BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018C12 434 bp,:Filtered

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002862422.1|  predicted protein                                46.2    4e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_009588083.1|  PREDICTED: exocyst complex component SEC8        48.9    5e-04   Nicotiana tomentosiformis
ref|XP_010942478.1|  PREDICTED: exocyst complex component SEC8 is...  48.9    6e-04   Elaeis guineensis
ref|XP_009122941.1|  PREDICTED: exocyst complex component SEC8-li...  48.5    6e-04   Brassica rapa
ref|XP_010942477.1|  PREDICTED: exocyst complex component SEC8 is...  48.9    6e-04   Elaeis guineensis
ref|XP_007218908.1|  hypothetical protein PRUPE_ppa000625mg           48.5    6e-04   Prunus persica
ref|XP_008233277.1|  PREDICTED: exocyst complex component SEC8        48.5    6e-04   Prunus mume [ume]
ref|XP_009122939.1|  PREDICTED: exocyst complex component SEC8-li...  48.5    7e-04   Brassica rapa
emb|CDY41338.1|  BnaA01g31810D                                        48.5    7e-04   Brassica napus [oilseed rape]
emb|CDY56705.1|  BnaC01g38640D                                        48.5    7e-04   Brassica napus [oilseed rape]
ref|XP_009146846.1|  PREDICTED: exocyst complex component SEC8        48.1    8e-04   Brassica rapa
emb|CDY08608.1|  BnaA05g28440D                                        48.1    8e-04   Brassica napus [oilseed rape]



>ref|XP_002862422.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38680.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  6    AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
             EYS+LL+V VPGRD P+DA++RL EIL H
Sbjct  73   TEYSNLLKVNVPGRDTPSDAQSRLLEILSH  102



>ref|XP_009588083.1| PREDICTED: exocyst complex component SEC8 [Nicotiana tomentosiformis]
 ref|XP_009588084.1| PREDICTED: exocyst complex component SEC8 [Nicotiana tomentosiformis]
Length=1071

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  6     AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
             AEYS LL+VQVPGR+IPADA+ R++EIL H
Sbjct  1042  AEYSDLLKVQVPGREIPADAQDRVAEILPH  1071



>ref|XP_010942478.1| PREDICTED: exocyst complex component SEC8 isoform X2 [Elaeis 
guineensis]
Length=1076

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  9     EYSSLLRVQVPGRDIPADAEARLSEIL  89
             EYSSLL++ VPGR+IPADAE RLSEIL
Sbjct  1048  EYSSLLKISVPGREIPADAEQRLSEIL  1074



>ref|XP_009122941.1| PREDICTED: exocyst complex component SEC8-like isoform X2 [Brassica 
rapa]
Length=839

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  6    AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
             EYS+LL+V VPGRD P DA++RLSEIL H
Sbjct  810  TEYSNLLKVNVPGRDTPTDAQSRLSEILSH  839



>ref|XP_010942477.1| PREDICTED: exocyst complex component SEC8 isoform X1 [Elaeis 
guineensis]
Length=1106

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  9     EYSSLLRVQVPGRDIPADAEARLSEIL  89
             EYSSLL++ VPGR+IPADAE RLSEIL
Sbjct  1078  EYSSLLKISVPGREIPADAEQRLSEIL  1104



>ref|XP_007218908.1| hypothetical protein PRUPE_ppa000625mg [Prunus persica]
 gb|EMJ20107.1| hypothetical protein PRUPE_ppa000625mg [Prunus persica]
Length=1063

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  3     NAEYSSLLRVQVPGRDIPADAEARLSEIL  89
              +EY++LL+VQVPGRDIPADA+ R+SEIL
Sbjct  1033  TSEYANLLKVQVPGRDIPADAQDRVSEIL  1061



>ref|XP_008233277.1| PREDICTED: exocyst complex component SEC8 [Prunus mume]
Length=1063

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  3     NAEYSSLLRVQVPGRDIPADAEARLSEIL  89
              +EY++LL+VQVPGRDIPADA+ R+SEIL
Sbjct  1033  TSEYANLLKVQVPGRDIPADAQDRVSEIL  1061



>ref|XP_009122939.1| PREDICTED: exocyst complex component SEC8-like isoform X1 [Brassica 
rapa]
Length=1045

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  6     AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
              EYS+LL+V VPGRD P DA++RLSEIL H
Sbjct  1016  TEYSNLLKVNVPGRDTPTDAQSRLSEILSH  1045



>emb|CDY41338.1| BnaA01g31810D [Brassica napus]
Length=1079

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  6     AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
              EYS+LL+V VPGRD P DA++RLSEIL H
Sbjct  1050  TEYSNLLKVNVPGRDTPTDAQSRLSEILSH  1079



>emb|CDY56705.1| BnaC01g38640D [Brassica napus]
Length=1078

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  6     AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
              EYS+LL+V VPGRD P DA++RLSEIL H
Sbjct  1049  TEYSNLLKVNVPGRDTPTDAQSRLSEILSH  1078



>ref|XP_009146846.1| PREDICTED: exocyst complex component SEC8 [Brassica rapa]
Length=1055

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  6     AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
              EYS+LL+V VPGRD P+DA+ RLSEIL H
Sbjct  1026  TEYSNLLKVNVPGRDTPSDAQVRLSEILSH  1055



>emb|CDY08608.1| BnaA05g28440D [Brassica napus]
Length=1055

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  6     AEYSSLLRVQVPGRDIPADAEARLSEILLH  95
              EYS+LL+V VPGRD P+DA+ RLSEIL H
Sbjct  1026  TEYSNLLKVNVPGRDTPSDAQVRLSEILSH  1055



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800