPK  298

Query  347  HQLNPTYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYM  526
            + +  + +  +AG +LYCLEM  +Y ++    +I++  E L+G L Y     F  ++ Y+
Sbjct  299  NPVKISSVHANAG-LLYCLEMTKNY-DSSAADSIDEVVEALLGQLGYIPASVFTTDLPYV  356

Query  527  NFLLRVKKGEEHARANGTWDTPHPWLNLFI  616
            +FL RV K E   RA G W  PHPWLNLF+
Sbjct  357  DFLDRVHKAEMRLRAKGLWAVPHPWLNLFV  386



>ref|XP_002308930.2| hypothetical protein POPTR_0006s04650g [Populus trichocarpa]
 gb|EEE92453.2| hypothetical protein POPTR_0006s04650g [Populus trichocarpa]
Length=539

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 127/205 (62%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEVVTG G+   CSE  N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIYQLEVVTGKGEAVTCSENKNADLFYGVLGGLGQFGIITRARISLEPAPK  262

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIR +Y  F  F+ D E L++++ SFDY+EG V +N    +N W +     D     
Sbjct  263  MVKWIRALYDEFSKFSSDQEHLISKN-SFDYIEGLVIINRTGLLNNWRSSFNPKDPLQAS  321

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
             +I +  G  LYCLE+A  Y N +    +N++ E L+  L Y     F   VSY+ FL R
Sbjct  322  QFISE--GKTLYCLEIA-KYFNPNESDAMNQETESLLSELSYIPSTLFLSEVSYVEFLDR  378

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E   RA G WD PHPWLNL I
Sbjct  379  VHLSEIKLRAKGLWDIPHPWLNLLI  403



>ref|XP_006576244.1| PREDICTED: cytokinin dehydrogenase 1-like isoform X1 [Glycine 
max]
Length=543

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 128/205 (62%), Gaps = 5/205 (2%)
 Frame = +2

Query  2    AFRFGPQTSNVTELEVVTGNGDIAVCSETHNSELFYSVLGGLGQFGIITRARVMLQPAPD  181
            AF+ GPQ +N+ +LEV+TG  ++  CS   N++LFY VLGGLGQFGIITRAR+ L+PAP 
Sbjct  203  AFKHGPQINNIFQLEVITG--EVVTCSGNRNADLFYGVLGGLGQFGIITRARISLEPAPK  260

Query  182  MVRWIRVVYSAFEDFTQDAESLVTRDESFDYVEGFVFVNSDDPVNGWSTVPLNSDHQLNP  361
            MV+WIRV+YS F  FT+D E LV+ + +FDY+EGFV +N    +N W +   +  +QL  
Sbjct  261  MVKWIRVLYSEFSTFTRDQEYLVSLNNTFDYIEGFVIINRTGILNNWRS-SFDPKNQLQA  319

Query  362  TYIPKDAGPVLYCLEMALHYKNNDHPSTINKKAERLVGGLRYCKKLRFEVNVSYMNFLLR  541
            +    D G   YCLEMA  Y N      +N+    L+  L Y     F   VSY+ FL R
Sbjct  320  SQFSSD-GKTFYCLEMA-KYFNPGEAEAMNQSVAYLLSKLSYIPSTLFLSEVSYVEFLDR  377

Query  542  VKKGEEHARANGTWDTPHPWLNLFI  616
            V   E+  RA G W+ PHPWLNL I
Sbjct  378  VHVSEKKLRAQGLWEVPHPWLNLLI  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520