BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018C11 630 bp,

Length=596
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758756.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            177   6e-49   Nicotiana sylvestris
ref|XP_009615220.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            175   4e-48   Nicotiana tomentosiformis
ref|XP_011046083.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    169   6e-46   Populus euphratica
ref|XP_006372628.1|  proton-dependent oligopeptide transport fami...    169   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_003633812.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            168   2e-45   Vitis vinifera
emb|CBI34989.3|  unnamed protein product                                168   3e-45   Vitis vinifera
emb|CDP02164.1|  unnamed protein product                                166   8e-45   Coffea canephora [robusta coffee]
ref|XP_007032332.1|  Amino acid permease, putative isoform 1            166   1e-44   Theobroma cacao [chocolate]
ref|XP_006338515.1|  PREDICTED: probable peptide/nitrate transpor...    166   2e-44   Solanum tuberosum [potatoes]
ref|XP_004232263.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       165   2e-44   Solanum lycopersicum
ref|XP_002305027.1|  proton-dependent oligopeptide transport fami...    165   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011035394.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       165   3e-44   Populus euphratica
gb|KJB33723.1|  hypothetical protein B456_006G027600                    165   3e-44   Gossypium raimondii
ref|XP_006446423.1|  hypothetical protein CICLE_v10014849mg             164   4e-44   Citrus clementina
gb|KHG28522.1|  hypothetical protein F383_09980                         164   7e-44   Gossypium arboreum [tree cotton]
gb|KJB75802.1|  hypothetical protein B456_012G058600                    163   1e-43   Gossypium raimondii
ref|XP_007215636.1|  hypothetical protein PRUPE_ppa003862mg             163   1e-43   Prunus persica
ref|XP_008230677.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            163   2e-43   Prunus mume [ume]
ref|XP_010696018.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    162   3e-43   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010696017.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    162   4e-43   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KDP45420.1|  hypothetical protein JCGZ_09669                         160   1e-42   Jatropha curcas
ref|XP_008341498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            160   2e-42   Malus domestica [apple tree]
ref|XP_011098534.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       157   1e-41   Sesamum indicum [beniseed]
ref|XP_010272076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       158   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_004147481.1|  PREDICTED: probable peptide/nitrate transpor...    156   5e-41   Cucumis sativus [cucumbers]
ref|XP_002517413.1|  amino acid permease, putative                      155   6e-41   Ricinus communis
ref|XP_008365497.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       155   8e-41   Malus domestica [apple tree]
ref|XP_010091949.1|  Putative peptide/nitrate transporter               155   8e-41   Morus notabilis
ref|XP_008357888.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    155   1e-40   
ref|XP_008443465.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       154   3e-40   Cucumis melo [Oriental melon]
ref|XP_009335771.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       154   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_008347950.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    150   7e-39   Malus domestica [apple tree]
ref|XP_008348207.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    150   8e-39   Malus domestica [apple tree]
ref|XP_004489344.1|  PREDICTED: probable peptide/nitrate transpor...    144   8e-37   Cicer arietinum [garbanzo]
ref|XP_004296558.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       142   3e-36   Fragaria vesca subsp. vesca
ref|XP_010255307.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       141   7e-36   Nelumbo nucifera [Indian lotus]
ref|NP_186784.1|  putative peptide/nitrate transporter                  137   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485501.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       137   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010463532.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9            137   4e-34   Camelina sativa [gold-of-pleasure]
gb|EYU44686.1|  hypothetical protein MIMGU_mgv1a004892mg                136   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_010498082.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like...    137   5e-34   Camelina sativa [gold-of-pleasure]
gb|KHG25623.1|  hypothetical protein F383_02486                         136   5e-34   Gossypium arboreum [tree cotton]
ref|XP_010486758.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like...    137   5e-34   Camelina sativa [gold-of-pleasure]
emb|CDY49047.1|  BnaC05g48750D                                          136   6e-34   Brassica napus [oilseed rape]
emb|CDY37529.1|  BnaA05g33940D                                          136   6e-34   Brassica napus [oilseed rape]
gb|KFK25622.1|  hypothetical protein AALP_AA8G138600                    136   8e-34   Arabis alpina [alpine rockcress]
ref|XP_009147425.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9            135   9e-34   Brassica rapa
ref|XP_010492181.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010453501.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010550101.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9 isof...    135   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_006408493.1|  hypothetical protein EUTSA_v10020393mg             135   2e-33   Eutrema salsugineum
ref|XP_010033250.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            134   2e-33   Eucalyptus grandis [rose gum]
gb|KFK37592.1|  hypothetical protein AALP_AA3G003400                    134   2e-33   Arabis alpina [alpine rockcress]
ref|XP_006432899.1|  hypothetical protein CICLE_v10003886mg             132   9e-33   Citrus clementina
ref|XP_009108657.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       128   1e-32   Brassica rapa
ref|XP_006299737.1|  hypothetical protein CARUB_v10015930mg             133   2e-32   Capsella rubella
dbj|BAE98864.1|  oligopeptide transporter - like protein                130   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196998.1|  probable peptide/nitrate transporter                  130   9e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09902.1|  BnaC09g42590D                                          126   9e-32   Brassica napus [oilseed rape]
ref|XP_006400015.1|  hypothetical protein EUTSA_v10013156mg             130   1e-31   Eutrema salsugineum
ref|XP_003554136.1|  PREDICTED: probable peptide/nitrate transpor...    129   1e-31   Glycine max [soybeans]
gb|KHN34167.1|  Putative peptide/nitrate transporter                    129   1e-31   Glycine soja [wild soybean]
gb|KFK25731.1|  hypothetical protein AALP_AA8G152400                    129   1e-31   Arabis alpina [alpine rockcress]
ref|XP_002873698.1|  proton-dependent oligopeptide transport fami...    129   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009114672.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       127   2e-31   Brassica rapa
ref|XP_009121620.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       129   2e-31   Brassica rapa
gb|AES74588.2|  peptide/nitrate transporter plant-like protein          129   2e-31   Medicago truncatula
ref|XP_006287415.1|  hypothetical protein CARUB_v10000620mg             129   3e-31   Capsella rubella
emb|CDX85576.1|  BnaA02g02370D                                          128   3e-31   Brassica napus [oilseed rape]
ref|XP_010928216.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       128   4e-31   Elaeis guineensis
ref|XP_009126016.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            128   4e-31   Brassica rapa
emb|CDY65044.1|  BnaA10g29780D                                          127   6e-31   Brassica napus [oilseed rape]
dbj|BAF00457.1|  oligopeptide transporter - like protein                119   9e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70256.1|  BnaCnng67440D                                          126   2e-30   Brassica napus [oilseed rape]
ref|XP_010492315.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       126   3e-30   Camelina sativa [gold-of-pleasure]
emb|CDY69851.1|  BnaCnng65650D                                          126   3e-30   Brassica napus [oilseed rape]
ref|XP_010420140.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       125   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008793797.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    125   5e-30   Phoenix dactylifera
gb|EEE65415.1|  hypothetical protein OsJ_20762                          119   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010453622.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            125   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003543540.1|  PREDICTED: probable peptide/nitrate transpor...    124   7e-30   Glycine max [soybeans]
ref|XP_007151152.1|  hypothetical protein PHAVU_004G022300g             124   1e-29   Phaseolus vulgaris [French bean]
ref|XP_008798051.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       124   1e-29   Phoenix dactylifera
ref|XP_010913459.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    122   4e-29   Elaeis guineensis
ref|XP_009401528.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       122   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413863.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    122   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX91013.1|  BnaC02g05840D                                          114   1e-28   Brassica napus [oilseed rape]
gb|EAZ00313.1|  hypothetical protein OsI_22330                          117   3e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_006656833.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    120   4e-28   Oryza brachyantha
gb|KDO43629.1|  hypothetical protein CISIN_1g042477mg                   118   8e-28   Citrus sinensis [Valencia orange]
ref|XP_003618370.1|  Peptide transporter family                         119   9e-28   
ref|NP_001057261.1|  Os06g0239500                                       118   1e-27   
ref|XP_003560866.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            118   2e-27   Brachypodium distachyon [annual false brome]
gb|EMT07879.1|  Peptide transporter PTR5                                117   4e-27   Aegilops tauschii
ref|XP_009413865.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    117   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010420013.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       115   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_007032333.1|  Amino acid permease, putative isoform 2            114   3e-26   Theobroma cacao [chocolate]
ref|XP_006408492.1|  hypothetical protein EUTSA_v10020393mg             114   4e-26   Eutrema salsugineum
dbj|BAJ94556.1|  predicted protein                                      113   8e-26   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK01715.1|  predicted protein                                      113   8e-26   Hordeum vulgare subsp. vulgare [barley]
dbj|BAD37873.1|  putative oligopeptide transporter                      113   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010913458.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    108   5e-24   Elaeis guineensis
ref|XP_006856890.1|  hypothetical protein AMTR_s00055p00208320          107   1e-23   
ref|XP_004965110.1|  PREDICTED: probable peptide/nitrate transpor...    105   1e-22   Setaria italica
ref|XP_008658869.1|  PREDICTED: uncharacterized protein LOC100383...    102   1e-21   Zea mays [maize]
ref|XP_002438139.1|  hypothetical protein SORBIDRAFT_10g008670          100   3e-21   Sorghum bicolor [broomcorn]
ref|XP_004953900.1|  PREDICTED: LOW QUALITY PROTEIN: putative pep...    100   7e-21   Setaria italica
gb|AFW85190.1|  hypothetical protein ZEAMMB73_094848                  87.0    2e-18   Zea mays [maize]
gb|EAZ00312.1|  hypothetical protein OsI_22329                        90.5    2e-17   Oryza sativa Indica Group [Indian rice]
gb|EPS62614.1|  hypothetical protein M569_12174                       87.4    1e-16   Genlisea aurea
emb|CDP00908.1|  unnamed protein product                              80.9    3e-14   Coffea canephora [robusta coffee]
gb|AFK45252.1|  unknown                                               77.0    6e-14   Lotus japonicus
gb|ABK24896.1|  unknown                                               78.6    2e-13   Picea sitchensis
ref|XP_006403575.1|  hypothetical protein EUTSA_v10010617mg           75.9    2e-13   Eutrema salsugineum
ref|XP_010276617.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     77.8    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_006830430.1|  hypothetical protein AMTR_s00118p00123330        74.7    3e-13   
ref|XP_006420719.1|  hypothetical protein CICLE_v10006572mg           77.8    4e-13   Citrus clementina
ref|XP_006470865.1|  PREDICTED: probable peptide/nitrate transpor...  77.4    4e-13   Citrus sinensis [Valencia orange]
gb|KGN50307.1|  hypothetical protein Csa_5G167000                     76.3    5e-13   Cucumis sativus [cucumbers]
gb|AHA84209.1|  oligopeptide transporter-like protein                 77.0    5e-13   Phaseolus vulgaris [French bean]
gb|KHN06992.1|  Putative peptide/nitrate transporter                  77.0    6e-13   Glycine soja [wild soybean]
ref|XP_008437003.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    76.6    7e-13   Cucumis melo [Oriental melon]
ref|XP_006602614.1|  PREDICTED: putative peptide/nitrate transpor...  77.0    7e-13   Glycine max [soybeans]
ref|XP_006339007.1|  PREDICTED: probable peptide/nitrate transpor...  76.6    8e-13   Solanum tuberosum [potatoes]
ref|XP_007133765.1|  hypothetical protein PHAVU_011G207100g           76.6    8e-13   Phaseolus vulgaris [French bean]
gb|EPS64734.1|  hypothetical protein M569_10046                       74.3    9e-13   Genlisea aurea
ref|XP_006292507.1|  hypothetical protein CARUB_v10018737mg           76.3    1e-12   Capsella rubella
ref|XP_004143744.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  76.6    1e-12   
ref|XP_010262662.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          75.9    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006843060.1|  hypothetical protein AMTR_s00186p00036810        75.9    2e-12   Amborella trichopoda
ref|XP_010312293.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     75.9    2e-12   Solanum lycopersicum
ref|XP_002266676.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4          75.9    2e-12   Vitis vinifera
gb|KGN50309.1|  hypothetical protein Csa_5G167020                     73.9    2e-12   Cucumis sativus [cucumbers]
ref|XP_002876254.1|  hypothetical protein ARALYDRAFT_348537           75.5    2e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_010256764.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          75.5    2e-12   Nelumbo nucifera [Indian lotus]
emb|CBI40153.3|  unnamed protein product                              75.9    2e-12   Vitis vinifera
ref|XP_004143743.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.9    3e-12   
ref|XP_009771569.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     74.7    3e-12   Nicotiana sylvestris
ref|XP_010108379.1|  putative peptide/nitrate transporter             73.6    4e-12   Morus notabilis
ref|XP_006390699.1|  hypothetical protein EUTSA_v10019829mg           74.3    4e-12   Eutrema salsugineum
ref|XP_007011003.1|  Major facilitator superfamily protein            74.7    4e-12   Theobroma cacao [chocolate]
ref|XP_003634604.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...  74.3    4e-12   Vitis vinifera
gb|KDO49053.1|  hypothetical protein CISIN_1g0085651mg                74.3    4e-12   Citrus sinensis [Valencia orange]
ref|NP_974431.2|  probable peptide/nitrate transporter                74.3    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EYU38280.1|  hypothetical protein MIMGU_mgv1a021345mg              73.9    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_010312294.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     74.3    5e-12   Solanum lycopersicum
ref|XP_008437711.1|  PREDICTED: uncharacterized protein LOC103483057  74.7    5e-12   
ref|XP_010665406.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...  73.9    5e-12   Vitis vinifera
ref|XP_008356821.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     72.0    5e-12   Malus domestica [apple tree]
emb|CBI39334.3|  unnamed protein product                              74.3    6e-12   Vitis vinifera
ref|XP_006339008.1|  PREDICTED: probable peptide/nitrate transpor...  73.9    6e-12   Solanum tuberosum [potatoes]
ref|XP_010515972.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4          73.9    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010427147.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     73.9    6e-12   Camelina sativa [gold-of-pleasure]
gb|ABR17733.1|  unknown                                               73.9    6e-12   Picea sitchensis
ref|XP_010062427.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    73.9    6e-12   Eucalyptus grandis [rose gum]
ref|XP_010665405.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...  73.9    6e-12   Vitis vinifera
emb|CAN75422.1|  hypothetical protein VITISV_011767                   73.9    6e-12   Vitis vinifera
gb|KCW69566.1|  hypothetical protein EUGRSUZ_F02995                   73.9    6e-12   Eucalyptus grandis [rose gum]
ref|XP_003546719.1|  PREDICTED: probable peptide/nitrate transpor...  73.9    6e-12   Glycine max [soybeans]
ref|XP_004511030.1|  PREDICTED: probable peptide/nitrate transpor...  73.9    7e-12   Cicer arietinum [garbanzo]
ref|XP_010504249.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4          73.9    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007140460.1|  hypothetical protein PHAVU_008G114200g           73.9    7e-12   Phaseolus vulgaris [French bean]
ref|XP_009109895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15-like    73.6    8e-12   Brassica rapa
ref|XP_010095974.1|  putative peptide/nitrate transporter             73.6    8e-12   Morus notabilis
ref|XP_010665398.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    73.6    9e-12   Vitis vinifera
ref|XP_003627833.1|  Peptide transporter PTR1                         73.6    9e-12   Medicago truncatula
ref|XP_010269378.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...  73.6    9e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010269377.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...  73.2    1e-11   Nelumbo nucifera [Indian lotus]
emb|CDY36098.1|  BnaA08g19500D                                        72.8    1e-11   Brassica napus [oilseed rape]
gb|KJB74997.1|  hypothetical protein B456_012G017800                  73.2    1e-11   Gossypium raimondii
ref|XP_010695697.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  73.2    1e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009772498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     73.2    1e-11   Nicotiana sylvestris
ref|XP_009620626.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          72.8    1e-11   Nicotiana tomentosiformis
emb|CDY66692.1|  BnaC04g53060D                                        72.8    1e-11   Brassica napus [oilseed rape]
gb|KHF99635.1|  hypothetical protein F383_18770                       72.8    1e-11   Gossypium arboreum [tree cotton]
gb|KHN37667.1|  Putative peptide/nitrate transporter                  72.8    1e-11   Glycine soja [wild soybean]
emb|CDP06560.1|  unnamed protein product                              72.8    1e-11   Coffea canephora [robusta coffee]
ref|XP_010683110.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    72.8    1e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003542826.1|  PREDICTED: probable peptide/nitrate transpor...  72.8    1e-11   Glycine max [soybeans]
ref|XP_002513061.1|  Peptide transporter, putative                    72.8    2e-11   
ref|XP_009116130.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4          72.8    2e-11   Brassica rapa
emb|CDX78237.1|  BnaA09g34320D                                        72.8    2e-11   Brassica napus [oilseed rape]
gb|AFK39795.1|  unknown                                               68.9    2e-11   Lotus japonicus
ref|XP_008785490.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     72.4    2e-11   
ref|XP_003529111.1|  PREDICTED: putative peptide/nitrate transpor...  72.4    2e-11   Glycine max [soybeans]
ref|XP_009361962.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     72.4    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_002265901.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     72.4    2e-11   Vitis vinifera
ref|XP_008353485.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like     72.0    2e-11   Malus domestica [apple tree]
gb|KJB73105.1|  hypothetical protein B456_011G215200                  72.4    2e-11   Gossypium raimondii
ref|XP_004246394.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     72.4    2e-11   Solanum lycopersicum
gb|KDO84007.1|  hypothetical protein CISIN_1g045562mg                 72.0    2e-11   Citrus sinensis [Valencia orange]
ref|XP_006434673.1|  hypothetical protein CICLE_v10000719mg           72.4    2e-11   Citrus clementina
gb|EYU22787.1|  hypothetical protein MIMGU_mgv1a003626mg              72.0    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_010276618.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     72.0    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006473248.1|  PREDICTED: probable peptide/nitrate transpor...  72.0    2e-11   Citrus sinensis [Valencia orange]
ref|XP_007133986.1|  hypothetical protein PHAVU_010G009400g           72.0    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010088558.1|  Putative peptide/nitrate transporter             72.0    3e-11   Morus notabilis
ref|XP_002278980.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...  72.0    3e-11   Vitis vinifera
ref|XP_009116102.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1          72.0    3e-11   Brassica rapa
gb|KHG09768.1|  hypothetical protein F383_13158                       72.0    3e-11   Gossypium arboreum [tree cotton]
ref|XP_011094926.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     72.0    3e-11   Sesamum indicum [beniseed]
emb|CAN70960.1|  hypothetical protein VITISV_025055                   72.0    3e-11   Vitis vinifera
ref|XP_009593536.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    72.0    3e-11   Nicotiana tomentosiformis
ref|XP_004147936.1|  PREDICTED: putative peptide/nitrate transpor...  72.0    3e-11   Cucumis sativus [cucumbers]
ref|XP_010683004.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    72.0    3e-11   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KDP40528.1|  hypothetical protein JCGZ_24527                       72.0    3e-11   Jatropha curcas
ref|XP_008793798.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...  71.6    3e-11   
ref|XP_010428067.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...  71.6    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010251739.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     71.6    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_004507202.1|  PREDICTED: probable peptide/nitrate transpor...  71.6    3e-11   Cicer arietinum [garbanzo]
gb|EMT03148.1|  Peptide transporter PTR2                              71.6    4e-11   Aegilops tauschii
ref|XP_009357420.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     71.6    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_008448441.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          71.6    4e-11   Cucumis melo [Oriental melon]
ref|XP_010089167.1|  hypothetical protein L484_000371                 67.8    4e-11   Morus notabilis
ref|XP_002534074.1|  Peptide transporter, putative                    72.0    5e-11   
ref|XP_007020109.1|  Major facilitator superfamily protein, putat...  71.2    5e-11   Theobroma cacao [chocolate]
ref|XP_011091838.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     71.2    5e-11   Sesamum indicum [beniseed]
ref|XP_010923254.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          71.2    5e-11   Elaeis guineensis
ref|XP_009783108.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    71.2    5e-11   Nicotiana sylvestris
ref|XP_004308593.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     70.9    5e-11   Fragaria vesca subsp. vesca
ref|XP_004492370.1|  PREDICTED: putative peptide/nitrate transpor...  71.2    5e-11   Cicer arietinum [garbanzo]
ref|XP_007220562.1|  hypothetical protein PRUPE_ppa003298mg           71.2    6e-11   Prunus persica
ref|XP_011006628.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like...  71.2    6e-11   Populus euphratica
gb|KHG04630.1|  hypothetical protein F383_29596                       70.9    6e-11   Gossypium arboreum [tree cotton]
ref|XP_009380625.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...  70.9    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN52717.1|  hypothetical protein Csa_5G652230                     67.8    7e-11   Cucumis sativus [cucumbers]
gb|KDP35100.1|  hypothetical protein JCGZ_10942                       70.9    7e-11   Jatropha curcas
ref|XP_007020108.1|  Major facilitator superfamily protein, putat...  71.2    7e-11   Theobroma cacao [chocolate]
gb|KHG26072.1|  hypothetical protein F383_04504                       70.9    7e-11   Gossypium arboreum [tree cotton]
ref|XP_002265817.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     70.9    7e-11   Vitis vinifera
ref|XP_002521809.1|  oligopeptide transporter, putative               71.2    7e-11   
ref|XP_006390700.1|  hypothetical protein EUTSA_v10018035mg           71.2    7e-11   Eutrema salsugineum
gb|KFK44351.1|  hypothetical protein AALP_AA1G246300                  70.5    8e-11   Arabis alpina [alpine rockcress]
ref|XP_004307712.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          70.5    8e-11   Fragaria vesca subsp. vesca
ref|XP_008437001.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    70.5    8e-11   
gb|KFK44350.1|  hypothetical protein AALP_AA1G246200                  70.5    8e-11   Arabis alpina [alpine rockcress]
gb|ABR32184.1|  peptide transporter                                   70.5    9e-11   Hakea actites
ref|XP_002323528.1|  proton-dependent oligopeptide transport fami...  70.5    9e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003516904.1|  PREDICTED: putative peptide/nitrate transpor...  70.5    9e-11   Glycine max [soybeans]
ref|XP_004308589.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     70.1    1e-10   Fragaria vesca subsp. vesca
ref|XP_009621141.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     70.5    1e-10   Nicotiana tomentosiformis
emb|CDP10688.1|  unnamed protein product                              70.1    1e-10   Coffea canephora [robusta coffee]
ref|XP_004507194.1|  PREDICTED: putative peptide/nitrate transpor...  70.1    1e-10   Cicer arietinum [garbanzo]
gb|KHN11892.1|  Putative peptide/nitrate transporter                  70.1    1e-10   Glycine soja [wild soybean]
ref|XP_010033212.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     70.1    1e-10   Eucalyptus grandis [rose gum]
ref|XP_004241845.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...  70.1    1e-10   Solanum lycopersicum
ref|XP_008245631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     70.1    1e-10   Prunus mume [ume]
ref|XP_010498730.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15 iso...  70.1    1e-10   Camelina sativa [gold-of-pleasure]
gb|KEH28963.1|  peptide/nitrate transporter plant                     70.1    1e-10   Medicago truncatula
ref|XP_010091027.1|  hypothetical protein L484_000418                 66.6    1e-10   Morus notabilis
ref|XP_010498731.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15 iso...  70.1    1e-10   Camelina sativa [gold-of-pleasure]
gb|KDP24538.1|  hypothetical protein JCGZ_25102                       70.1    1e-10   Jatropha curcas
ref|XP_002881551.1|  hypothetical protein ARALYDRAFT_482796           70.1    1e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_010480600.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15-like    70.1    1e-10   Camelina sativa [gold-of-pleasure]
gb|KDP21682.1|  hypothetical protein JCGZ_03353                       70.1    1e-10   Jatropha curcas
ref|XP_008459724.1|  PREDICTED: uncharacterized protein LOC103498766  70.5    1e-10   
ref|XP_009409715.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like     69.7    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI30474.3|  unnamed protein product                              69.3    1e-10   Vitis vinifera
ref|XP_008233850.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          69.7    1e-10   Prunus mume [ume]
ref|XP_008442499.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          69.7    2e-10   Cucumis melo [Oriental melon]
ref|XP_006356504.1|  PREDICTED: probable peptide/nitrate transpor...  69.7    2e-10   Solanum tuberosum [potatoes]
emb|CDY07763.1|  BnaA03g17480D                                        69.7    2e-10   Brassica napus [oilseed rape]
ref|XP_002520834.1|  oligopeptide transporter, putative               69.7    2e-10   Ricinus communis
ref|XP_009133215.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          69.7    2e-10   Brassica rapa
ref|XP_007131296.1|  hypothetical protein PHAVU_011G002000g           69.3    2e-10   Phaseolus vulgaris [French bean]
gb|KGN52719.1|  hypothetical protein Csa_5G652250                     68.2    2e-10   Cucumis sativus [cucumbers]
ref|XP_011464753.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    69.3    2e-10   Fragaria vesca subsp. vesca
ref|XP_010654232.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          69.3    2e-10   Vitis vinifera
emb|CAN73408.1|  hypothetical protein VITISV_024373                   69.3    2e-10   Vitis vinifera
ref|XP_009361961.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     69.3    2e-10   Pyrus x bretschneideri [bai li]
gb|KEH29313.1|  peptide/nitrate transporter plant                     68.9    2e-10   Medicago truncatula
ref|XP_007131295.1|  hypothetical protein PHAVU_011G001900g           69.3    2e-10   Phaseolus vulgaris [French bean]
ref|XP_006420320.1|  hypothetical protein CICLE_v10006425mg           69.3    2e-10   Citrus clementina
ref|XP_009358790.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     69.3    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_009369254.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  68.9    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_003598531.1|  Peptide transporter PTR5                         68.9    2e-10   Medicago truncatula
ref|XP_004172150.1|  PREDICTED: probable peptide/nitrate transpor...  68.9    3e-10   
gb|KFK41627.1|  hypothetical protein AALP_AA2G152300                  68.9    3e-10   Arabis alpina [alpine rockcress]
ref|XP_008388083.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     68.9    3e-10   Malus domestica [apple tree]
ref|XP_010245114.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    68.9    3e-10   
gb|KJB73039.1|  hypothetical protein B456_011G210900                  68.9    3e-10   
ref|XP_007163480.1|  hypothetical protein PHAVU_001G237600g           65.1    3e-10   
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     68.9    3e-10   
ref|XP_010067584.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...  68.9    3e-10   
ref|XP_010067583.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...  68.9    3e-10   
ref|XP_004981230.1|  PREDICTED: probable peptide/nitrate transpor...  68.6    3e-10   
ref|XP_008391631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     68.6    3e-10   
ref|XP_010930856.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.9    4e-10   
ref|XP_008375319.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4          68.6    4e-10   
emb|CDY21370.1|  BnaA09g30570D                                        68.6    4e-10   
ref|XP_009361960.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     68.6    4e-10   
emb|CDY14503.1|  BnaC03g20920D                                        68.6    4e-10   
ref|XP_007220930.1|  hypothetical protein PRUPE_ppa023730mg           68.6    4e-10   
gb|EYU20116.1|  hypothetical protein MIMGU_mgv1a003150mg              68.6    4e-10   
gb|KJB36660.1|  hypothetical protein B456_006G169400                  68.6    4e-10   
gb|AES71051.2|  peptide/nitrate transporter plant                     68.6    4e-10   
ref|NP_001055627.1|  Os05g0430900                                     68.2    4e-10   
ref|XP_008343637.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like     68.6    4e-10   
ref|XP_003540022.1|  PREDICTED: probable peptide/nitrate transpor...  68.6    4e-10   
gb|EMT28393.1|  Peptide transporter PTR2                              68.6    4e-10   
ref|XP_009419917.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     68.6    4e-10   
ref|XP_004307113.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     68.2    5e-10   
ref|XP_007218954.1|  hypothetical protein PRUPE_ppa003507mg           68.2    5e-10   
ref|XP_010264468.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like     68.2    5e-10   
ref|XP_010032301.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4          68.2    5e-10   
ref|XP_002309091.2|  proton-dependent oligopeptide transport fami...  68.2    5e-10   
ref|XP_006293895.1|  hypothetical protein CARUB_v10022888mg           68.2    5e-10   
ref|XP_002441153.1|  hypothetical protein SORBIDRAFT_09g021320        68.2    5e-10   
ref|XP_007220558.1|  hypothetical protein PRUPE_ppa003244mg           68.2    5e-10   
dbj|BAD31819.1|  putative peptide transport protein                   68.2    5e-10   
ref|NP_001058672.1|  Os07g0100600                                     68.2    5e-10   
ref|XP_008246054.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     68.2    6e-10   
ref|XP_008233505.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     68.2    6e-10   
ref|XP_006845418.1|  hypothetical protein AMTR_s00019p00083970        67.8    6e-10   
ref|XP_009363836.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like     68.2    6e-10   
ref|XP_004172444.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...  67.8    6e-10   
dbj|BAK04766.1|  predicted protein                                    67.8    6e-10   
ref|XP_008459680.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    67.8    6e-10   
ref|XP_011019211.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          67.8    6e-10   
gb|KEH29316.1|  peptide/nitrate transporter plant                     67.8    6e-10   
gb|EMT00870.1|  Peptide transporter PTR2                              67.8    6e-10   
ref|XP_003623153.1|  Peptide transporter PTR3-B                       67.8    7e-10   
ref|XP_010505388.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     67.8    7e-10   
ref|XP_009351271.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     67.8    7e-10   
ref|XP_009392698.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     67.8    7e-10   
gb|KHG17597.1|  hypothetical protein F383_23381                       67.8    7e-10   
ref|XP_009378859.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     67.8    8e-10   
ref|XP_008369322.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          67.8    8e-10   
ref|XP_010532218.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          67.4    8e-10   
ref|XP_010691634.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     67.4    8e-10   
ref|XP_008359699.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          67.4    8e-10   
ref|XP_010509262.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6          67.4    8e-10   
gb|KHN04807.1|  Putative peptide/nitrate transporter                  67.4    8e-10   
ref|XP_003538496.1|  PREDICTED: probable peptide/nitrate transpor...  67.4    8e-10   
emb|CDX78212.1|  BnaA09g34070D                                        67.0    9e-10   
ref|XP_007020104.1|  Major facilitator superfamily protein isoform 1  67.4    9e-10   
ref|XP_010911895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    67.4    9e-10   
ref|XP_007026879.1|  Major facilitator superfamily protein isoform 3  67.0    9e-10   
ref|XP_006385990.1|  hypothetical protein POPTR_0003s19690g           65.5    9e-10   
ref|XP_007020105.1|  Major facilitator superfamily protein isoform 2  67.4    9e-10   
ref|XP_004141652.1|  PREDICTED: uncharacterized protein LOC101211419  67.8    9e-10   
ref|NP_181578.1|  putative peptide/nitrate transporter                67.4    9e-10   
gb|AAL36253.1|  putative PTR2 family peptide transporter protein      67.4    9e-10   
gb|KGN50308.1|  hypothetical protein Csa_5G167010                     63.5    1e-09   
ref|XP_010508857.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...  67.4    1e-09   
gb|EMS46619.1|  Peptide transporter PTR2                              67.0    1e-09   
ref|XP_010517068.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     67.4    1e-09   
ref|XP_010683224.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    67.0    1e-09   
ref|XP_004168265.1|  PREDICTED: probable peptide/nitrate transpor...  67.4    1e-09   
emb|CDY09395.1|  BnaA02g26150D                                        67.0    1e-09   
ref|XP_010505781.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like...  67.0    1e-09   
gb|EYU26617.1|  hypothetical protein MIMGU_mgv1a003329mg              67.0    1e-09   
ref|XP_010676231.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     67.0    1e-09   
gb|ABK25104.1|  unknown                                               67.0    1e-09   
ref|XP_007163607.1|  hypothetical protein PHAVU_001G248600g           67.0    1e-09   
ref|NP_001148010.1|  peptide transporter PTR2                         67.0    1e-09   
ref|XP_008231698.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     67.0    1e-09   
ref|XP_005847577.1|  hypothetical protein CHLNCDRAFT_23105            67.0    1e-09   
ref|XP_006489657.1|  PREDICTED: peptide transporter PTR3-A-like       67.0    1e-09   
ref|XP_010256950.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like     67.0    1e-09   
ref|XP_009788012.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    67.0    1e-09   
ref|XP_002467419.1|  hypothetical protein SORBIDRAFT_01g027730        67.0    1e-09   
ref|XP_009363640.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     67.0    1e-09   
ref|XP_006416185.1|  hypothetical protein EUTSA_v10007251mg           67.0    1e-09   
ref|XP_009613182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    67.0    1e-09   
ref|XP_006655204.1|  PREDICTED: probable peptide/nitrate transpor...  67.0    1e-09   
ref|XP_010517471.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like...  67.0    1e-09   
ref|XP_004307585.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     67.0    1e-09   
gb|EAZ02458.1|  hypothetical protein OsI_24563                        67.0    1e-09   
ref|XP_009104872.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like    66.6    1e-09   
ref|XP_010553271.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6 isof...  67.0    1e-09   
ref|XP_006435862.1|  hypothetical protein CICLE_v10031051mg           67.0    1e-09   
emb|CDP13934.1|  unnamed protein product                              67.0    1e-09   
gb|KDO44873.1|  hypothetical protein CISIN_1g007932mg                 67.0    1e-09   
ref|XP_006293896.1|  hypothetical protein CARUB_v10022889mg           67.0    1e-09   
gb|KJB81309.1|  hypothetical protein B456_013G138200                  66.6    1e-09   
ref|XP_004983516.1|  PREDICTED: peptide transporter PTR2-like iso...  66.6    1e-09   
ref|XP_004983458.1|  PREDICTED: probable peptide/nitrate transpor...  66.6    1e-09   
ref|XP_003536840.1|  PREDICTED: peptide transporter PTR3-A-like       66.6    1e-09   
ref|XP_006361305.1|  PREDICTED: probable peptide/nitrate transpor...  66.6    1e-09   
ref|XP_006480900.1|  PREDICTED: probable peptide/nitrate transpor...  66.6    1e-09   
ref|XP_010326140.1|  PREDICTED: uncharacterized protein LOC101268606  67.0    1e-09   
ref|XP_001781231.1|  predicted protein                                66.6    2e-09   
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     66.6    2e-09   
ref|XP_006429216.1|  hypothetical protein CICLE_v10011341mg           66.6    2e-09   
ref|XP_002456717.1|  hypothetical protein SORBIDRAFT_03g041270        64.3    2e-09   
dbj|BAK05012.1|  predicted protein                                    66.6    2e-09   
ref|XP_004983515.1|  PREDICTED: peptide transporter PTR2-like iso...  66.6    2e-09   
ref|XP_008644373.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     66.6    2e-09   
ref|XP_003552142.1|  PREDICTED: probable peptide/nitrate transpor...  66.6    2e-09   
ref|XP_002879871.1|  predicted protein                                66.6    2e-09   
emb|CDY58920.1|  BnaCnng33940D                                        66.2    2e-09   
emb|CAN75421.1|  hypothetical protein VITISV_011766                   64.7    2e-09   
ref|XP_009104877.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like    66.6    2e-09   
ref|XP_006829376.1|  hypothetical protein AMTR_s00256p00011920        66.6    2e-09   
ref|XP_009391687.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like     66.6    2e-09   
ref|XP_004983455.1|  PREDICTED: probable peptide/nitrate transpor...  66.6    2e-09   
ref|XP_006410988.1|  hypothetical protein EUTSA_v10016423mg           66.6    2e-09   
ref|NP_001130610.1|  uncharacterized protein LOC100191709             66.6    2e-09   
ref|XP_009115625.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10         66.2    2e-09   
ref|XP_003568390.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    66.2    2e-09   
tpg|DAA52235.1|  TPA: hypothetical protein ZEAMMB73_814932            66.2    2e-09   
gb|AFW78188.1|  hypothetical protein ZEAMMB73_298414                  66.2    2e-09   
ref|XP_002976499.1|  hypothetical protein SELMODRAFT_105638           66.2    2e-09   
ref|XP_011001079.1|  PREDICTED: uncharacterized protein LOC105108458  66.6    2e-09   
ref|XP_010087054.1|  putative peptide/nitrate transporter             66.2    2e-09   
ref|XP_010095972.1|  putative peptide/nitrate transporter             66.2    2e-09   
ref|XP_008375317.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     66.2    2e-09   
ref|NP_177358.2|  putative peptide/nitrate transporter                66.2    2e-09   
gb|EPS69660.1|  hypothetical protein M569_05105                       66.2    2e-09   
ref|XP_006290773.1|  hypothetical protein CARUB_v10016879mg           66.2    2e-09   
ref|XP_006290774.1|  hypothetical protein CARUB_v10016879mg           66.2    2e-09   
ref|XP_009133434.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like     66.2    2e-09   
gb|KFK36927.1|  hypothetical protein AALP_AA4G190800                  66.2    2e-09   
ref|XP_009405847.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     66.2    2e-09   
ref|XP_011076614.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          66.2    2e-09   
ref|XP_009362004.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     66.2    2e-09   
ref|XP_006830434.1|  hypothetical protein AMTR_s00118p00129200        65.1    2e-09   
emb|CDY58918.1|  BnaCnng33930D                                        65.9    2e-09   
ref|XP_002325970.2|  proton-dependent oligopeptide transport fami...  65.9    2e-09   
ref|NP_181326.1|  putative peptide/nitrate transporter                65.9    2e-09   
ref|XP_002325913.2|  proton-dependent oligopeptide transport fami...  65.9    2e-09   
emb|CDX73503.1|  BnaC08g25000D                                        65.9    3e-09   
dbj|BAJ85403.1|  predicted protein                                    62.8    3e-09   
ref|XP_009617710.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          65.9    3e-09   
gb|AAG51131.1|AC069273_2  oligopeptide transporter, putative          66.2    3e-09   
gb|KHN47085.1|  Putative peptide/nitrate transporter                  65.9    3e-09   
ref|XP_006661602.1|  PREDICTED: peptide transporter PTR2-like         65.9    3e-09   
ref|XP_011008113.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          65.9    3e-09   
gb|KFK33425.1|  hypothetical protein AALP_AA5G011400                  64.7    3e-09   
ref|XP_003523479.1|  PREDICTED: probable peptide/nitrate transpor...  65.9    3e-09   
ref|XP_004240906.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...  65.9    3e-09   
gb|AAG51788.1|AC067754_4  peptide transporter PTR2-B, putative; 1...  66.2    3e-09   
ref|XP_009415773.1|  PREDICTED: uncharacterized protein LOC103996574  66.2    3e-09   
ref|XP_009104873.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like    65.9    3e-09   
ref|XP_009141905.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...  65.9    3e-09   
emb|CDY06989.1|  BnaA04g23260D                                        65.9    3e-09   
emb|CDX68281.1|  BnaA07g23210D                                        65.9    3e-09   
ref|XP_010105518.1|  Peptide transporter                              66.2    3e-09   
gb|KFK36688.1|  hypothetical protein AALP_AA4G156500                  65.9    3e-09   
ref|XP_010665396.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    65.9    3e-09   
gb|EEE63299.1|  hypothetical protein OsJ_18109                        62.0    3e-09   
gb|KFK36689.1|  hypothetical protein AALP_AA4G156500                  65.9    3e-09   
ref|XP_009380623.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like...  65.9    3e-09   
ref|XP_010477514.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    65.9    3e-09   
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like         65.9    3e-09   
emb|CDP00147.1|  unnamed protein product                              65.9    3e-09   
ref|XP_009142692.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like     65.9    3e-09   
dbj|BAK07796.1|  predicted protein                                    65.5    3e-09   
ref|XP_010504182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7          65.9    3e-09   
ref|XP_004963750.1|  PREDICTED: uncharacterized protein LOC101758083  66.2    3e-09   
ref|XP_010515904.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like     65.5    3e-09   
ref|XP_010427058.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like     65.5    3e-09   
ref|XP_003564730.2|  PREDICTED: uncharacterized protein LOC100833779  65.9    4e-09   
ref|XP_004982913.1|  PREDICTED: peptide transporter PTR3-B-like       65.5    4e-09   
gb|KHN07608.1|  Putative peptide/nitrate transporter                  65.5    4e-09   
ref|XP_010668156.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     65.5    4e-09   
emb|CDX91390.1|  BnaC04g07600D                                        65.5    4e-09   
gb|KHG09490.1|  hypothetical protein F383_15518                       65.5    4e-09   
ref|XP_006856672.1|  hypothetical protein AMTR_s00054p00083290        65.5    4e-09   
ref|XP_007163475.1|  hypothetical protein PHAVU_001G2373001g          63.5    4e-09   
emb|CBI39325.3|  unnamed protein product                              65.9    4e-09   
ref|XP_008783395.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like    65.1    4e-09   
dbj|BAJ94112.1|  predicted protein                                    65.1    4e-09   
ref|NP_177359.1|  putative peptide/nitrate transporter                65.1    4e-09   
ref|XP_011077621.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     65.5    4e-09   
ref|XP_006601976.1|  PREDICTED: putative peptide/nitrate transpor...  65.5    4e-09   
ref|XP_009143444.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  65.1    4e-09   
emb|CDY24388.1|  BnaCnng04550D                                        65.1    4e-09   
ref|XP_006415889.1|  hypothetical protein EUTSA_v10007254mg           65.1    4e-09   
ref|XP_011020391.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4          65.1    4e-09   
ref|XP_004146445.1|  PREDICTED: probable peptide/nitrate transpor...  65.1    4e-09   
ref|XP_007011220.1|  Major facilitator superfamily protein isoform 1  65.1    4e-09   
ref|XP_001754642.1|  predicted protein                                65.1    5e-09   
emb|CDY65668.1|  BnaCnng48110D                                        65.1    5e-09   
dbj|BAD43310.1|  putative peptide transporter PTR2-B                  65.1    5e-09   
gb|EEC79004.1|  hypothetical protein OsI_19508                        61.6    5e-09   
ref|XP_008372883.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     65.1    5e-09   
ref|XP_009345590.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     65.1    5e-09   
gb|EMT00871.1|  Peptide transporter PTR2                              65.1    5e-09   
ref|XP_010264931.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like...  65.1    5e-09   
ref|XP_008456928.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          65.1    5e-09   
gb|KHN07609.1|  Putative peptide/nitrate transporter                  65.1    5e-09   
ref|XP_010921100.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          65.1    5e-09   
ref|XP_004514886.1|  PREDICTED: probable peptide/nitrate transpor...  64.7    6e-09   
ref|XP_006601977.1|  PREDICTED: probable peptide/nitrate transpor...  65.1    6e-09   
ref|XP_009590467.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like     64.7    6e-09   
ref|XP_002297740.2|  hypothetical protein POPTR_0001s06440g           64.7    6e-09   
ref|XP_010911915.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  65.1    6e-09   
ref|XP_006346629.1|  PREDICTED: peptide transporter PTR2-like         64.7    6e-09   
emb|CDY24387.1|  BnaCnng04540D                                        64.7    6e-09   
ref|XP_008466771.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  64.7    6e-09   
ref|XP_007163474.1|  hypothetical protein PHAVU_001G237200g           64.7    6e-09   
ref|XP_010460013.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.16-like    64.7    6e-09   
ref|XP_010105519.1|  Peptide transporter                              64.7    7e-09   
dbj|BAJ98420.1|  predicted protein                                    64.7    7e-09   
ref|XP_004506789.1|  PREDICTED: peptide transporter PTR1-like iso...  64.7    7e-09   
ref|XP_009627210.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like     64.7    7e-09   
ref|XP_008785424.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     64.7    7e-09   
ref|XP_009795789.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1          64.7    7e-09   



>ref|XP_009758756.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Nicotiana sylvestris]
 ref|XP_009758757.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Nicotiana sylvestris]
Length=538

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 107/129 (83%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ    LNKPCILLIVIAGMERF FKGVA+NLVTYLTDVAKMSNS+AAK VNNWCG 
Sbjct  1    MAGGQSRSSLNKPCILLIVIAGMERFAFKGVASNLVTYLTDVAKMSNSAAAKKVNNWCGI  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKIS-SSSLS  564
            TSM+PLLVAPLADSYLD Y+T+L S+  Y+ GL+ALTS A+ W P +N+A K    SSLS
Sbjct  61   TSMLPLLVAPLADSYLDRYTTVLASSSLYVAGLLALTSLALQW-PWTNSADKSGFCSSLS  119

Query  565  WPLHLISLG  591
            W L+LISLG
Sbjct  120  WSLNLISLG  128



>ref|XP_009615220.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Nicotiana tomentosiformis]
Length=538

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 3/128 (2%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ    LNKPCILLIVIAGMERF FKGVA+NLVTYLTDV KMSNS+AAK VNNWCG 
Sbjct  1    MAGGQSRTSLNKPCILLIVIAGMERFAFKGVASNLVTYLTDVVKMSNSAAAKKVNNWCGI  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TSM+PLLVAPLADSYLD Y+T+L S+  Y+ GL+ALTS A+ WP  ++  +   +SS SW
Sbjct  61   TSMLPLLVAPLADSYLDRYTTVLASSSLYVAGLLALTSLALQWPWPNSADKSGFTSSFSW  120

Query  568  PLHLISLG  591
             L+LISLG
Sbjct  121  SLNLISLG  128



>ref|XP_011046083.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X1 [Populus 
euphratica]
Length=540

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA GQ   GLNK C LLIVIAGMERF FKGVA+NLVTYLTDV KMSNS+AAK VNNWCGF
Sbjct  1    MASGQKPKGLNKSCFLLIVIAGMERFAFKGVASNLVTYLTDVVKMSNSAAAKTVNNWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TSM+PLLVA LADS+ D YSTIL S+F Y++GL+ALTSTA+ W     N  KISSS L W
Sbjct  61   TSMLPLLVASLADSW-DRYSTILTSSFIYVVGLVALTSTALSWARHPTN--KISSSYLFW  117

Query  568  PLHLISLG  591
             L LISLG
Sbjct  118  SLCLISLG  125



>ref|XP_006372628.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP50425.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=540

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA GQ   GLNK C LLIVIAGMERF FKGVA+NLVTYLTDV KMSNS+AAK VNNWCGF
Sbjct  1    MASGQKPKGLNKSCFLLIVIAGMERFAFKGVASNLVTYLTDVVKMSNSAAAKTVNNWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TSM+PLLVA LADS+ D YSTIL S+F Y++GL+ALTSTA+ W     N  KISSS L W
Sbjct  61   TSMLPLLVASLADSW-DRYSTILTSSFIYVVGLVALTSTALSWARHPTN--KISSSYLFW  117

Query  568  PLHLISLG  591
             L LISLG
Sbjct  118  SLCLISLG  125



>ref|XP_003633812.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Vitis vinifera]
 ref|XP_010660979.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Vitis vinifera]
Length=533

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 102/131 (78%), Gaps = 8/131 (6%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ   GLNKPCILLIV+AGMERF FKGV +NLVTYLTDV KMSNS+AAK VN+WCG 
Sbjct  1    MAGGQRSRGLNKPCILLIVVAGMERFAFKGVVSNLVTYLTDVVKMSNSTAAKTVNSWCGL  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSL  561
            TSM+ LLVAPLADSY   YSTIL S+F YI+GL+ALTSTA+   W P    +    SS L
Sbjct  61   TSMLALLVAPLADSYWYRYSTILASSFLYIIGLLALTSTALVGTWIPEDRTS---GSSFL  117

Query  562  SWPLHLISLGL  594
             W L+LISLGL
Sbjct  118  FWSLYLISLGL  128



>emb|CBI34989.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 102/131 (78%), Gaps = 8/131 (6%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ   GLNKPCILLIV+AGMERF FKGV +NLVTYLTDV KMSNS+AAK VN+WCG 
Sbjct  1    MAGGQRSRGLNKPCILLIVVAGMERFAFKGVVSNLVTYLTDVVKMSNSTAAKTVNSWCGL  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSL  561
            TSM+ LLVAPLADSY   YSTIL S+F YI+GL+ALTSTA+   W P    +    SS L
Sbjct  61   TSMLALLVAPLADSYWYRYSTILASSFLYIIGLLALTSTALVGTWIPEDRTS---GSSFL  117

Query  562  SWPLHLISLGL  594
             W L+LISLGL
Sbjct  118  FWSLYLISLGL  128



>emb|CDP02164.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 104/133 (78%), Gaps = 13/133 (10%)
 Frame = +1

Query  217  MAGGQ----GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCG  384
            MAGG     GLNKP +LLIVIAG+ERF FKGVA+NLVTYLTDV KMSNSSAAK+VN+WCG
Sbjct  1    MAGGHRLTAGLNKPIVLLIVIAGVERFAFKGVASNLVTYLTDVVKMSNSSAAKMVNSWCG  60

Query  385  FTSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGW---PPGSNNAQKISSS  555
            FTSMVPL+VAPLADSY D Y+T+  +A  Y LGL+ L STA+GW   P G     K+SSS
Sbjct  61   FTSMVPLVVAPLADSYWDRYTTVQSAALLYALGLVMLASTALGWLLIPIG-----KVSSS  115

Query  556  S-LSWPLHLISLG  591
            + L W L+LISLG
Sbjct  116  ALLHWSLYLISLG  128



>ref|XP_007032332.1| Amino acid permease, putative isoform 1 [Theobroma cacao]
 gb|EOY03258.1| Amino acid permease, putative isoform 1 [Theobroma cacao]
Length=541

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 8/130 (6%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   QGL++ CILLIVIAGMERF FKGVA+N+VTYLTDV KMSNSSAAK VN+WCGF
Sbjct  1    MAGGGRAQGLSRSCILLIVIAGMERFAFKGVASNMVTYLTDVVKMSNSSAAKTVNSWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSL  561
            TSM+PLLVAPLADS+ D YSTIL S+F Y+LGL A+ STA+   W P SN +   SS+ L
Sbjct  61   TSMLPLLVAPLADSFWDRYSTILTSSFLYVLGLGAVASTALLWTWSPPSNTS---SSAFL  117

Query  562  SWPLHLISLG  591
             W L LISLG
Sbjct  118  FWSLCLISLG  127



>ref|XP_006338515.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Solanum tuberosum]
Length=534

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 3/104 (3%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ    LNKPCILLIVIAGMERF+FKGVA+NLVTYLTDVAKMSNS+AAK+VNNWCG 
Sbjct  1    MAGGQSTRNLNKPCILLIVIAGMERFSFKGVASNLVTYLTDVAKMSNSAAAKMVNNWCGI  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWP  519
            TSM+PLLVAPLADSYLD Y+T+L S+  Y  GL+ALTS A+ WP
Sbjct  61   TSMLPLLVAPLADSYLDRYTTVLASSSLYFAGLLALTSLALQWP  104



>ref|XP_004232263.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Solanum lycopersicum]
 ref|XP_010316272.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Solanum lycopersicum]
 ref|XP_010316273.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Solanum lycopersicum]
Length=537

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 3/104 (3%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ    LNKPCILLIVIAGMERF+FKGVA+NLVTYLTDVAKMSNS+AAK+VNNWCG 
Sbjct  1    MAGGQSPRNLNKPCILLIVIAGMERFSFKGVASNLVTYLTDVAKMSNSAAAKMVNNWCGI  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWP  519
            TSM+PLLVAPLADSYLD Y+T+L S+  Y  GL+ALTS A+ WP
Sbjct  61   TSMLPLLVAPLADSYLDRYTTVLASSSLYFAGLLALTSLALQWP  104



>ref|XP_002305027.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE85538.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=540

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 100/128 (78%), Gaps = 6/128 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA GQ   GLN+ C LLIVIAGMERF FKGVA+NLVTYLTDV  MSNS+AAK VNNWCGF
Sbjct  1    MASGQKPKGLNRSCFLLIVIAGMERFAFKGVASNLVTYLTDVVMMSNSAAAKTVNNWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TSM+PLLVA LADS+ D YSTIL S+F Y++GL+ALTSTA+ W     N   ISSS L W
Sbjct  61   TSMLPLLVASLADSW-DRYSTILSSSFLYVVGLVALTSTALAWARHPTN--NISSSYLFW  117

Query  568  PLHLISLG  591
             L LISLG
Sbjct  118  SLCLISLG  125



>ref|XP_011035394.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Populus euphratica]
Length=538

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 100/128 (78%), Gaps = 6/128 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA GQ   GLN+ C LLIVIAGMERF FKGVA+NLVTYLTDV  MSNS+AAK VNNWCGF
Sbjct  1    MASGQKPKGLNRSCFLLIVIAGMERFAFKGVASNLVTYLTDVVMMSNSAAAKTVNNWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TSM+PLLVA LADS+ D YSTIL S+F Y++GL+ALTSTA+ W     N   ISSS L W
Sbjct  61   TSMLPLLVASLADSW-DRYSTILTSSFLYVVGLVALTSTALAWARHPTN--NISSSYLFW  117

Query  568  PLHLISLG  591
             L LISLG
Sbjct  118  SLGLISLG  125



>gb|KJB33723.1| hypothetical protein B456_006G027600 [Gossypium raimondii]
 gb|KJB33724.1| hypothetical protein B456_006G027600 [Gossypium raimondii]
Length=542

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 7/126 (6%)
 Frame = +1

Query  226  GQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPL  405
             QGL+K C+LLIVIAGMERF FKGVA+NLVTYLTDV KMSNSSAAK VN+WCGFTS+VPL
Sbjct  7    AQGLSKACVLLIVIAGMERFAFKGVASNLVTYLTDVVKMSNSSAAKTVNSWCGFTSIVPL  66

Query  406  LVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGW---PPGSNNAQKISSSSLSWPLH  576
            LVAPLADS+ D YSTIL S+F Y+LGL A+ STA+ W   PP + +    SS+ L W L 
Sbjct  67   LVAPLADSFWDRYSTILTSSFLYVLGLGAVASTALLWTYTPPSTTS----SSAFLFWSLC  122

Query  577  LISLGL  594
            LISLGL
Sbjct  123  LISLGL  128



>ref|XP_006446423.1| hypothetical protein CICLE_v10014849mg [Citrus clementina]
 ref|XP_006470412.1| PREDICTED: putative peptide/nitrate transporter At3g01350-like 
[Citrus sinensis]
 gb|ESR59663.1| hypothetical protein CICLE_v10014849mg [Citrus clementina]
 gb|KDO66304.1| hypothetical protein CISIN_1g009413mg [Citrus sinensis]
Length=535

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 99/122 (81%), Gaps = 4/122 (3%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL+K CI+LIVIAG ERF FKGVA+NLVTYLTDV KMSNSSAAK VN+WCGFTSM+PL++
Sbjct  2    GLSKSCIMLIVIAGKERFAFKGVASNLVTYLTDVVKMSNSSAAKTVNSWCGFTSMLPLVL  61

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSS--LSWPLHLIS  585
            APLADSY D YSTIL  +F Y++GL+ALTSTA  W   + N  KISSSS  L W L LIS
Sbjct  62   APLADSYWDRYSTILAFSFIYVVGLVALTSTAFSWAWSTTN--KISSSSAFLFWSLCLIS  119

Query  586  LG  591
            LG
Sbjct  120  LG  121



>gb|KHG28522.1| hypothetical protein F383_09980 [Gossypium arboreum]
Length=542

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 7/125 (6%)
 Frame = +1

Query  226  GQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPL  405
             QGL+K C+LLIVIAGMERF FKGVA+NLVTYLTDV KMSNSSAAK VN+WCGFTS+VPL
Sbjct  7    AQGLSKSCVLLIVIAGMERFAFKGVASNLVTYLTDVVKMSNSSAAKTVNSWCGFTSIVPL  66

Query  406  LVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGW---PPGSNNAQKISSSSLSWPLH  576
            LVAPLADS+ D YSTIL S+F Y+LGL A+ STA+ W   PP + +    SS+ L W L 
Sbjct  67   LVAPLADSFWDRYSTILTSSFLYVLGLGAVASTALLWTYTPPSTTS----SSAFLFWSLC  122

Query  577  LISLG  591
            LISLG
Sbjct  123  LISLG  127



>gb|KJB75802.1| hypothetical protein B456_012G058600 [Gossypium raimondii]
Length=541

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 103/130 (79%), Gaps = 8/130 (6%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            M+GG   QGL++ CILLIVIAGMERF FKGVA+NLVTYLTDV +MSNSSAAK VN+WCGF
Sbjct  1    MSGGGRVQGLSRSCILLIVIAGMERFAFKGVASNLVTYLTDVVQMSNSSAAKTVNSWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSL  561
            TSM+PLLVAPLADS+ DSYSTIL S+F Y+LGL A+ STA    W P SN   K S + L
Sbjct  61   TSMLPLLVAPLADSFWDSYSTILTSSFVYVLGLGAVASTATIWTWSPPSN---KSSPAFL  117

Query  562  SWPLHLISLG  591
             W L LISLG
Sbjct  118  FWSLCLISLG  127



>ref|XP_007215636.1| hypothetical protein PRUPE_ppa003862mg [Prunus persica]
 gb|EMJ16835.1| hypothetical protein PRUPE_ppa003862mg [Prunus persica]
Length=543

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+ L   CILLIVIAGMERF +KGVA+NLVTYLTDV KMSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKTLGNSCILLIVIAGMERFAYKGVASNLVTYLTDVVKMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAP  DSY D Y TIL S+F Y+ GL+ALTSTA+     + N    +SS L W L
Sbjct  62   MLPLLVAPFVDSYWDRYPTILASSFLYVAGLVALTSTALTRASSAANKTSSNSSFLFWSL  121

Query  574  HLISLG  591
            +LISLG
Sbjct  122  YLISLG  127



>ref|XP_008230677.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Prunus mume]
 ref|XP_008230678.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Prunus mume]
Length=542

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+ L   CILLIVIAGMERF +KGVA+NLVTYLTDV KMSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKTLGNSCILLIVIAGMERFAYKGVASNLVTYLTDVMKMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAP  DSY D Y TIL S+F Y+ GL+ALTSTA+     + N    +SS L W L
Sbjct  62   MLPLLVAPFVDSYWDRYPTILASSFLYVAGLVALTSTALTRASSAANKTSSNSSFLFWSL  121

Query  574  HLISLG  591
            +LISLG
Sbjct  122  YLISLG  127



>ref|XP_010696018.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG     LNKPCILLIVIAGMERF FKGVA+NLV YLTDV  MSNS+AAK VN+WCGF
Sbjct  1    MAGGHRPKVLNKPCILLIVIAGMERFAFKGVASNLVIYLTDVVNMSNSAAAKTVNSWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TS++PLLVAPLADS  D YSTIL ++FFYILGL +LTST   W    N  + IS++ + W
Sbjct  61   TSIMPLLVAPLADSLWDHYSTILAASFFYILGLASLTSTTFEWAWPVN--KNISNTFMFW  118

Query  568  PLHLISLG  591
             L LISLG
Sbjct  119  SLCLISLG  126



>ref|XP_010696017.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=542

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG     LNKPCILLIVIAGMERF FKGVA+NLV YLTDV  MSNS+AAK VN+WCGF
Sbjct  1    MAGGHRPKVLNKPCILLIVIAGMERFAFKGVASNLVIYLTDVVNMSNSAAAKTVNSWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TS++PLLVAPLADS  D YSTIL ++FFYILGL +LTST   W    N  + IS++ + W
Sbjct  61   TSIMPLLVAPLADSLWDHYSTILAASFFYILGLASLTSTTFEWAWPVN--KNISNTFMFW  118

Query  568  PLHLISLG  591
             L LISLG
Sbjct  119  SLCLISLG  126



>gb|KDP45420.1| hypothetical protein JCGZ_09669 [Jatropha curcas]
Length=538

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = +1

Query  217  MAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSM  396
            + GG GLNK C+LLIVIAG+ERF FKGVA+NLVTYLTDV KMSNSSAAK VN WCGFT M
Sbjct  4    VQGGGGLNKQCLLLIVIAGIERFAFKGVASNLVTYLTDVVKMSNSSAAKTVNKWCGFTYM  63

Query  397  VPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLH  576
            +PLLVA +ADS  D Y TIL S+F Y++GL+ALTSTA+ W     N   +SSS L W L 
Sbjct  64   LPLLVASVADSCWDKYPTILFSSFLYVVGLVALTSTALAWALYPTN--NLSSSFLFWSLC  121

Query  577  LISLG  591
            LISLG
Sbjct  122  LISLG  126



>ref|XP_008341498.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Malus domestica]
Length=543

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+     CILLIVIAGMERF +KGVA+NLVTYLTDV +MSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKRXGNSCILLIVIAGMERFAYKGVASNLVTYLTDVVQMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAPL DSY D Y TIL S+F Y+ GL+ALTSTA      + N    +SS L W L
Sbjct  62   MLPLLVAPLVDSYWDRYPTILASSFLYVAGLVALTSTAFTRASSAANKTSSNSSFLFWSL  121

Query  574  HLISLG  591
            +LIS+G
Sbjct  122  YLISVG  127



>ref|XP_011098534.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Sesamum indicum]
Length=528

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 94/121 (78%), Gaps = 3/121 (2%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GLNKPC LL VIAGMERF FKGVA+NLVTYLTDV  MSNSSAAK VN W GFTSM+PL+V
Sbjct  4    GLNKPCFLLTVIAGMERFAFKGVASNLVTYLTDVMGMSNSSAAKYVNGWMGFTSMLPLIV  63

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISS-SSLSWPLHLISL  588
            A LADSY D YSTI  S+  Y  GL+ALTSTA+ WP    N  K+ S SSLSW L++ISL
Sbjct  64   ATLADSYWDRYSTIFASSVLYAAGLLALTSTAVRWPWIPTN--KVHSISSLSWSLYMISL  121

Query  589  G  591
            G
Sbjct  122  G  122



>ref|XP_010272076.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Nelumbo nucifera]
Length=548

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 8/130 (6%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG G   L K CILLIV+AG+ERF FKGVA+NLVTYLT+V K+SNSSAAK +N+WCG 
Sbjct  1    MAGGVGSRRLRKQCILLIVVAGLERFAFKGVASNLVTYLTEVVKLSNSSAAKTINSWCGV  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSL  561
            TSM+PLL A LADSYLD YSTIL S+F Y++GL+ LTSTA+   W P S  +   SS+SL
Sbjct  61   TSMLPLLGALLADSYLDRYSTILVSSFLYVVGLVVLTSTALISAWIPRSKTS---SSASL  117

Query  562  SWPLHLISLG  591
             W L+LIS+G
Sbjct  118  YWSLYLISVG  127



>ref|XP_004147481.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Cucumis sativus]
 gb|KGN59623.1| hypothetical protein Csa_3G829130 [Cucumis sativus]
Length=560

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 98/121 (81%), Gaps = 7/121 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L+  CILLIV++GMERF FKGVA+NLVTYLTDV KMSNSSAAK V++WCGFTSM+PL+VA
Sbjct  19   LSNSCILLIVVSGMERFVFKGVASNLVTYLTDVMKMSNSSAAKTVSSWCGFTSMLPLVVA  78

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTST--AMGWPPGSNNAQKISSSSLSWPLHLISL  588
            PLADSY D YSTILGSAF Y+LGL+ALTST  A  W P +N A    SS L   L+LISL
Sbjct  79   PLADSYWDRYSTILGSAFLYVLGLVALTSTTLARTWSP-TNTA----SSFLFSSLYLISL  133

Query  589  G  591
            G
Sbjct  134  G  134



>ref|XP_002517413.1| amino acid permease, putative [Ricinus communis]
 gb|EEF44955.1| amino acid permease, putative [Ricinus communis]
Length=536

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 99/131 (76%), Gaps = 11/131 (8%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAG Q   G NK C LLIVIAG+ERF FKGVA+NLVTYLTDV K+SNS+AAK VNNWCGF
Sbjct  1    MAGMQRTKGFNKSCFLLIVIAGIERFAFKGVASNLVTYLTDVVKLSNSAAAKTVNNWCGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGW---PPGSNNAQKISSSS  558
            TSM+PLLVA LADS  D + TIL S++ Y++GL+ALTSTA+ W   PP      K SS+ 
Sbjct  61   TSMLPLLVASLADSCWDKHPTILASSYLYVVGLMALTSTALTWAWYPP-----NKRSSTF  115

Query  559  LSWPLHLISLG  591
            L W L LIS+G
Sbjct  116  LYWSLGLISVG  126



>ref|XP_008365497.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like, partial [Malus 
domestica]
Length=503

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+ L   C LLIVIAGMERF +KGVA+NLVTYLTDV KMSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKRLGSSCFLLIVIAGMERFAYKGVASNLVTYLTDVVKMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAPL DSY D Y TIL S+F Y+ GL+ALTSTA      + N    +SS L   L
Sbjct  62   MLPLLVAPLVDSYWDRYPTILVSSFLYVAGLVALTSTAFKRATPAANKTSSNSSFLFCSL  121

Query  574  HLISLG  591
            +LISLG
Sbjct  122  YLISLG  127



>ref|XP_010091949.1| Putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB47729.1| Putative peptide/nitrate transporter [Morus notabilis]
Length=541

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 99/128 (77%), Gaps = 4/128 (3%)
 Frame = +1

Query  217  MAG---GQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAG    +GL+  CILLIVIAGMERF FKGVA+NLVTYLTDV KMSNSSAAK VN+W GF
Sbjct  1    MAGVLREKGLSYSCILLIVIAGMERFAFKGVASNLVTYLTDVLKMSNSSAAKTVNSWGGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            TSM+PLL+AP ADSYL  Y+TIL S+F Y++GL+ALTS+A  W     N  + S++ L W
Sbjct  61   TSMLPLLIAPFADSYLHRYTTILASSFLYVVGLVALTSSASAWAWSPANRTR-STTFLFW  119

Query  568  PLHLISLG  591
             L +ISLG
Sbjct  120  SLCVISLG  127



>ref|XP_008357888.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.8-like 
[Malus domestica]
Length=543

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+ L   C LLIVIAGMERF +KGVA+NLVTYLTDV KMSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKRLGSSCFLLIVIAGMERFAYKGVASNLVTYLTDVVKMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAPL DSY D Y TIL S+F Y+ GL+ALTSTA      + N    +SS L   L
Sbjct  62   MLPLLVAPLVDSYWDRYPTILVSSFLYVAGLVALTSTAFTRATPAANKTSSNSSFLFCSL  121

Query  574  HLISLG  591
            +LISLG
Sbjct  122  YLISLG  127



>ref|XP_008443465.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Cucumis melo]
Length=560

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 97/121 (80%), Gaps = 7/121 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L+  CILLIV++GMERF FKGVA+NLVTYLTDV KMSNSSAAK V++WCGFTSM+PL+VA
Sbjct  19   LSNSCILLIVVSGMERFVFKGVASNLVTYLTDVMKMSNSSAAKTVSSWCGFTSMLPLVVA  78

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTST--AMGWPPGSNNAQKISSSSLSWPLHLISL  588
            PLADSY D YSTIL SAF Y+LGL+ALTST  A  W P +N A    SS L   L+LISL
Sbjct  79   PLADSYWDRYSTILASAFLYVLGLVALTSTTLARTWSP-TNTA----SSFLFSSLYLISL  133

Query  589  G  591
            G
Sbjct  134  G  134



>ref|XP_009335771.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Pyrus x bretschneideri]
Length=543

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+ L   C LLIVI+GMERF +KGVA+NLVTYLTDV KMSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKRLGTSCFLLIVISGMERFAYKGVASNLVTYLTDVVKMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAPL DSY D Y TIL S+F Y+ GL+ALTSTA      + N    +SS L   L
Sbjct  62   MLPLLVAPLVDSYWDRYPTILVSSFLYVAGLVALTSTAFTRATPAANKASSNSSFLFCSL  121

Query  574  HLISLG  591
            +LISLG
Sbjct  122  YLISLG  127



>ref|XP_008347950.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.8-like 
[Malus domestica]
Length=543

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+ L   C LLIVIAGMERF +K VA+NLV YLTDV KMSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKRLGSSCFLLIVIAGMERFAYKXVASNLVIYLTDVVKMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAPL DSY D Y TIL S+F Y+ GL+ALTSTA      + N    +SS L   L
Sbjct  62   MLPLLVAPLVDSYWDRYPTILVSSFLYVAGLVALTSTAFTRATPAANKTSSNSSFLFCSL  121

Query  574  HLISLG  591
            +LISLG
Sbjct  122  YLISLG  127



>ref|XP_008348207.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.8-like 
[Malus domestica]
Length=543

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A +GG+ L   C LLIVIAGMERF +K VA+NLV YLTDV KMSNS+AAK VN+WCGFTS
Sbjct  2    AGSGGKRLGSSCFLLIVIAGMERFAYKXVASNLVIYLTDVVKMSNSAAAKTVNSWCGFTS  61

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPL  573
            M+PLLVAPL DSY D Y TIL S+F Y+ GL+ALTSTA      + N    +SS L   L
Sbjct  62   MLPLLVAPLVDSYWDRYPTILVSSFLYVAGLVALTSTAFTRATPAANKTSSNSSFLFCSL  121

Query  574  HLISLG  591
            +LISLG
Sbjct  122  YLISLG  127



>ref|XP_004489344.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Cicer arietinum]
Length=543

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ    LN  CILLI IAG+ERF FKGVA+NLVTYLTDV  +SNSSAAK+VN+W GF
Sbjct  1    MAGGQKQKRLNNSCILLIAIAGIERFAFKGVASNLVTYLTDVVNLSNSSAAKMVNSWVGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMG  513
            TS++PLLVAP+AD+Y D YSTI+ S+F Y++GL+ALT+TA+ 
Sbjct  61   TSIMPLLVAPIADAYWDKYSTIMSSSFLYVMGLVALTTTALA  102



>ref|XP_004296558.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Fragaria vesca 
subsp. vesca]
Length=545

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 98/128 (77%), Gaps = 3/128 (2%)
 Frame = +1

Query  217  MAG--GQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFT  390
            MAG   + L   CILLI+I+GMERF +KGVA+NL+TYLTDV KMSNSSAAK VN+WCGFT
Sbjct  1    MAGTARKRLGNSCILLIMISGMERFAYKGVASNLITYLTDVVKMSNSSAAKTVNSWCGFT  60

Query  391  SMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSW  567
            SMVPLL+AP ADSY D Y TI+ S+  Y+ GL+ALTSTA+     ++ A K  SSS L W
Sbjct  61   SMVPLLIAPFADSYWDRYYTIVASSLVYVAGLVALTSTAIMSRASTDQANKTSSSSFLFW  120

Query  568  PLHLISLG  591
             L+LISLG
Sbjct  121  SLYLISLG  128



>ref|XP_010255307.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Nelumbo nucifera]
Length=537

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 86/101 (85%), Gaps = 3/101 (3%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG G   L+K CILLIV+AG+ERF FKGVA+NLVTYLTDV K+SNSSAAK +N+WCG 
Sbjct  1    MAGGMGYKKLSKSCILLIVVAGVERFAFKGVASNLVTYLTDVVKLSNSSAAKAINSWCGV  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM  510
            TSM+PLL A LADSY D YST+L ++FFY++GL+ALT TA+
Sbjct  61   TSMLPLLGAFLADSYWDRYSTLLAASFFYVVGLVALTFTAL  101



>ref|NP_186784.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9SRI2.1|PTR31_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.9; Short=AtNPF5.9 [Arabidopsis 
thaliana]
 gb|AAF03501.1|AC010676_11 putative peptide transporter [Arabidopsis thaliana]
 gb|AEE73654.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=563

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K ISS  L   L L+S
Sbjct  68   SAPLADTYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISSYFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>ref|XP_010485501.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=568

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SAPLADTYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTCFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>ref|XP_010463532.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9 [Camelina sativa]
Length=568

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SAPLADTYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTCFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>gb|EYU44686.1| hypothetical protein MIMGU_mgv1a004892mg [Erythranthe guttata]
Length=505

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  274  MERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTI  453
            MERF FKGVA+NLVTYLTDV  MSNSSAAK VN W GFTSM+PL+VA LADSY D Y+TI
Sbjct  1    MERFAFKGVASNLVTYLTDVMYMSNSSAAKFVNTWVGFTSMLPLIVATLADSYWDRYTTI  60

Query  454  LGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
            L S+  Y  GL+ALTSTA+ W P +  A+K S  SLSW L++ISLG
Sbjct  61   LASSVLYAAGLLALTSTAVKW-PWNPTAKKHSILSLSWSLYMISLG  105



>ref|XP_010498082.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like isoform X3 [Camelina 
sativa]
Length=584

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  23   RGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  82

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  83   SAPLADTYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTCFLYSSLCLVS  139

Query  586  LGL  594
            +GL
Sbjct  140  IGL  142



>gb|KHG25623.1| hypothetical protein F383_02486 [Gossypium arboreum]
Length=519

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 84/108 (78%), Gaps = 5/108 (5%)
 Frame = +1

Query  274  MERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTI  453
            MERF FKGVA+NLVTYLTDV +MSNSSAAK VN+WCGFTSM+PLLVAPLADS+ D YSTI
Sbjct  1    MERFAFKGVASNLVTYLTDVVQMSNSSAAKTVNSWCGFTSMLPLLVAPLADSFWDRYSTI  60

Query  454  LGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLISLG  591
            L S+F Y+LGL A+ STA    W P SN   K S + L W L LISLG
Sbjct  61   LTSSFVYVLGLGAVASTATIWTWSPPSN---KSSPAFLFWSLCLISLG  105



>ref|XP_010486758.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like isoform X1 [Camelina 
sativa]
 ref|XP_010493500.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like isoform X2 [Camelina 
sativa]
Length=599

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  38   RGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  97

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  98   SAPLADTYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTCFLYSSLCLVS  154

Query  586  LGL  594
            +GL
Sbjct  155  IGL  157



>emb|CDY49047.1| BnaC05g48750D [Brassica napus]
Length=551

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLGKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SAPLADAYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTYFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>emb|CDY37529.1| BnaA05g33940D [Brassica napus]
Length=570

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLGKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SAPLADAYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTYFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>gb|KFK25622.1| hypothetical protein AALP_AA8G138600 [Arabis alpina]
Length=571

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 88/121 (73%), Gaps = 4/121 (3%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L K C LLIVIAGMERF FKG+A+NLVTYLTDV KMSNS AAK VN W GFTSM+PLL A
Sbjct  13   LGKSCALLIVIAGMERFAFKGIASNLVTYLTDVLKMSNSRAAKTVNTWAGFTSMLPLLSA  72

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLISLG  591
            PLAD+Y D + TIL S+  Y LGL+ LT TA     GS +A K IS+  +   L LIS+G
Sbjct  73   PLADAYWDRFFTILASSSVYFLGLVGLTWTAFA---GSRSATKTISTCFIYSSLGLISIG  129

Query  592  L  594
            L
Sbjct  130  L  130



>ref|XP_009147425.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9 [Brassica rapa]
Length=571

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLGKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SAPLADAYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTYFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>ref|XP_010492181.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=565

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL K C LLIVI GMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLGKSCALLIVIVGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW-PLHLIS  585
             APLAD+Y D + TIL S+  Y + L+ LT TA     GS +A KI S+   +  L LIS
Sbjct  68   AAPLADAYWDRFFTILASSSVYFVALVGLTWTAFS---GSRSATKIVSTYFLYSSLGLIS  124

Query  586  LGL  594
            LGL
Sbjct  125  LGL  127



>ref|XP_010453501.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=565

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL K C LLIVI GMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLGKSCALLIVIVGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW-PLHLIS  585
             APLAD+Y D + TIL S+  Y + L+ LT TA     GS +A KI S+   +  L LIS
Sbjct  68   AAPLADAYWDRFFTILASSSVYFVALVGLTWTAFS---GSRSATKIVSTYFLYSSLGLIS  124

Query  586  LGL  594
            LGL
Sbjct  125  LGL  127



>ref|XP_010550101.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K C+LLIVIAGMER+ FKGV +NLVTYLTD+ KMSNS+AAK VN W GFTSM+PL 
Sbjct  10   RGLSKSCVLLIVIAGMERYAFKGVQSNLVTYLTDMVKMSNSAAAKTVNTWAGFTSMLPLF  69

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMG  513
             APLADSY D +STIL S+  Y +GL+ LT TA+G
Sbjct  70   SAPLADSYWDRFSTILFSSLLYFVGLVGLTWTALG  104



>ref|XP_006408493.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
 gb|ESQ49946.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
Length=569

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLGKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SAPLADAYWDRFFTILVSSSVYFVGLVGLTWTAFA---GSRSATKTISTYFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>ref|XP_010033250.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Eucalyptus grandis]
 gb|KCW52838.1| hypothetical protein EUGRSUZ_J02168 [Eucalyptus grandis]
Length=528

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            + LNK C+LL+VIAGMERF FKGVA+NLVTYLT+V KMSNSSAAK+VN WCG TS++PLL
Sbjct  3    RRLNKACVLLMVIAGMERFVFKGVASNLVTYLTEVMKMSNSSAAKMVNAWCGLTSLLPLL  62

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLI  582
            VAPLADSY D YST+L  + FY++GL+ALTSTA+   W P S   +   S  L W L LI
Sbjct  63   VAPLADSYWDRYSTVLSFSLFYVVGLVALTSTALESAWHPPS---KPDYSPYLFWSLCLI  119

Query  583  SLGL  594
            S+GL
Sbjct  120  SVGL  123



>gb|KFK37592.1| hypothetical protein AALP_AA3G003400 [Arabis alpina]
Length=567

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +G  K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGFGKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             APLAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SAPLADAYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTYFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  VGL  127



>ref|XP_006432899.1| hypothetical protein CICLE_v10003886mg [Citrus clementina]
 ref|XP_006494124.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Citrus sinensis]
 gb|ESR46139.1| hypothetical protein CICLE_v10003886mg [Citrus clementina]
Length=508

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 92/121 (76%), Gaps = 1/121 (1%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL K C++LIVIAG ERF FKGVA+NLVTYLTDV KMSNSSAAK V++W G TSM+PLL+
Sbjct  2    GLCKSCLMLIVIAGKERFAFKGVASNLVTYLTDVMKMSNSSAAKTVSSWNGLTSMLPLLL  61

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
            APLADSY D +STIL  +F Y+LGL+ALTSTA  W     N     SS L  PL LISLG
Sbjct  62   APLADSYWDRHSTILAFSFIYVLGLMALTSTAFAWAESPANTTS-CSSFLFLPLSLISLG  120

Query  592  L  594
            L
Sbjct  121  L  121



>ref|XP_009108657.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Brassica rapa]
Length=251

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA G+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  2    MAEGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  61

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  62   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTYTAF---DGSRSTTKTISLYFLY  118

Query  565  WPLHLISLGL  594
              L LI+LGL
Sbjct  119  TSLSLIALGL  128



>ref|XP_006299737.1| hypothetical protein CARUB_v10015930mg [Capsella rubella]
 gb|EOA32635.1| hypothetical protein CARUB_v10015930mg [Capsella rubella]
Length=684

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K C LLIVIAGMER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL 
Sbjct  8    RGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLF  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLIS  585
             A LAD+Y D + TIL S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S
Sbjct  68   SASLADAYWDRFFTILASSSVYFVGLVGLTWTAFA---GSRSATKTISTCFLYSSLCLVS  124

Query  586  LGL  594
            +GL
Sbjct  125  IGL  127



>dbj|BAE98864.1| oligopeptide transporter - like protein [Arabidopsis thaliana]
Length=530

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTFTAFA---GSRSTTKTISLYFLY  117

Query  565  WPLHLISLGL  594
              L L++LGL
Sbjct  118  TSLSLVALGL  127



>ref|NP_196998.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9LFR1.1|PTR50_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.8; Short=AtNPF5.8 [Arabidopsis 
thaliana]
 emb|CAC01813.1| oligopeptide transporter-like protein [Arabidopsis thaliana]
 gb|AED92094.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=552

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTFTAFA---GSRSTTKTISLYFLY  117

Query  565  WPLHLISLGL  594
              L L++LGL
Sbjct  118  TSLSLVALGL  127



>emb|CDY09902.1| BnaC09g42590D [Brassica napus]
Length=264

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 87/129 (67%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   +GL+K C LLI+IAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGDKRRGLSKSCALLIMIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA  +    +    IS   L  
Sbjct  61   TFMLPLFSAPFADSYGDRFFTILASSSLYFVGLVGLTLTA--FAGSRSTTTTISIFFLYT  118

Query  568  PLHLISLGL  594
             L L++LGL
Sbjct  119  SLSLVALGL  127



>ref|XP_006400015.1| hypothetical protein EUTSA_v10013156mg [Eutrema salsugineum]
 gb|ESQ41468.1| hypothetical protein EUTSA_v10013156mg [Eutrema salsugineum]
Length=554

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTYTAFA---GSRSTTKTISLYFLY  117

Query  565  WPLHLISLGL  594
              L L++LGL
Sbjct  118  TSLCLVALGL  127



>ref|XP_003554136.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Glycine max]
Length=540

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   Q LNK CILLI IAG+ERF FKGVA+NLVTYLTDV  +SNSSAAK+VN+W GF
Sbjct  1    MAGGRRQQRLNKSCILLIAIAGIERFAFKGVASNLVTYLTDVVNLSNSSAAKMVNSWVGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILG  483
            TS++PLLVAP+AD+Y   YSTI+ S+F Y +G
Sbjct  61   TSIMPLLVAPIADAYWHKYSTIMVSSFLYFVG  92



>gb|KHN34167.1| Putative peptide/nitrate transporter [Glycine soja]
Length=540

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   Q LNK CILLI IAG+ERF FKGVA+NLVTYLTDV  +SNSSAAK+VN+W GF
Sbjct  1    MAGGRRQQRLNKSCILLIAIAGIERFAFKGVASNLVTYLTDVVNLSNSSAAKMVNSWVGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILG  483
            TS++PLLVAP+AD+Y   YSTI+ S+F Y +G
Sbjct  61   TSIMPLLVAPIADAYWHKYSTIMVSSFLYFVG  92



>gb|KFK25731.1| hypothetical protein AALP_AA8G152400 [Arabis alpina]
Length=428

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            M+GG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MSGGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTFTAFA---GSRSTTKTISLYFLY  117

Query  565  WPLHLISLGL  594
              L L++LGL
Sbjct  118  TSLSLVALGL  127



>ref|XP_002873698.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49957.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=554

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTFTAYA---GSRSTTKTISLYFLY  117

Query  565  WPLHLISLGL  594
              L L++LGL
Sbjct  118  TSLSLVALGL  127



>ref|XP_009114672.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Brassica rapa]
Length=358

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA G+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  2    MAEGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  61

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  62   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTYTAFD---GSRSTTKTISLYFLY  118

Query  565  WPLHLISLGL  594
              L LI+LGL
Sbjct  119  TSLSLIALGL  128



>ref|XP_009121620.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Brassica rapa]
Length=562

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   +GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGDKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYGDRFFTILASSSLYFVGLVGLTLTAFA---GSRSTTKTISIFFLY  117

Query  565  WPLHLISLGL  594
              L L++LGL
Sbjct  118  TSLSLVALGL  127



>gb|AES74588.2| peptide/nitrate transporter plant-like protein [Medicago truncatula]
Length=541

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 3/92 (3%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ    L+  CILLIVIAG+ERF FKGVA+NLVTYLTDV  +SNSSAAK+VN+W GF
Sbjct  1    MAGGQKTKRLSNSCILLIVIAGIERFAFKGVASNLVTYLTDVVDLSNSSAAKMVNSWVGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILG  483
            TS++PLLVAP+AD+Y   YSTI+ S+F Y++G
Sbjct  61   TSIMPLLVAPIADAYWAKYSTIMSSSFLYVMG  92



>ref|XP_006287415.1| hypothetical protein CARUB_v10000620mg [Capsella rubella]
 gb|EOA20313.1| hypothetical protein CARUB_v10000620mg [Capsella rubella]
Length=553

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C+LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRKGLSKSCVLLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            T M+PL  AP ADS  D + TIL S+  Y LGL+ LT TA  +    + ++ IS   L  
Sbjct  61   TFMLPLFSAPFADSCWDRFFTILASSCVYFLGLVGLTFTA--YARSRSTSKTISLYFLYT  118

Query  568  PLHLISLGL  594
             L L++LGL
Sbjct  119  SLSLVALGL  127



>emb|CDX85576.1| BnaA02g02370D [Brassica napus]
Length=543

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA G+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAEGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTYTAFD---GSRSTTKTISLYFLY  117

Query  565  WPLHLISLGL  594
              L LI+LGL
Sbjct  118  TSLSLIALGL  127



>ref|XP_010928216.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Elaeis guineensis]
Length=528

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 11/122 (9%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL+K C+L+IV+AG+ERF +KGVA+NLVTYLTDV KMS SSAAK ++ W G TSM+PL+ 
Sbjct  9    GLSKSCVLIIVVAGVERFAYKGVASNLVTYLTDVVKMSTSSAAKSISTWVGLTSMLPLVS  68

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLIS  585
            A LADSY D YSTI  S+  Y++GL+ LT  A+   W P         +SSL  PL+LIS
Sbjct  69   AILADSYWDRYSTITASSLLYVMGLVGLTLWALLYAWMP---------ASSLFIPLYLIS  119

Query  586  LG  591
            +G
Sbjct  120  IG  121



>ref|XP_009126016.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brassica rapa]
Length=544

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA G+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  2    MAEGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  61

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  62   TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTYTAFD---GSRSTTKTISLYFLY  118

Query  565  WPLHLISLGL  594
              L LI+LGL
Sbjct  119  TSLSLIALGL  128



>emb|CDY65044.1| BnaA10g29780D [Brassica napus]
Length=558

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   +GL+K C LLI+IAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGDKRRGLSKSCALLIMIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLS  564
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA     GS +  K IS   L 
Sbjct  61   TFMLPLFSAPFADSYGDRFFTILASSSLYFVGLVGLTLTAFA---GSRSTTKTISIFFLY  117

Query  565  WPLHLISLGL  594
              L L++LGL
Sbjct  118  TSLSLVALGL  127



>dbj|BAF00457.1| oligopeptide transporter - like protein [Arabidopsis thaliana]
Length=101

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTS  501
            T M+PL  AP ADSY D + TIL S+  Y + +I++ S
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFVVIISIPS  98



>emb|CDY70256.1| BnaCnng67440D [Brassica napus]
Length=561

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 87/129 (67%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   +GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGGKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            T M+PL  AP ADSY D + TIL S+  Y +GL+ LT TA  +    +    IS   L  
Sbjct  61   TFMLPLFSAPFADSYGDRFFTILASSSLYFVGLVGLTLTA--FAGSRSTTTTISIFFLYT  118

Query  568  PLHLISLGL  594
             L L++LGL
Sbjct  119  SLSLVALGL  127



>ref|XP_010492315.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Camelina sativa]
Length=550

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRKGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            T M+PL  AP ADS  D + TIL S+  Y +GL+ LT TA  +    + ++ IS   L  
Sbjct  61   TFMLPLFSAPFADSCWDRFFTILASSSLYFVGLVGLTFTA--YARSRSTSKTISLYFLYT  118

Query  568  PLHLISLGL  594
             L L++LGL
Sbjct  119  SLSLVALGL  127



>emb|CDY69851.1| BnaCnng65650D [Brassica napus]
Length=563

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 87/129 (67%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   +GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGGKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            T M+PL  AP ADSY + + TIL S+  Y +GL+ LT TA  +    +    IS   L  
Sbjct  61   TFMLPLFSAPFADSYRERFFTILASSSLYFVGLVGLTLTA--FAGSRSTTTTISIFFLYT  118

Query  568  PLHLISLGL  594
             L L++LGL
Sbjct  119  SLSLVALGL  127



>ref|XP_010420140.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Camelina sativa]
Length=550

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRKGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            T M+PL  AP ADS  D + TIL S+  Y +GL+ LT TA  +    + ++ +S   L  
Sbjct  61   TFMLPLFSAPFADSCWDRFFTILASSSLYFVGLVGLTFTA--YAKSRSTSKTVSLYFLYT  118

Query  568  PLHLISLGL  594
             L L++LGL
Sbjct  119  SLSLVALGL  127



>ref|XP_008793797.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X1 [Phoenix 
dactylifera]
Length=528

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 7/120 (6%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL K C+L+IV+A +ERF +KGVA+NLVTYLTDV KMS SSAAK ++ W G TSM+PL+ 
Sbjct  9    GLGKSCVLIIVVASVERFAYKGVASNLVTYLTDVVKMSTSSAAKSISTWVGLTSMLPLVS  68

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
            A LADSY D YSTI+ S+  Y++GL+ LT  A+          ++ +SSL  PL+LIS+G
Sbjct  69   AILADSYWDRYSTIMASSLLYVMGLVGLTLWAL-------LCARMPASSLFIPLYLISVG  121



>gb|EEE65415.1| hypothetical protein OsJ_20762 [Oryza sativa Japonica Group]
Length=174

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 86/119 (72%), Gaps = 7/119 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++ C+++IV+A +ERF +KGVA+NLVTYLT+V +MS S+AAK V+ W G TSM+PLL A
Sbjct  15   LSRACVMIIVVASVERFAYKGVASNLVTYLTEVVEMSTSAAAKSVSAWSGVTSMLPLLTA  74

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             LADSY D YSTI  S+  Y++GLI LT  A+          +I  S+L +PL+LIS+G
Sbjct  75   VLADSYWDRYSTITASSLLYVVGLIGLTLWAL-------LHTRIPCSTLFFPLYLISIG  126



>ref|XP_010453622.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Camelina sativa]
Length=550

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAGGEKRKGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSW  567
            T M+PL  AP ADS  D + TIL S+  Y +GL+ LT TA  +    + ++ +S   L  
Sbjct  61   TFMLPLFSAPFADSCWDRFFTILASSSLYFVGLVGLTFTA--YARSRSTSKTVSLYFLYT  118

Query  568  PLHLISLGL  594
             L L++LGL
Sbjct  119  SLSLVALGL  127



>ref|XP_003543540.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Glycine max]
 gb|KHN13270.1| Putative peptide/nitrate transporter [Glycine soja]
Length=540

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 3/92 (3%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA GQ    L+K CILLI IAG+ERF FKGVA+NLVTYLTDV  +SNSSAAK+VN+W GF
Sbjct  1    MADGQRQQRLSKSCILLIAIAGIERFAFKGVASNLVTYLTDVVNLSNSSAAKMVNSWVGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILG  483
            TS++PLLVAP+AD+Y   YSTI+ S+F Y +G
Sbjct  61   TSIMPLLVAPIADAYWRKYSTIMVSSFLYFVG  92



>ref|XP_007151152.1| hypothetical protein PHAVU_004G022300g [Phaseolus vulgaris]
 gb|ESW23146.1| hypothetical protein PHAVU_004G022300g [Phaseolus vulgaris]
Length=541

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 3/92 (3%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAG Q    L++ CILLI IAG+ERF FKGVA+NLVTYLTDV  +SNSSAAK+VN+W GF
Sbjct  1    MAGAQRQQRLSRSCILLIAIAGIERFAFKGVASNLVTYLTDVVNLSNSSAAKMVNSWVGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILG  483
            TS++PLLVAP+AD+Y   YSTI+ S+F Y +G
Sbjct  61   TSIMPLLVAPIADAYWHKYSTIMVSSFLYFVG  92



>ref|XP_008798051.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Phoenix dactylifera]
Length=527

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 86/122 (70%), Gaps = 11/122 (9%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL+K C+L+IV+AG+ERF +KGVA+NLVTYL DV KMS SSAAK ++ W G TSM+PL+ 
Sbjct  9    GLSKSCVLIIVVAGVERFAYKGVASNLVTYLIDVVKMSTSSAAKSISTWVGLTSMLPLVS  68

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLIS  585
            A LADSY D YSTI+ S+  Y++GL  LT  A+   W P          SSL  PL+LIS
Sbjct  69   AILADSYWDRYSTIMASSLLYVVGLAGLTLWALLRAWMP---------PSSLFIPLYLIS  119

Query  586  LG  591
            +G
Sbjct  120  VG  121



>ref|XP_010913459.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X2 [Elaeis guineensis]
Length=521

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 86/122 (70%), Gaps = 11/122 (9%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL K C+L+IV+AG+ERF +KGVA+NLVTYL DV  MS SSAAK ++ W G TSM+PL+ 
Sbjct  9    GLGKSCVLIIVVAGVERFAYKGVASNLVTYLIDVVNMSTSSAAKSISTWVGLTSMLPLVS  68

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLIS  585
            A LADSY D  STI+ S+F Y++GL+ LT  A+   W P         +SSL  PL+LIS
Sbjct  69   AILADSYWDRCSTIMVSSFLYVMGLVGLTLWALLCAWMP---------TSSLFIPLYLIS  119

Query  586  LG  591
            +G
Sbjct  120  IG  121



>ref|XP_009401528.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Musa acuminata 
subsp. malaccensis]
Length=513

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 11/123 (9%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +GL+K CIL+IV+A +ERF +KGVA+NL++YLT   KMS SSAAK V+ W G TSM+PL+
Sbjct  8    RGLSKSCILIIVVASVERFAYKGVASNLLSYLTGHVKMSTSSAAKSVSTWIGVTSMLPLV  67

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLI  582
             A LADSY D YSTI+ S+  Y++GL+ LTS A+   W P         +SSL  PL+LI
Sbjct  68   SAILADSYWDRYSTIMASSLLYVIGLVGLTSWALLCAWMP---------TSSLFLPLYLI  118

Query  583  SLG  591
            S+G
Sbjct  119  SIG  121



>ref|XP_009413863.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 86/122 (70%), Gaps = 11/122 (9%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL+K CIL+I +A +ERF +KGVA+NL++YLTD  KMS SSAAK V+ W G TSM+PL  
Sbjct  14   GLSKSCILIIAVASVERFAYKGVASNLLSYLTDHVKMSTSSAAKSVSTWSGVTSMLPLAS  73

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLIS  585
            A LADSY D YSTI+ S+  YI+GL+ LTS A+   W P         +SSL  PL+LIS
Sbjct  74   AILADSYWDRYSTIMASSLLYIVGLVGLTSWALLCAWMP---------TSSLFLPLYLIS  124

Query  586  LG  591
            +G
Sbjct  125  IG  126



>emb|CDX91013.1| BnaC02g05840D [Brassica napus]
Length=113

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +1

Query  217  MAGGQ---GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MA G+   GL+K C LLIVIAG+ER+ FKGVA+NLVTYLTDV KMSNS AA  VN W GF
Sbjct  1    MAEGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF  60

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYIL  480
            T M+PL  AP ADSY D + TIL S+  Y +
Sbjct  61   TFMLPLFSAPFADSYWDRFFTILASSSLYFV  91



>gb|EAZ00313.1| hypothetical protein OsI_22330 [Oryza sativa Indica Group]
Length=280

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 7/119 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++ C+++IV+A +ERF +KGVA+NLVTYLT+V +MS S+AAK V+ W G TSM+PLL A
Sbjct  15   LSRACVMIIVVASVERFAYKGVASNLVTYLTEVVEMSTSAAAKSVSAWSGVTSMLPLLTA  74

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             LADSY D YSTI  S+  Y++GLI LT  A+          ++  S+L +PL+LIS+G
Sbjct  75   VLADSYWDRYSTITASSLLYVVGLIGLTLWAL-------LHTRMPCSTLFFPLYLISIG  126



>ref|XP_006656833.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide/nitrate transporter 
At5g14940-like [Oryza brachyantha]
Length=541

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 7/119 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++PC+L+IV+A +ERF +KGVA+NLVTYLTDV +MS S+AA+ V+ W G TSM+PL  A
Sbjct  19   LSRPCVLIIVVASVERFAYKGVASNLVTYLTDVVEMSTSAAARSVSTWSGVTSMLPLASA  78

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             +ADSY D YSTI  S+  Y++GLI LT  A+          ++  S+L +PL+LIS+G
Sbjct  79   VVADSYWDRYSTITASSLLYVVGLIGLTLWAL-------LHTRMPCSTLFFPLYLISVG  130



>gb|KDO43629.1| hypothetical protein CISIN_1g042477mg, partial [Citrus sinensis]
Length=478

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +1

Query  265  IAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSY  444
            IAG ERF FKGVA+NLVTYLTDV KMSNSSAAK V++W G TSM+PLL+APLADSY D +
Sbjct  1    IAGKERFAFKGVASNLVTYLTDVMKMSNSSAAKTVSSWNGLTSMLPLLLAPLADSYWDRH  60

Query  445  STILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLGL  594
            STIL  +F Y+LGL+ALTSTA  W     N     SS L  PL LISLGL
Sbjct  61   STILAFSFIYVLGLMALTSTAFAWAESPANTTS-CSSFLFLPLSLISLGL  109



>ref|XP_003618370.1| Peptide transporter family [Medicago truncatula]
Length=538

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 6/92 (7%)
 Frame = +1

Query  217  MAGGQG---LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGGQ    L+  CILLI   G+ERF FKGVA+NLVTYLTDV  +SNSSAAK+VN+W GF
Sbjct  1    MAGGQKTKRLSNSCILLI---GIERFAFKGVASNLVTYLTDVVDLSNSSAAKMVNSWVGF  57

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILG  483
            TS++PLLVAP+AD+Y   YSTI+ S+F Y++G
Sbjct  58   TSIMPLLVAPIADAYWAKYSTIMSSSFLYVMG  89



>ref|NP_001057261.1| Os06g0239500 [Oryza sativa Japonica Group]
 dbj|BAD37875.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAD37912.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAF19175.1| Os06g0239500 [Oryza sativa Japonica Group]
 dbj|BAG89295.1| unnamed protein product [Oryza sativa Japonica Group]
Length=535

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 7/119 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++ C+++IV+A +ERF +KGVA+NLVTYLT+V +MS S+AAK V+ W G TSM+PLL A
Sbjct  15   LSRACVMIIVVASVERFAYKGVASNLVTYLTEVVEMSTSAAAKSVSAWSGVTSMLPLLTA  74

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             LADSY D YSTI  S+  Y++GLI LT  A+          ++  S+L +PL+LIS+G
Sbjct  75   VLADSYWDRYSTITASSLLYVVGLIGLTLWAL-------LHTRMPCSTLFFPLYLISIG  126



>ref|XP_003560866.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brachypodium distachyon]
 ref|XP_010227802.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brachypodium distachyon]
 ref|XP_010227804.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brachypodium distachyon]
Length=538

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 12/122 (10%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L+ PCIL+IV+AG+ERF +KGVA NLVTYLT V +MS S+AAK V+ W G TSM+PL  A
Sbjct  20   LSTPCILIIVVAGVERFAYKGVACNLVTYLTGVVEMSTSAAAKSVSIWAGVTSMLPLFSA  79

Query  415  PLADSYL-DSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLIS  585
             LADSY  D YSTI+ S+  Y+ GLI LTS  +   W P          SSL +PL+LIS
Sbjct  80   VLADSYCWDRYSTIVASSLLYVAGLIGLTSWELLRKWMP---------RSSLFFPLYLIS  130

Query  586  LG  591
            +G
Sbjct  131  IG  132



>gb|EMT07879.1| Peptide transporter PTR5 [Aegilops tauschii]
Length=507

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 83/124 (67%), Gaps = 14/124 (11%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L +PCIL+IV+AG+ERF FKGVA+N+V YLT V  MS ++AA+ V+ W G TSM+PL+ A
Sbjct  11   LGRPCILIIVVAGVERFAFKGVASNMVNYLTGVVGMSTAAAAQSVSAWVGITSMLPLVSA  70

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMG-----WPPGSNNAQKISSSSLSWPLHL  579
             LADSY D YST+  S+  Y+ GL  L S A+G     W PG         ++L  PL+L
Sbjct  71   VLADSYWDRYSTVTASSLLYVAGLAGLASWALGTTLQRWRPG---------AALPLPLYL  121

Query  580  ISLG  591
            IS+G
Sbjct  122  ISIG  125



>ref|XP_009413865.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 85/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            GL+K CIL+I +A +ERF +KGVA+NL++YLTD  KMS SSAAK V+ W G TSM+PL  
Sbjct  14   GLSKSCILIIAVASVERFAYKGVASNLLSYLTDHVKMSTSSAAKSVSTWSGVTSMLPLAS  73

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLIS  585
            A LADSY D YSTI+ S+  YI GL+ LTS A+   W P         +SSL  PL+LIS
Sbjct  74   AILADSYWDRYSTIMASSLLYI-GLVGLTSWALLCAWMP---------TSSLFLPLYLIS  123

Query  586  LG  591
            +G
Sbjct  124  IG  125



>ref|XP_010420013.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=540

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +1

Query  274  MERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTI  453
            MER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL  APLAD+Y D + TI
Sbjct  1    MERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLFAAPLADAYWDRFFTI  60

Query  454  LGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLISLGL  594
            L S+  Y + L+ LT TA     GS +A K +S+  L   L LISLGL
Sbjct  61   LASSSVYFVALVGLTWTAFS---GSRSATKTVSTCFLYSSLGLISLGL  105



>ref|XP_007032333.1| Amino acid permease, putative isoform 2 [Theobroma cacao]
 gb|EOY03259.1| Amino acid permease, putative isoform 2 [Theobroma cacao]
Length=519

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 83/130 (64%), Gaps = 30/130 (23%)
 Frame = +1

Query  217  MAGG---QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGF  387
            MAGG   QGL++ CILLI                      DV KMSNSSAAK VN+WCGF
Sbjct  1    MAGGGRAQGLSRSCILLI----------------------DVVKMSNSSAAKTVNSWCGF  38

Query  388  TSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSL  561
            TSM+PLLVAPLADS+ D YSTIL S+F Y+LGL A+ STA+   W P SN +   SS+ L
Sbjct  39   TSMLPLLVAPLADSFWDRYSTILTSSFLYVLGLGAVASTALLWTWSPPSNTS---SSAFL  95

Query  562  SWPLHLISLG  591
             W L LISLG
Sbjct  96   FWSLCLISLG  105



>ref|XP_006408492.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
 gb|ESQ49945.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
Length=547

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +1

Query  274  MERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTI  453
            MER+ FKGVA+NLVTYLTDV KMSNS AAK VN W GFTSM+PL  APLAD+Y D + TI
Sbjct  1    MERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLFSAPLADAYWDRFFTI  60

Query  454  LGSAFFYILGLIALTSTAMGWPPGSNNAQK-ISSSSLSWPLHLISLGL  594
            L S+  Y +GL+ LT TA     GS +A K IS+  L   L L+S+GL
Sbjct  61   LVSSSVYFVGLVGLTWTAFA---GSRSATKTISTYFLYSSLCLVSIGL  105



>dbj|BAJ94556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L +PCIL+IV+AG+ERF FKGVA+N+V YLT V  MS ++AA+ V+ W G TSM+PL+ A
Sbjct  11   LARPCILIIVVAGVERFAFKGVASNMVNYLTGVVGMSTAAAAQNVSAWVGITSMLPLVSA  70

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLISL  588
             LADSY D YST+  S+  Y+ GL+ L S AM   W P          ++L  PL+LIS+
Sbjct  71   VLADSYWDRYSTVTASSLLYVAGLVGLASWAMLHKWMPW---------ATLFLPLYLISI  121

Query  589  G  591
            G
Sbjct  122  G  122



>dbj|BAK01715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L +PCIL+IV+AG+ERF FKGVA+N+V YLT V  MS ++AA+ V+ W G TSM+PL+ A
Sbjct  11   LARPCILIIVVAGVERFAFKGVASNMVNYLTGVVGMSTAAAAQNVSAWVGITSMLPLVSA  70

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLISL  588
             LADSY D YST+  S+  Y+ GL+ L S AM   W P          ++L  PL+LIS+
Sbjct  71   VLADSYWDRYSTVTASSLLYVAGLVGLASWAMLHKWMPW---------ATLFLPLYLISI  121

Query  589  G  591
            G
Sbjct  122  G  122



>dbj|BAD37873.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAD37910.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 gb|EAZ36431.1| hypothetical protein OsJ_20761 [Oryza sativa Japonica Group]
Length=521

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 81/119 (68%), Gaps = 7/119 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++ C+L+IV+A MER  +KGV +NLVTYLT+V +MS S+AAK V+ W G TSM+PLL A
Sbjct  7    LSRACVLIIVVASMERLAYKGVGSNLVTYLTEVVEMSTSAAAKSVSAWSGVTSMLPLLTA  66

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             L DSY D YSTI  S+ FY+  LI +   A+          ++  S+L +PL+LIS+G
Sbjct  67   VLTDSYWDRYSTITASSLFYVFVLIGVALVAL-------LRTRVPYSTLIFPLYLISIG  118



>ref|XP_010913458.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X1 [Elaeis guineensis]
Length=552

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 11/112 (10%)
 Frame = +1

Query  262  VIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDS  441
            V+AG+ERF +KGVA+NLVTYL DV  MS SSAAK ++ W G TSM+PL+ A LADSY D 
Sbjct  50   VVAGVERFAYKGVASNLVTYLIDVVNMSTSSAAKSISTWVGLTSMLPLVSAILADSYWDR  109

Query  442  YSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSSLSWPLHLISLG  591
             STI+ S+F Y++GL+ LT  A+   W P         +SSL  PL+LIS+G
Sbjct  110  CSTIMVSSFLYVMGLVGLTLWALLCAWMP---------TSSLFIPLYLISIG  152



>ref|XP_006856890.1| hypothetical protein AMTR_s00055p00208320 [Amborella trichopoda]
 gb|ERN18357.1| hypothetical protein AMTR_s00055p00208320 [Amborella trichopoda]
Length=509

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 5/111 (5%)
 Frame = +1

Query  262  VIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDS  441
            ++A +ERF +KGVA+NLVTYLTDV   SN  AAK V+ W G TSM+PLL A L DSY + 
Sbjct  14   MVASVERFAYKGVASNLVTYLTDVVHQSNGEAAKNVSTWAGLTSMLPLLGAFLTDSYFNR  73

Query  442  YSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLGL  594
            YSTI+ S+FFY+ GL+AL S A  +P G    + ISS+ +   L+LIS GL
Sbjct  74   YSTIILSSFFYLSGLVALASLAR-FPHG----KAISSAPIFGSLYLISFGL  119



>ref|XP_004965110.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Setaria italica]
Length=525

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 82/119 (69%), Gaps = 7/119 (6%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++PC+L+IV+AG+ERF  KGV +NLVTYLT V  MS ++AAK V  W G + M+PL  A
Sbjct  12   LSRPCVLIIVMAGVERFANKGVGSNLVTYLTGVVGMSTAAAAKSVVAWTGVSFMLPLFSA  71

Query  415  PLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             LADSY D YSTI  S+  Y+LG+ A+T+ A+         +++  S+L  PL+L+++G
Sbjct  72   ILADSYWDRYSTIAVSSLLYVLGMSAITAWAL-------LRKRMPRSTLFLPLYLMAIG  123



>ref|XP_008658869.1| PREDICTED: uncharacterized protein LOC100383435 isoform X2 [Zea 
mays]
 gb|ACN35262.1| unknown [Zea mays]
 gb|AFW85189.1| hypothetical protein ZEAMMB73_094848 [Zea mays]
Length=542

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 83/120 (69%), Gaps = 8/120 (7%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++PC+L+IV+AG+ERF  KGV +NLVTYLT V  MS ++AAK V  W G + M+PL+ A
Sbjct  12   LSRPCVLVIVMAGVERFANKGVGSNLVTYLTSVVGMSTAAAAKSVIAWNGVSFMLPLVSA  71

Query  415  PLADS-YLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             LADS + D Y TI  S+  Y+LG++ALT+ A+          ++  S+L +PL+L+S+G
Sbjct  72   VLADSAHWDRYCTIAASSLLYVLGMVALTTWAL-------LGTRMPRSTLFFPLYLMSIG  124



>ref|XP_002438139.1| hypothetical protein SORBIDRAFT_10g008670 [Sorghum bicolor]
 gb|EER89506.1| hypothetical protein SORBIDRAFT_10g008670 [Sorghum bicolor]
Length=538

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 82/120 (68%), Gaps = 8/120 (7%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++PC+L+I +AG+ERF  KGV +NLVTYLT V  MS ++AAK V  W G + M+PL+ A
Sbjct  18   LSRPCVLIIAMAGVERFANKGVGSNLVTYLTGVVGMSTAAAAKSVIAWNGVSFMLPLVSA  77

Query  415  PLADSYLDS-YSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             LADSY D  Y TI  S+  Y+LG++ALT+ A+          ++  S+L +PL+L+S+G
Sbjct  78   ILADSYWDDRYCTIAVSSLLYVLGMVALTTWAL-------LRTRMRRSTLFFPLYLMSIG  130



>ref|XP_004953900.1| PREDICTED: LOW QUALITY PROTEIN: putative peptide/nitrate transporter 
At3g01350-like [Setaria italica]
Length=528

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 81/128 (63%), Gaps = 20/128 (16%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L+KPC+L+IV+A +ERF +KGVA+NLVTYLTDV K  +SSAAK VN W G TSM+PL  A
Sbjct  10   LSKPCVLIIVVASVERFVYKGVASNLVTYLTDVVK--SSSAAKSVNTWNGVTSMLPLASA  67

Query  415  PLADSYLDSYSTI-LGSAFFYIL------GLIALTSTAM--GWPPGSNNAQKISSSSLSW  567
             LADS+ D YSTI   S  F I+      GL  L S AM   W P          S L  
Sbjct  68   ILADSFWDRYSTISCKSLTFSIILLILDQGLAGLASWAMLHSWLP---------RSLLFL  118

Query  568  PLHLISLG  591
            PL+LIS+G
Sbjct  119  PLYLISVG  126



>gb|AFW85190.1| hypothetical protein ZEAMMB73_094848 [Zea mays]
Length=100

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++PC+L+IV+AG+ERF  KGV +NLVTYLT V  MS ++AAK V  W G + M+PL+ A
Sbjct  12   LSRPCVLVIVMAGVERFANKGVGSNLVTYLTSVVGMSTAAAAKSVIAWNGVSFMLPLVSA  71

Query  415  PLADS-YLDSYSTILGSAFFYIL  480
             LADS + D Y TI  S+  Y+L
Sbjct  72   VLADSAHWDRYCTIAASSLLYVL  94



>gb|EAZ00312.1| hypothetical protein OsI_22329 [Oryza sativa Indica Group]
Length=563

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 82/151 (54%), Gaps = 34/151 (23%)
 Frame = +1

Query  235  LNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVA  414
            L++ C+L+IV+A MER  +KGVA+NLVTY T+V +MS ++AAK V+ W G TSM+PLL A
Sbjct  7    LSRACVLIIVVASMERLAYKGVASNLVTYPTEVVEMSTAAAAKGVSMWSGVTSMLPLLTA  66

Query  415  PLADSYLDSYSTI--------------LGSAFFYILGLIALTSTAMGWPPGSNNAQ----  540
             L DSY D YS I              LG  F ++  + A  ST +        A+    
Sbjct  67   VLTDSYWDRYSAITDSQPPPCSTSLTDLGQTFCFLQVMGA--STRLRHCEQEEEARMGGD  124

Query  541  --------------KISSSSLSWPLHLISLG  591
                          ++  S+L +PL+LIS+G
Sbjct  125  KGLIGVALVALLRTRVPYSTLIFPLYLISIG  155



>gb|EPS62614.1| hypothetical protein M569_12174, partial [Genlisea aurea]
Length=486

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query  262  VIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS-YLD  438
            V+ G ERF  KG++ANLV YLT+V  +SNSSAA+ VN W GFTSM+PL+VA  ADS   +
Sbjct  1    VVGGTERFVHKGISANLVIYLTEVIGLSNSSAARYVNTWVGFTSMLPLIVATAADSCCRN  60

Query  439  SYSTILGSAFFYILGLIALTSTAM  510
              S IL  A  Y+ GL+ALTS ++
Sbjct  61   RNSAILAFALPYVAGLLALTSRSL  84



>emb|CDP00908.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 6/117 (5%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  I +I +   ERF++ GVA NL+ YLTDV     + AAK VN W G +S+ PLL A +
Sbjct  14   KAAIFMICLEVAERFSYYGVAGNLINYLTDVLHQPTAVAAKNVNVWIGVSSIFPLLGALV  73

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
            ADSY+    TI  S+  Y++GL+ALT T    P  +  A  ++S      L+++S+G
Sbjct  74   ADSYMGRCKTIYVSSIVYLIGLVALTITVSTVPSSAREAIFLTS------LYIMSVG  124



>gb|AFK45252.1| unknown [Lotus japonicus]
Length=188

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A NL+TYLT+V     ++AAK VN W G +S+ PLL   +AD
Sbjct  28   AIFIIFVEFAERFAYQGLAGNLITYLTNVLNGPITTAAKNVNTWVGVSSLFPLLGGFVAD  87

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TI+ S+  Y+LG+I LT
Sbjct  88   SYLGRFNTIVMSSLIYLLGMIFLT  111



>gb|ABK24896.1| unknown [Picea sitchensis]
Length=574

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G  K  + +I +   ERF + G+ ANLV YLTDV   S ++AAK VN W G  SM+P L 
Sbjct  31   GRWKASLFIIGVEMAERFAYAGILANLVIYLTDVMDESTATAAKNVNVWTGVASMLPFLG  90

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTA  507
            A +ADSYL  Y TI  S+  Y+LGLI +T +A
Sbjct  91   AFVADSYLGRYWTIALSSVIYLLGLILVTLSA  122



>ref|XP_006403575.1| hypothetical protein EUTSA_v10010617mg [Eutrema salsugineum]
 gb|ESQ45028.1| hypothetical protein EUTSA_v10010617mg [Eutrema salsugineum]
Length=279

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            + +IV+   ERF F G+A+NL+TYLT+    S ++AAK +N W G + + P+L A LADS
Sbjct  20   VFIIVVEMTERFAFYGLASNLMTYLTNELGQSTATAAKHINTWIGVSCIFPILGAFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L S+F Y+LG++ L
Sbjct  80   ILGRFKTVLLSSFIYLLGMVML  101



>ref|XP_010276617.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Nelumbo nucifera]
Length=554

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF + G+  NL+TYLTDV   S ++AAK VN W G T+++PLL A +AD
Sbjct  25   AIYIIGVEIAERFAYYGMFGNLMTYLTDVLGESTATAAKNVNIWFGITTLLPLLGAVIAD  84

Query  427  SYLDSYSTILGSAFFYILGLIALT-STAMGWPP  522
            SYL  +  I  S+  Y++GL+ LT ST    PP
Sbjct  85   SYLGRFKAIFFSSLIYLMGLVMLTVSTTKAIPP  117



>ref|XP_006830430.1| hypothetical protein AMTR_s00118p00123330 [Amborella trichopoda]
 gb|ERM97846.1| hypothetical protein AMTR_s00118p00123330 [Amborella trichopoda]
Length=183

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 60/104 (58%), Gaps = 3/104 (3%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  I +I     ERF +  +  NL+TYLTD      ++A+K VN W G   +VPLL A +
Sbjct  38   KSSIYIIGAEVAERFAYYAILLNLITYLTDYLAEDTATASKNVNIWSGVACVVPLLGAFV  97

Query  421  ADSYLDSYSTILGSAFFYILGLIALT-STAMGW--PPGSNNAQK  543
            ADSYL  Y TI+ S+  Y+LGL+ LT S  + W  P G  NA K
Sbjct  98   ADSYLGRYKTIILSSVIYLLGLVMLTLSAVLPWLRPDGCWNAAK  141



>ref|XP_006420719.1| hypothetical protein CICLE_v10006572mg, partial [Citrus clementina]
 gb|ESR33959.1| hypothetical protein CICLE_v10006572mg, partial [Citrus clementina]
Length=561

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I++   +RF + G+A NL+ YLT+V     ++AA+ VNNW G +S+ PLL A +AD
Sbjct  37   AIFIIMVEMAQRFAYYGLAGNLIQYLTNVLNEPTATAAQDVNNWVGISSIFPLLGAFVAD  96

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+F Y +G++ L+
Sbjct  97   SYLGRFNTILLSSFIYFMGMVLLS  120



>ref|XP_006470865.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Citrus sinensis]
Length=572

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I++   +RF + G+A NL+ YLT+V     ++AA+ VNNW G +S+ PLL A +ADS
Sbjct  38   IFIIMVEMAQRFAYYGLAGNLIQYLTNVLNEPTATAAQDVNNWVGISSIFPLLGAFVADS  97

Query  430  YLDSYSTILGSAFFYILGLIALT  498
            YL  ++TIL S+F Y +G++ L+
Sbjct  98   YLGRFNTILLSSFIYFMGMVLLS  120



>gb|KGN50307.1| hypothetical protein Csa_5G167000 [Cucumis sativus]
Length=378

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + GV++NL+ +LTD  + S  +AAK VN W G  S++PLL A LADS+
Sbjct  34   LIIGVEVAERFAYYGVSSNLINFLTDQLQQSTVTAAKNVNAWSGTASLLPLLGAFLADSF  93

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSS  555
            L  Y TI+ S+  YILGL  LT +A+   P ++  Q+   S
Sbjct  94   LGRYWTIVLSSALYILGLGLLTMSALIPSPSTSACQQTEKS  134



>gb|AHA84209.1| oligopeptide transporter-like protein [Phaseolus vulgaris]
Length=582

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A+NL+ YLT+V     + AAK VN W G +S+ PLL   +AD
Sbjct  29   AIFIIFVEFAERFAYQGLASNLIQYLTNVLNEPITQAAKDVNTWVGASSLFPLLGGFIAD  88

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+  Y+LG+I LT
Sbjct  89   SYLGRFNTILFSSLIYLLGMIFLT  112



>gb|KHN06992.1| Putative peptide/nitrate transporter [Glycine soja]
Length=577

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 13/127 (10%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER ++ G+A +LV YLT V      +AA+ VN W G T+++PL    +
Sbjct  25   KAALFIIAIETSERLSYFGIATSLVLYLTKVMHQELKTAARNVNYWAGVTTLMPLFGGFI  84

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGW------PPGSNN----AQKISSSSLSWP  570
            AD+YL  YST+L S F Y++GL+ LT   + W      P G  N     ++I        
Sbjct  85   ADAYLGRYSTVLASCFVYLIGLVLLT---LSWFLPSLKPCGDTNMCTEPRRIHEVVFFLA  141

Query  571  LHLISLG  591
            ++LIS+G
Sbjct  142  IYLISIG  148



>ref|XP_008437003.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
 ref|XP_008437004.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
Length=563

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + GV++NL+ +LTD  + S  +AAK VN W G  S++PLL A LADS+
Sbjct  34   LIIGVEVAERFAYYGVSSNLINFLTDQLQQSTVTAAKNVNAWSGTASLLPLLGAFLADSF  93

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSS  555
            L  Y TI+ S+  YILGL  LT +A+   P ++  Q+   S
Sbjct  94   LGRYWTIVLSSALYILGLGLLTMSALISSPSTSACQQTEKS  134



>ref|XP_006602614.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=593

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 13/127 (10%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER ++ G+A +LV YLT V      +AA+ VN W G T+++PL    +
Sbjct  41   KAALFIIAIETSERLSYFGIATSLVLYLTKVMHQELKTAARNVNYWAGVTTLMPLFGGFI  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGW------PPGSNN----AQKISSSSLSWP  570
            AD+YL  YST+L S F Y++GL+ LT   + W      P G  N     ++I        
Sbjct  101  ADAYLGRYSTVLASCFVYLIGLVLLT---LSWFLPSLKPCGDTNMCTEPRRIHEVVFFLA  157

Query  571  LHLISLG  591
            ++LIS+G
Sbjct  158  IYLISIG  164



>ref|XP_006339007.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Solanum tuberosum]
Length=589

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +1

Query  217  MAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSM  396
            + G  G+ K  + +IVI   ER ++ G+A +L+ YLT V      +AAK VN W G T++
Sbjct  32   LRGSTGVWKASLFIIVIEFSERLSYFGLATSLIIYLTKVIHQDLKTAAKSVNYWSGVTTL  91

Query  397  VPLLVAPLADSYLDSYSTILGSAFFYILGLIALT  498
            +PLL   LAD++L  +ST+L S+  Y+LGLI LT
Sbjct  92   MPLLGGFLADAFLGRFSTVLASSIVYLLGLILLT  125



>ref|XP_007133765.1| hypothetical protein PHAVU_011G207100g [Phaseolus vulgaris]
 gb|ESW05759.1| hypothetical protein PHAVU_011G207100g [Phaseolus vulgaris]
Length=605

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A+NL+ YLT+V     + AAK VN W G +S+ PLL   +AD
Sbjct  58   AIFIIFVEFAERFAYQGLASNLIQYLTNVLNEPITQAAKDVNTWVGASSLFPLLGGFIAD  117

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+  Y+LG+I LT
Sbjct  118  SYLGRFNTILFSSLIYLLGMIFLT  141



>gb|EPS64734.1| hypothetical protein M569_10046, partial [Genlisea aurea]
Length=300

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 69/122 (57%), Gaps = 3/122 (2%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G  K    LI +   ERF + G+++NL+TYLT     S +SAA  VN W G +S++PL V
Sbjct  37   GCWKSAAFLIGVEVPERFGYYGISSNLITYLTGPLGQSTASAAANVNAWSGASSLLPLFV  96

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPG---SNNAQKISSSSLSWPLHLI  582
            A  ADS+L  + TIL ++  YILGL  LT +A+ +  G   + NA   S   L   L  I
Sbjct  97   AFFADSFLGRHRTILLASALYILGLGCLTLSAVIYSSGCQTTTNASSCSPPGLQIVLFFI  156

Query  583  SL  588
            SL
Sbjct  157  SL  158



>ref|XP_006292507.1| hypothetical protein CARUB_v10018737mg, partial [Capsella rubella]
 gb|EOA25405.1| hypothetical protein CARUB_v10018737mg, partial [Capsella rubella]
Length=552

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +IV+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + M P+L   LADS
Sbjct  20   IFIIVVEMTERFAFYGLASNLITFLTNELGQSTATAAKQINTWIGVSCMFPILGGFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L S+F Y+LG++ L
Sbjct  80   ILGRFKTVLLSSFIYLLGIVML  101



>ref|XP_004143744.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101218147 
[Cucumis sativus]
Length=1122

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + GV++NL+ +LTD  + S  +AAK VN W G  S++PLL A LADS+
Sbjct  34   LIIGVEVAERFAYYGVSSNLINFLTDQLQQSTVTAAKNVNAWSGTASLLPLLGAFLADSF  93

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSS  555
            L  Y TI+ S+  YILGL  LT +A+   P ++  Q+   S
Sbjct  94   LGRYWTIVLSSALYILGLGLLTMSALIPSPSTSACQQTEKS  134


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 68/112 (61%), Gaps = 0/112 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + GV++NL+ +LTD    S ++AAK VN W G  +++PLL A LAD +
Sbjct  590  LIIAVEIAERFAYFGVSSNLINFLTDQLHQSTATAAKNVNTWSGTATLLPLLGAFLADCF  649

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISL  588
            L  Y TI+ S+  YILGL  LT  A   P    +A + + +SL+   +L+ +
Sbjct  650  LGRYRTIVFSSALYILGLGFLTVYATLLPSPDISACQQTENSLTCSPNLVQV  701



>ref|XP_010262662.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Nelumbo nucifera]
Length=593

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I I   ER ++ G+A NL+ YLT V      +AAK VN W G T+++PL+ 
Sbjct  40   GVWKAALFIIAIEFSERLSYFGIATNLIIYLTKVLHQDLETAAKNVNYWSGVTTLMPLIG  99

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM  510
              +AD+Y+  +ST+L S+F Y+ GLI LT + +
Sbjct  100  GFIADAYMGRFSTVLVSSFIYLFGLILLTMSVL  132



>ref|XP_006843060.1| hypothetical protein AMTR_s00186p00036810 [Amborella trichopoda]
 gb|ERN04735.1| hypothetical protein AMTR_s00186p00036810 [Amborella trichopoda]
Length=582

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +1

Query  214  AMAGGQGLN-----KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNW  378
            A  GG+G +        I +I +   ERF + G ++N++TYLT     S ++AAK VN W
Sbjct  27   AAVGGRGRSATGGWSAAIYIIWVEVAERFAYNGASSNMMTYLTRYLHQSTATAAKNVNVW  86

Query  379  CGFTSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM  510
             G  +++PLL A +ADSY+  Y TI+ S+F Y++GL  LT +A+
Sbjct  87   NGVATIIPLLGAFIADSYMGRYPTIIVSSFIYVMGLSMLTLSAI  130



>ref|XP_010312293.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Solanum lycopersicum]
Length=591

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +1

Query  217  MAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSM  396
            + G  G+ K  + +IVI   ER ++ G+A +L+ YLT V      +AAK VN W G T++
Sbjct  32   LRGSTGVWKASLFIIVIEFSERLSYFGLATSLIIYLTKVIHQDLKTAAKSVNYWSGVTTL  91

Query  397  VPLLVAPLADSYLDSYSTILGSAFFYILGLIALT  498
            +PLL   LAD++L  +ST+L S+  Y++GLI LT
Sbjct  92   MPLLGGFLADAFLGRFSTVLASSIVYLVGLILLT  125



>ref|XP_002266676.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4 [Vitis vinifera]
Length=575

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +G  +  I +I +   ERF + GVA NL TYLT+V     ++AAK VN W G +++ PLL
Sbjct  28   KGRWRAAIFIIFVEMAERFAYYGVAGNLFTYLTNVLGEHTATAAKNVNTWVGVSAIFPLL  87

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALT  498
               +ADSYL  + TI+ S+  Y+ GL+ +T
Sbjct  88   GGFIADSYLGRFKTIIASSVIYLAGLLLMT  117



>gb|KGN50309.1| hypothetical protein Csa_5G167020 [Cucumis sativus]
Length=310

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 61/101 (60%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + GV++NL+ +LTD    S ++AAK VN W G  +++PLL A LAD +
Sbjct  34   LIIAVEIAERFAYFGVSSNLINFLTDQLHQSTATAAKNVNTWSGTATLLPLLGAFLADCF  93

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSS  555
            L  Y TI+ S+  YILGL  LT  A    P  +  Q+  +S
Sbjct  94   LGRYRTIVFSSALYILGLGFLTVYATLPSPDISACQETENS  134



>ref|XP_002876254.1| hypothetical protein ARALYDRAFT_348537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52513.1| hypothetical protein ARALYDRAFT_348537 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            + +IV+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + M P+L A LADS
Sbjct  20   VFIIVVEMAERFAFYGLASNLITFLTNELGQSTATAAKHINTWIGVSCMFPILGAFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L ++F Y+LG++ L
Sbjct  80   ILGRFKTVLLTSFVYLLGMVML  101



>ref|XP_010256764.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Nelumbo nucifera]
Length=598

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ +  + +I I   ER ++ G+A NL+TYLT V      +AAK VN W G T+M+PL+ 
Sbjct  42   GVWRASLFIIAIEFSERLSYFGIATNLITYLTKVIHQDLKTAAKNVNYWSGVTTMMPLMG  101

Query  412  APLADSYLDSYSTILGSAFFYILGL  486
              LADSY   +ST+L S+F Y LGL
Sbjct  102  GFLADSYWGRFSTVLVSSFIYFLGL  126



>emb|CBI40153.3| unnamed protein product [Vitis vinifera]
Length=1794

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +1

Query  229  QGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLL  408
            +G  +  I +I +   ERF + GVA NL TYLT+V     ++AAK VN W G +++ PLL
Sbjct  21   KGRWRAAIFIIFVEMAERFAYYGVAGNLFTYLTNVLGEHTATAAKNVNTWVGVSAIFPLL  80

Query  409  VAPLADSYLDSYSTILGSAFFYILGLIALT  498
               +ADSYL  + TI+ S+  Y+ GL+ +T
Sbjct  81   GGFIADSYLGRFKTIIASSVIYLAGLLLMT  110


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  223   GGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVP  402
             G  G  K    +I++   ERFTF GV  NLVTY T+V   + S+AAK VN W G + ++P
Sbjct  1307  GTSGGWKSAAFIILVEIAERFTFYGVLGNLVTYFTNVLGQTISTAAKNVNTWVGVSMILP  1366

Query  403   LLVAPLADSYLDSYSTILGSAFFYILGLIAL  495
             +  A +ADSYL  + TI+ ++  Y+LG + L
Sbjct  1367  IFGAAVADSYLGRFKTIIIASVIYLLGAVLL  1397


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  I +I +   ERF++ GV+ NL+TYLT V     ++AAK VN W G + + P+L A +
Sbjct  652  RSAIFVIFVEVAERFSYYGVSGNLITYLTIVLGQPTATAAKNVNMWAGVSMVSPILGAIV  711

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSYL  + TI+ S+  Y +G++ LT
Sbjct  712  ADSYLGRFKTIIISSIIYFMGVLLLT  737



>ref|XP_004143743.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101217910 
[Cucumis sativus]
Length=1096

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + GV++NL+ +LTD    S ++AAK VN W G  +++PLL A LAD +
Sbjct  590  LIIAVEIAERFAYFGVSSNLINFLTDQLHQSTATAAKNVNTWSGTATLLPLLGAFLADCF  649

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK  543
            L  Y TI+ S+  YILGL  LT +A+   P ++  Q+
Sbjct  650  LGRYRTIVLSSALYILGLGLLTMSALIPSPSTSACQQ  686


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF F G ++NL+ +LTD  + S + AAK VN W G  +++PLL A LAD +
Sbjct  34   LIIGVEVAERFAFYGASSNLINFLTDQLQQSTAMAAKNVNIWSGTAALLPLLGAFLADCF  93

Query  433  LDSYSTILGSAFFYILGLIALTSTA  507
            L  Y TI+ S+  Y+LGL  LT +A
Sbjct  94   LGRYRTIVLSSALYVLGLGLLTLSA  118



>ref|XP_009771569.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana sylvestris]
Length=595

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 6/126 (5%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +IVI   ER ++ G+A +L+ YLT V      +AAK VN W G T+++PLL 
Sbjct  43   GVWKASLFIIVIEFSERLSYFGIATSLIIYLTKVIHQDLKTAAKSVNYWSGVTTLMPLLG  102

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNN----AQKISSSSLSWPL  573
              LAD+YL  +ST+L S+  Y LGL+ LT + +     P   N     +K+        +
Sbjct  103  GFLADAYLGRFSTVLVSSTVYFLGLLLLTMSRVVPSLKPCDGNLCDEPRKVHEPIFFLAI  162

Query  574  HLISLG  591
            +LISLG
Sbjct  163  YLISLG  168



>ref|XP_010108379.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXC19370.1| putative peptide/nitrate transporter [Morus notabilis]
Length=350

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = +1

Query  217  MAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSM  396
            +    G+ K  + +I I   ER  + G++ NL+TYLT +     + AAK VN W G T++
Sbjct  31   LRASTGVWKASLFIIPIELSERLNYFGISTNLITYLTKIIHQDLNMAAKNVNYWSGVTTV  90

Query  397  VPLLVAPLADSYLDSYSTILGSAFFYILGLIALT-----------STAMGWPPGSNNAQK  543
            +PL+ A LADSY   ++ +L S+ FY++GL  LT           ST +G     N  +K
Sbjct  91   IPLVGAFLADSYTGRFTMVLFSSIFYLMGLFLLTMSQFIPSLKPCSTTIG---MCNKPRK  147

Query  544  ISSSSLSWPLHLISLG  591
            I        L++IS+G
Sbjct  148  IHEVVFFLALYMISIG  163



>ref|XP_006390699.1| hypothetical protein EUTSA_v10019829mg [Eutrema salsugineum]
 gb|ESQ27985.1| hypothetical protein EUTSA_v10019829mg [Eutrema salsugineum]
Length=496

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+++NL+TYLT     S +SAA  VN W G  S +PLL + +AD++L  Y TI+
Sbjct  3    ERFAYFGISSNLITYLTRPLGESTASAAANVNAWIGTVSFLPLLWSFIADAFLGRYRTII  62

Query  457  GSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
             S+  YILGL  L+ +AM  P  SN++ ++  +     L+LI++G
Sbjct  63   FSSSLYILGLALLSFSAM-IPSHSNDSNQLQVALFFCSLYLIAIG  106



>ref|XP_007011003.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY19813.1| Major facilitator superfamily protein [Theobroma cacao]
Length=581

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF F G+A NL+ YLT+      ++AAK VN W G +++ PLL A +AD
Sbjct  35   AIFVIFVEMAERFAFYGLAGNLIQYLTNNLGEPVATAAKNVNTWIGVSAIFPLLGAFVAD  94

Query  427  SYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNA  537
            SYL  + TIL S+F Y LG++ L+ +    P  S  A
Sbjct  95   SYLGRFKTILASSFIYFLGMVLLSLSVSVIPMHSRKA  131



>ref|XP_003634604.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Vitis 
vinifera]
Length=572

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G  +    +I +   ERF + G+ ANL+ YLT    +S ++AA+ VN W G   ++PL+ 
Sbjct  36   GCWRSAYFIIGVEVAERFAYSGIQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVG  95

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK  543
            A +ADSYL  Y TI+ ++F YILGL  LT +A+   P  ++ QK
Sbjct  96   AFVADSYLGRYRTIIIASFLYILGLGLLTLSAVLPSPSPSDCQK  139



>gb|KDO49053.1| hypothetical protein CISIN_1g0085651mg, partial [Citrus sinensis]
Length=519

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            +RF + G+A NL+ YLT+V     ++AA+ VNNW G +S+ PLL A +ADSYL  ++TIL
Sbjct  5    QRFAYYGLAGNLIQYLTNVLNEPTATAAQDVNNWVGISSIFPLLGAFVADSYLGRFNTIL  64

Query  457  GSAFFYILGLIALT  498
             S+F Y +G++ L+
Sbjct  65   LSSFIYFMGMVLLS  78



>ref|NP_974431.2| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9M1I2.1|PTR46_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.4; Short=AtNPF5.4 [Arabidopsis 
thaliana]
 emb|CAB77565.1| oligopeptide transporter-like protein [Arabidopsis thaliana]
 gb|AEE79233.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=555

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            + +IV+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + M P+L A LADS
Sbjct  20   LFIIVVEIAERFAFYGLASNLITFLTNELGQSTATAAKNINTWIGVSCMFPILGAFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L ++F Y+LG++ L
Sbjct  80   ILGRFKTVLLTSFIYLLGIVML  101



>gb|EYU38280.1| hypothetical protein MIMGU_mgv1a021345mg [Erythranthe guttata]
Length=552

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  I +I +   ERF + GVA NL  YLT V     ++AAK VN W G +++ P++   L
Sbjct  16   KSAIFIIFVEVAERFAYYGVAGNLFMYLTKVLGQPTATAAKNVNTWQGVSAIFPVVGGFL  75

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSY+  Y TIL S+  Y++GLI LT
Sbjct  76   ADSYVGRYKTILFSSVVYLIGLILLT  101



>ref|XP_010312294.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Solanum lycopersicum]
Length=604

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +IVI   ER +F G+A +L+ YLT V      +AAK VN W G T+++PLL 
Sbjct  40   GVWKASLFIIVIEFSERLSFFGIATSLIMYLTKVIHQDLKTAAKSVNYWTGVTTLMPLLG  99

Query  412  APLADSYLDSYSTILGSAFFYILGLIALT  498
              LAD+YL  +ST+L S+  Y LGL+ LT
Sbjct  100  GFLADAYLGRFSTVLLSSTVYFLGLLLLT  128



>ref|XP_008437711.1| PREDICTED: uncharacterized protein LOC103483057 [Cucumis melo]
Length=1156

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+IV+   ERF + GV++NL+ +LTD  + S + AAK VN W G  +++PLL A LAD +
Sbjct  34   LIIVVEIAERFAYLGVSSNLINFLTDQLQQSTAMAAKNVNAWSGTAALLPLLGAFLADCF  93

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSS  555
            L  Y TI+ S+  YILGL  LT +A    P  +  Q+  +S
Sbjct  94   LGRYRTIVLSSALYILGLGLLTVSATLPSPDISACQETENS  134



>ref|XP_010665406.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X3 [Vitis 
vinifera]
Length=530

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+ ANL+ YLT    +S ++AA+ VN W G   ++PL+ A +ADSYL  Y TI+
Sbjct  9    ERFAYSGIQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGRYRTII  68

Query  457  GSAFFYILGLIALTSTAMGWPPGSNNAQK  543
             ++F YILGL  LT +A+   P  ++ QK
Sbjct  69   IASFLYILGLGLLTLSAVLPSPSPSDCQK  97



>ref|XP_008356821.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Malus domestica]
Length=278

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 0/97 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I++   ++F F G+A+NL+ YLTDV     ++AAK VN W G +S+ P++ A LAD
Sbjct  19   AIFIILVEVAQQFAFYGLASNLIMYLTDVLDQPLATAAKNVNTWLGVSSVFPVVGAFLAD  78

Query  427  SYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNA  537
            SY   + TI+ S   Y LG++ LT +    P  S  A
Sbjct  79   SYFGRFKTIVFSVTIYFLGMVLLTLSVSVIPSQSRRA  115



>emb|CBI39334.3| unnamed protein product [Vitis vinifera]
Length=755

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G  +    +I +   ERF + G+ ANL+ YLT    +S ++AA+ VN W G   ++PL+ 
Sbjct  36   GCWRSAYFIIGVEVAERFAYSGIQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVG  95

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQK  543
            A +ADSYL  Y TI+ ++F YILGL  LT +A+   P  ++ QK
Sbjct  96   AFVADSYLGRYRTIIIASFLYILGLGLLTLSAVLPSPSPSDCQK  139


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+ +NL+ + TD    SN +A + VN W G  S++PL+ A +ADSYL  Y+TI+
Sbjct  626  ERFAYFGIQSNLINFFTDRLGQSNPTAGESVNIWTGTGSLMPLVGAFVADSYLGRYATII  685

Query  457  GSA  465
             ++
Sbjct  686  NAS  688



>ref|XP_006339008.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Solanum tuberosum]
Length=597

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +IVI   ER +F G+A +L+ YLT V      +AAK VN W G T+++PLL 
Sbjct  43   GVWKASLFIIVIEFSERLSFFGIATSLIMYLTKVIHQDLKTAAKSVNYWTGVTTLMPLLG  102

Query  412  APLADSYLDSYSTILGSAFFYILGLIALT  498
              LAD+YL  +ST+L S+  Y LGL+ LT
Sbjct  103  GFLADAYLGRFSTVLLSSTVYFLGLLLLT  131



>ref|XP_010515972.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4 [Camelina sativa]
Length=559

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +IV+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + M P+L   LADS
Sbjct  20   IFIIVVEMTERFAFYGLASNLLTFLTNELGQSTATAAKQINTWIGVSCMFPILGGFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L S+F Y+ G++ L
Sbjct  80   ILGRFKTVLLSSFIYLFGMVML  101



>ref|XP_010427147.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Camelina sativa]
Length=559

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +IV+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + M P+L   LADS
Sbjct  20   IFIIVVEMTERFAFYGLASNLLTFLTNELGQSTATAAKQINTWIGVSCMFPILGGFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L S+F Y+ G++ L
Sbjct  80   ILGRFKTVLLSSFIYLFGMVML  101



>gb|ABR17733.1| unknown [Picea sitchensis]
Length=573

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G  K    +I +   ERF F G+ ANLV YLTDV   S ++AAK VN W G  +M+P + 
Sbjct  31   GRWKASFFVIGVEIAERFAFAGILANLVIYLTDVMGESTATAAKNVNVWSGVATMLPFVG  90

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTA  507
            A +ADSYL  + TI  S+  Y+LGLI +T +A
Sbjct  91   AFVADSYLGRFWTIALSSVVYLLGLILVTLSA  122



>ref|XP_010062427.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Eucalyptus grandis]
 gb|KCW69568.1| hypothetical protein EUGRSUZ_F02995 [Eucalyptus grandis]
Length=571

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+ ANL++YLT     S ++AA+ VN W G  S++PL+ A +ADSY
Sbjct  49   FIIGVEVAERFAYYGIEANLISYLTGPLGESTAAAAENVNAWSGAASLLPLVGAFVADSY  108

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKIS--SSSLSWPLHLI  582
            L  Y TI+ ++F YILGL  LT +A+    G++  Q  +  +S  S  LH++
Sbjct  109  LGRYRTIIIASFLYILGLALLTLSAVLTSLGTSECQNTTKITSCPSSKLHVV  160



>ref|XP_010665405.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Vitis 
vinifera]
Length=584

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+ ANL+ YLT    +S ++AA+ VN W G   ++PL+ A +ADSYL  Y TI+
Sbjct  63   ERFAYSGIQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGRYRTII  122

Query  457  GSAFFYILGLIALTSTAMGWPPGSNNAQK  543
             ++F YILGL  LT +A+   P  ++ QK
Sbjct  123  IASFLYILGLGLLTLSAVLPSPSPSDCQK  151



>emb|CAN75422.1| hypothetical protein VITISV_011767 [Vitis vinifera]
Length=584

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+ ANL+ YLT    +S ++AA+ VN W G   ++PL+ A +ADSYL  Y TI+
Sbjct  63   ERFAYSGIQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGRYRTII  122

Query  457  GSAFFYILGLIALTSTAMGWPPGSNNAQK  543
             ++F YILGL  LT +A+   P  ++ QK
Sbjct  123  IASFLYILGLGLLTLSAVLPSPSPSDCQK  151



>gb|KCW69566.1| hypothetical protein EUGRSUZ_F02995 [Eucalyptus grandis]
Length=571

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+ ANL++YLT     S ++AA+ VN W G  S++PL+ A +ADSY
Sbjct  49   FIIGVEVAERFAYYGIEANLISYLTGPLGESTAAAAENVNAWSGAASLLPLVGAFVADSY  108

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKIS--SSSLSWPLHLI  582
            L  Y TI+ ++F YILGL  LT +A+    G++  Q  +  +S  S  LH++
Sbjct  109  LGRYRTIIIASFLYILGLALLTLSAVLTSLGTSECQNTTKITSCPSSKLHVV  160



>ref|XP_003546719.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Glycine max]
Length=576

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A+NL+ YLT+V     + AAK VN W G +S+ PLL   +AD
Sbjct  29   AIFIIFVEFAERFAYQGLASNLIQYLTNVLNEPITQAAKDVNTWVGASSLFPLLGGFIAD  88

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+  Y +G++ LT
Sbjct  89   SYLGRFNTILLSSVIYFVGMVFLT  112



>ref|XP_004511030.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Cicer arietinum]
Length=571

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A+NLV YLT       ++A K VN W G +S+ PLL   +AD
Sbjct  27   AIFIIFVEVAERFAYQGLASNLVNYLTKFLNEPTTTAVKNVNTWVGVSSLFPLLGGFIAD  86

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+  Y++G+I LT
Sbjct  87   SYLGRFNTILLSSLIYLVGMIFLT  110



>ref|XP_010504249.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4 [Camelina sativa]
Length=559

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +IV+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + M P+L   LADS
Sbjct  20   IFIIVVEMTERFAFYGLASNLLTFLTNELGQSTATAAKQINTWIGVSCMFPILGGFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L S+F Y+ G++ L
Sbjct  80   ILGRFKTVLLSSFIYLFGMVML  101



>ref|XP_007140460.1| hypothetical protein PHAVU_008G114200g [Phaseolus vulgaris]
 gb|ESW12454.1| hypothetical protein PHAVU_008G114200g [Phaseolus vulgaris]
Length=592

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER +F G+A +LV YLT V      +AA+ VN W G T+++PL    +
Sbjct  40   KAALFIIAIETSERLSFFGIATSLVLYLTKVMHQELKTAARNVNYWSGVTTLMPLFGGFI  99

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSY+  Y+T+L S+  Y++GLI LT
Sbjct  100  ADSYMGRYTTVLASSIVYLMGLILLT  125



>ref|XP_009109895.1| PREDICTED: protein NRT1/ PTR FAMILY 5.15-like [Brassica rapa]
Length=536

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF++ G+A N++TYLT+    S ++AA  VN W G  S +P++ A LAD+Y
Sbjct  39   LIIGVEVAERFSYVGIACNMITYLTEQLGQSTANAAVNVNTWIGTASTLPIIGAFLADAY  98

Query  433  LDSYSTILGSAFFYILGL  486
            L  Y TILGS+  YILG+
Sbjct  99   LGRYRTILGSSLIYILGI  116



>ref|XP_010095974.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62667.1| putative peptide/nitrate transporter [Morus notabilis]
Length=594

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I++   +RF F G++ NL+ YLT+V      +AAK VN W G +S+ PLL A +ADS
Sbjct  44   IFVILVEVADRFAFYGLSGNLIMYLTNVLHQPTVTAAKNVNMWVGVSSLFPLLGALVADS  103

Query  430  YLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNA  537
            +L  + TIL S+  Y+LG++ L  +    P G   A
Sbjct  104  FLGRFKTILLSSIVYLLGMVLLCFSVSAIPAGYRKA  139



>ref|XP_010665398.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=569

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I +A +ERF FKG+  NL+ YLT     S  +AA  VN W G ++++PLL A +
Sbjct  36   KSAYFIIGMAVVERFVFKGIETNLINYLTGWLGESTVAAAANVNTWSGTSTLLPLLGASI  95

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAM---GWPPGSNNAQKISSSSLS  564
            ADSYL  Y TI+ ++  YILGL  LT +A+   G      N  K +S S S
Sbjct  96   ADSYLGQYRTIVIASVTYILGLGLLTLSAVLTSGSSSNCKNRNKTTSCSHS  146



>ref|XP_003627833.1| Peptide transporter PTR1 [Medicago truncatula]
 gb|AET02309.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=572

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A+NL+ YLT       ++A K VN W G +S+ PLL   +AD
Sbjct  27   AIFIIFVEFAERFAYQGLASNLINYLTKFLNEPTTTAVKNVNTWVGVSSLFPLLGGFIAD  86

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+  Y++G+I LT
Sbjct  87   SYLGRFNTILLSSLIYLVGMIFLT  110



>ref|XP_010269378.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like isoform X2 [Nelumbo 
nucifera]
Length=563

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  I +I +   ERF F G+  NL+TYLTDV   + +++AK VN W G ++++PLL A +
Sbjct  28   RSAIYIIGVEIAERFAFYGMLGNLITYLTDVLGEATATSAKNVNIWVGISTLLPLLGAVI  87

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADS+L    TI  S+  Y++GL+ LT
Sbjct  88   ADSFLGRLRTIFFSSIIYLMGLLMLT  113



>ref|XP_010269377.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like isoform X1 [Nelumbo 
nucifera]
Length=579

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  I +I +   ERF F G+  NL+TYLTDV   + +++AK VN W G ++++PLL A +
Sbjct  44   RSAIYIIGVEIAERFAFYGMLGNLITYLTDVLGEATATSAKNVNIWVGISTLLPLLGAVI  103

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADS+L    TI  S+  Y++GL+ LT
Sbjct  104  ADSFLGRLRTIFFSSIIYLMGLLMLT  129



>emb|CDY36098.1| BnaA08g19500D [Brassica napus]
Length=536

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + G+A N++TYLT+    S ++AA  VN W G  S +P++ A LAD+Y
Sbjct  39   LIIGVEVAERFAYVGIACNMITYLTEQLGQSTANAAVNVNTWIGTASTLPIIGAFLADAY  98

Query  433  LDSYSTILGSAFFYILGL  486
            L  Y TILGS+  YILG+
Sbjct  99   LGRYRTILGSSLIYILGI  116



>gb|KJB74997.1| hypothetical protein B456_012G017800 [Gossypium raimondii]
Length=578

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I +   ERF F G+A NL+TYLT+      ++AAK VN W G +++ PLL A +ADS
Sbjct  36   IFVIFVEMAERFAFYGLAGNLITYLTNNLGQPVAAAAKNVNTWVGVSAIFPLLGAFVADS  95

Query  430  YLDSYSTILGSAFFYILGLIALT  498
            YL  + TIL S+  Y LG++ L+
Sbjct  96   YLGRFKTILASSSIYFLGMVLLS  118



>ref|XP_010695697.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.1 
[Beta vulgaris subsp. vulgaris]
Length=574

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A+A   G  K C  L+V    ER  F G+A+NLV YLT        S+ + VNNW G   
Sbjct  23   AIASKTGKWKACAFLLVYEACERMAFYGIASNLVVYLTTQLHEDTVSSVRNVNNWNGVVW  82

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALT  498
            M P++ A +AD+YL  Y T   S+  Y+LG++ LT
Sbjct  83   MTPIIGAYIADAYLGRYWTFTISSLIYVLGMVLLT  117



>ref|XP_009772498.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana sylvestris]
Length=593

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 6/123 (5%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K   L+I I   ER ++ G+A +L+ YLT V      +AAK VN W G T+++PLL   +
Sbjct  43   KASFLIIAIEFSERLSYFGIATSLIIYLTKVIHQDLKTAAKSVNYWTGVTTLMPLLGGFV  102

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMG---WPPGS---NNAQKISSSSLSWPLHLI  582
            AD+YL  + T+L S   Y++GL+ LT +++     P GS      +KI      + ++LI
Sbjct  103  ADAYLGRFYTVLASTIVYLMGLLLLTMSSVVPSLKPCGSGICQEPRKIHVVIFFFAMYLI  162

Query  583  SLG  591
            S+G
Sbjct  163  SIG  165



>ref|XP_009620626.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Nicotiana tomentosiformis]
Length=593

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K   L+I I   ER ++ G+A +L+ YLT V      +AAK VN W G T+++PLL   +
Sbjct  43   KASFLIIAIEFSERLSYFGIATSLIIYLTKVIHQDLKTAAKSVNYWTGVTTLMPLLGGFV  102

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMG---WPPGSNNAQ---KISSSSLSWPLHLI  582
            AD+YL  + T+L S   Y++GL+ LT +++     P GS+  Q   KI      + ++LI
Sbjct  103  ADAYLGRFYTVLASTTVYLMGLLLLTMSSVVPSLKPCGSDICQEPRKIHVVIFFFAIYLI  162

Query  583  SLG  591
            S+G
Sbjct  163  SIG  165



>emb|CDY66692.1| BnaC04g53060D [Brassica napus]
Length=559

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             + ++V+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + + P+L A LAD
Sbjct  20   AVFIMVVEMTERFAFYGLASNLMTFLTNELGQSTATAAKHINTWLGVSYLFPILGAFLAD  79

Query  427  SYLDSYSTILGSAFFYILGLIAL  495
            S L  + T+L S+F Y+LG++ L
Sbjct  80   SILGRFKTVLLSSFVYLLGMVML  102



>gb|KHF99635.1| hypothetical protein F383_18770 [Gossypium arboreum]
Length=578

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I +   ERF F G+A NL+TYLT+      ++AAK VN W G +++ PLL A +ADS
Sbjct  36   IFVIFVEMAERFAFYGLAGNLITYLTNNLGQPVAAAAKNVNTWVGVSAIFPLLGAFVADS  95

Query  430  YLDSYSTILGSAFFYILGLIALT  498
            YL  + TIL S+  Y LG++ L+
Sbjct  96   YLGRFKTILASSSIYFLGMVLLS  118



>gb|KHN37667.1| Putative peptide/nitrate transporter [Glycine soja]
Length=561

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A+NL+ YLT+V     + AAK VN W G +S+ PLL   +AD
Sbjct  29   AIFIIFVEFAERFAYQGLASNLIQYLTNVLNEPITQAAKDVNTWVGASSLFPLLGGFIAD  88

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+  Y  G++ LT
Sbjct  89   SYLGRFNTILLSSVIYFAGMVFLT  112



>emb|CDP06560.1| unnamed protein product [Coffea canephora]
Length=591

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (59%), Gaps = 2/102 (2%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I +   ER ++ G+A +L+ YLT V      +AAK VN W G T+M+PLL 
Sbjct  36   GVWKASLFIIAVEFSERLSYFGIATSLIIYLTKVIHEDLKTAAKGVNYWSGVTTMMPLLG  95

Query  412  APLADSYLDSYSTILGSAFFYILGLIALT--STAMGWPPGSN  531
              LAD+YL  +ST+L S   YI+GL+ LT  ST     P  N
Sbjct  96   GFLADAYLGRFSTVLISCIIYIMGLLLLTMSSTIPALKPCDN  137



>ref|XP_010683110.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (60%), Gaps = 0/99 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A+    G  K    +I +   ER  + G+ +NL++YLT     S +SAA  VN W GF S
Sbjct  37   AIRSKHGRWKSASFIIGVEVAERIAYYGITSNLISYLTGPLGQSTASAAANVNAWSGFAS  96

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAM  510
            + P++ A +ADS+L  Y TI+ S+F YILGL  LT +A+
Sbjct  97   LFPVIGAIIADSFLGRYRTIIVSSFIYILGLALLTLSAV  135



>ref|XP_003542826.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Glycine max]
Length=579

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF ++G+A+NL+ YLT+V     + AAK VN W G +S+ PLL   +AD
Sbjct  29   AIFIIFVEFAERFAYQGLASNLIQYLTNVLNEPITQAAKDVNTWVGASSLFPLLGGFIAD  88

Query  427  SYLDSYSTILGSAFFYILGLIALT  498
            SYL  ++TIL S+  Y  G++ LT
Sbjct  89   SYLGRFNTILLSSVIYFAGMVFLT  112



>ref|XP_002513061.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF49564.1| Peptide transporter, putative [Ricinus communis]
Length=615

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I++   ERF F GVA NL+TYLT+      ++AAK +N W G +S+ P+L A +ADS
Sbjct  72   IFIILLEVAERFAFYGVAGNLITYLTNDLHQPTAAAAKNINTWIGVSSIFPILGAFIADS  131

Query  430  YLDSYSTILGSAFFYILGLIALT  498
            +L  + TIL ++  Y  G++ LT
Sbjct  132  FLGRFKTILFASIIYFTGMVLLT  154



>ref|XP_009116130.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4 [Brassica rapa]
Length=561

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            + ++V+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + + P+L A LADS
Sbjct  21   VFIMVVEMTERFAFYGLASNLMTFLTNELGQSTATAAKHINTWLGVSYLFPILGAFLADS  80

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L S+F Y+LG++ L
Sbjct  81   ILGRFKTVLLSSFVYLLGMVML  102



>emb|CDX78237.1| BnaA09g34320D [Brassica napus]
Length=561

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            + ++V+   ERF F G+A+NL+T+LT+    S ++AAK +N W G + + P+L A LADS
Sbjct  21   VFIMVVEMTERFAFYGLASNLMTFLTNELGQSTATAAKHINTWLGVSYLFPILGAFLADS  80

Query  430  YLDSYSTILGSAFFYILGLIAL  495
             L  + T+L S+F Y+LG++ L
Sbjct  81   ILGRFKTVLLSSFVYLLGMVML  102



>gb|AFK39795.1| unknown [Lotus japonicus]
Length=143

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER ++ G+A +LV YLT V      + A+ VN W G T+++PLL   +
Sbjct  25   KAALFIIAIEFCERLSYFGIATSLVLYLTKVIHQDLKTTARNVNYWSGVTTLMPLLGGFI  84

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            AD+YL  Y+T+  S+  Y++GL+ LT
Sbjct  85   ADAYLGRYATVFASSIVYLIGLVLLT  110



>ref|XP_008785490.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Phoenix dactylifera]
Length=607

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K    +I I   ER ++ G+ +NL+ YLT V      +AAK VN W G T+M+PLL 
Sbjct  41   GVWKASFFIIAIEFSERLSYFGLDSNLIIYLTKVLHQEVKTAAKNVNYWSGVTTMMPLLG  100

Query  412  APLADSYLDSYSTILGSAFFYILGLIALT  498
              +AD+YL  +ST+L S+  Y+ GLI LT
Sbjct  101  GFIADAYLGRFSTVLFSSLIYLAGLILLT  129



>ref|XP_003529111.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=593

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER ++ G+A +LV YLT V      +AA+ VN W G T+++PL    +
Sbjct  41   KAALFIIAIETSERLSYFGIATSLVLYLTKVMHQELKTAARNVNYWAGVTTLMPLFGGFI  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            AD+YL  YST+L S+  Y++GL+ LT
Sbjct  101  ADAYLGRYSTVLASSIVYLIGLVLLT  126



>ref|XP_009361962.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Pyrus x bretschneideri]
Length=564

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I++   ++F F G+A+NL+ YLTDV     ++AAK VN W G +S+ P++ A LADS
Sbjct  20   IFIILVEVAQQFAFYGLASNLIMYLTDVLDQPLATAAKNVNTWLGVSSVFPVVGAFLADS  79

Query  430  YLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNA  537
            Y   + TI+ S   Y LG++ LT +    P  S  A
Sbjct  80   YFGRFKTIVFSVTIYFLGMVLLTLSVSVIPSQSRRA  115



>ref|XP_002265901.2| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Vitis vinifera]
Length=569

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I++   ERFTF GV  NLVTY T+V   + S+AAK VN W G + ++P+  A +
Sbjct  31   KSAAFIILVEIAERFTFYGVLGNLVTYFTNVLGQTISTAAKNVNTWVGVSMILPIFGAAV  90

Query  421  ADSYLDSYSTILGSAFFYILGLIAL  495
            ADSYL  + TI+ ++  Y+LG + L
Sbjct  91   ADSYLGRFKTIIIASVIYLLGAVLL  115



>ref|XP_008353485.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like, partial [Malus 
domestica]
Length=481

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  382  GFTSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSL  561
            GFTSM+PLLVAPL DSY D Y TIL S+F Y+ GL+ALTSTA      + N    +SS L
Sbjct  1    GFTSMLPLLVAPLVDSYWDRYPTILVSSFLYVAGLVALTSTAFTRATPAANKTSSNSSFL  60

Query  562  SWPLHLISLG  591
               L+LISLG
Sbjct  61   FCSLYLISLG  70



>gb|KJB73105.1| hypothetical protein B456_011G215200 [Gossypium raimondii]
Length=584

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 57/99 (58%), Gaps = 0/99 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I +   ERF F G+A NL+TYLT+       +AAK VN W G +++ PLL A +
Sbjct  33   KAAFFVISVEMAERFAFYGLAGNLITYLTNNLGEPVVTAAKNVNTWVGVSAIFPLLGAFI  92

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNA  537
            ADSYL  + TIL S+  Y LG++ L+ +    P  S  A
Sbjct  93   ADSYLGRFKTILASSVIYFLGMVLLSLSVSVIPMHSRKA  131



>ref|XP_004246394.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Solanum lycopersicum]
Length=587

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 70/123 (57%), Gaps = 6/123 (5%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K   L+I I   ER ++ G+A +L+ YLT V      +AAK VN W G T+++PLL   +
Sbjct  43   KASFLIIAIEFSERLSYFGIATSLIIYLTKVIHQDLKTAAKSVNYWTGVTTLMPLLGGFV  102

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNN----AQKISSSSLSWPLHLI  582
            AD+YL  + T+L S   Y+LGL+ LT +++     P  N+     +++      + ++LI
Sbjct  103  ADAYLGRFYTVLASTIVYLLGLVLLTMSSVVPSLKPCGNDLCEEPRQVHVVVFFFAIYLI  162

Query  583  SLG  591
            S+G
Sbjct  163  SVG  165



>gb|KDO84007.1| hypothetical protein CISIN_1g045562mg, partial [Citrus sinensis]
Length=525

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  + +I +   ERF + GV++NL+TYLT     S ++AA+ VN W G  S++PL  A L
Sbjct  40   RSALFIIGVEMAERFAYYGVSSNLITYLTGPLAQSTATAAENVNAWSGVASLLPLFGAFL  99

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSS-------LSWPLHL  579
            ADS+L  Y  I+ ++  Y+LGL  LT +A+     ++  Q  S S+         + L+L
Sbjct  100  ADSFLGRYRAIIIASLIYVLGLGLLTLSAVLLSGSTSECQNTSCSANQFQVIFFFFSLYL  159

Query  580  ISLG  591
            I+LG
Sbjct  160  IALG  163



>ref|XP_006434673.1| hypothetical protein CICLE_v10000719mg [Citrus clementina]
 gb|ESR47913.1| hypothetical protein CICLE_v10000719mg [Citrus clementina]
Length=569

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  + +I +   ERF + GV++NL+TYLT     S ++AA+ VN W G  S++PL  A L
Sbjct  40   RSALFIIGVEMAERFAYYGVSSNLITYLTGPLAQSTATAAENVNAWSGVASLLPLFGAFL  99

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSS-------LSWPLHL  579
            ADS+L  Y  I+ ++  Y+LGL  LT +A+     ++  Q  S S+         + L+L
Sbjct  100  ADSFLGRYRAIIIASLIYVLGLGLLTLSAVLLSGSTSECQNTSCSANQFQVIFFFFSLYL  159

Query  580  ISLG  591
            I+LG
Sbjct  160  IALG  163



>gb|EYU22787.1| hypothetical protein MIMGU_mgv1a003626mg [Erythranthe guttata]
Length=573

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 68/109 (62%), Gaps = 0/109 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+++NL++YLT     S ++AA+ VN W G  S++PLL A LADS+
Sbjct  44   FIIGVEVAERFAYYGISSNLISYLTGPLGQSTATAAENVNLWSGTASLLPLLGAFLADSF  103

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHL  579
            L  Y  I+ ++  YILGL  LT +A+ +  GS++ +  ++++   P  L
Sbjct  104  LGRYRMIIAASVLYILGLGCLTLSALVYSLGSSDCENAANNASCSPPRL  152



>ref|XP_010276618.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Nelumbo nucifera]
Length=549

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I I   +RF + G+  NL+TYLTD    + ++AAK VN W G  +++PL  A +
Sbjct  15   KSATYIIGIGAAQRFAYYGLLGNLITYLTDALHETTATAAKNVNLWFGVATLLPLFGALI  74

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSYL  + TIL S+  +++GL+ LT
Sbjct  75   ADSYLGRFKTILFSSLIFLMGLVMLT  100



>ref|XP_006473248.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Citrus sinensis]
Length=569

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 71/124 (57%), Gaps = 7/124 (6%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  + +I +   ERF + GV++NL+TYLT     S ++AA+ VN W G  S++PL  A L
Sbjct  40   RSALFIIGVEMAERFAYYGVSSNLITYLTGPLAQSTATAAENVNAWSGVASLLPLFGAFL  99

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSS-------LSWPLHL  579
            ADS+L  Y  I+ ++  Y+LGL  LT +A+     ++  Q  S S+         + L+L
Sbjct  100  ADSFLGRYRAIIIASLIYVLGLGLLTLSAVLLSGSTSECQNTSCSANQFQVIFFFFSLYL  159

Query  580  ISLG  591
            I+LG
Sbjct  160  IALG  163



>ref|XP_007133986.1| hypothetical protein PHAVU_010G009400g [Phaseolus vulgaris]
 gb|ESW05980.1| hypothetical protein PHAVU_010G009400g [Phaseolus vulgaris]
Length=600

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 64/115 (56%), Gaps = 4/115 (3%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER ++ G+A +LV YLT V      +A K VN W G T+++PLL   L
Sbjct  41   KSSLFIIAIEFSERLSYFGIATSLVLYLTKVIHQDLKTAVKNVNYWSGVTTLMPLLGGFL  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGW-PPGSNNAQKISSSSLSWPLHLI  582
            AD+YL  YST++ S   Y++GL+ L+   + W  PG       S+ + +  +H +
Sbjct  101  ADAYLGRYSTVIASCIVYLMGLVVLS---LSWFVPGLRPCDHTSTCTETRRIHEV  152



>ref|XP_010088558.1| Putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB36699.1| Putative peptide/nitrate transporter [Morus notabilis]
Length=583

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER ++ G+A +L+ YLT V      +AA+ VN W G T+++PL    +
Sbjct  31   KASLFIIAIEFSERLSYFGIATSLIIYLTKVIHEDLKTAARSVNYWSGVTTLMPLFGGFI  90

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGW  516
            ADSYL  +ST+L S   YI+GLI LT   M W
Sbjct  91   ADSYLGRFSTVLASTVVYIMGLILLT---MSW  119



>ref|XP_002278980.1| PREDICTED: protein NRT1/ PTR FAMILY 5.1 isoform X1 [Vitis vinifera]
 emb|CBI25394.3| unnamed protein product [Vitis vinifera]
Length=585

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +1

Query  217  MAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSM  396
            +A   G  + C  L+     ER  F GVA+NLV YLT      N S+ + VNNW G   M
Sbjct  20   IASKTGKWRACAFLVGYEAFERMAFYGVASNLVVYLTTQLHEDNVSSVRNVNNWSGSVWM  79

Query  397  VPLLVAPLADSYLDSYSTILGSAFFYILGLIALT  498
             P+L A +ADSYL  + T   S+  Y+LG++ LT
Sbjct  80   TPILGAYIADSYLGRFWTFTVSSLIYVLGMVLLT  113



>ref|XP_009116102.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brassica rapa]
Length=570

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 65/125 (52%), Gaps = 7/125 (6%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K C  ++V    ERF + G++ NLV YL       N++AA  V NW G   + PL+ A L
Sbjct  29   KACRFILVNVCCERFAYYGMSKNLVDYLKSRLNQGNATAANNVTNWFGTCYITPLIGAFL  88

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNAQKISSSS-----LSWPLHL  579
            AD+YL  Y TI    F Y+ GL  LT +A   G  PG+ N+     SS         L++
Sbjct  89   ADAYLGRYWTIATFVFIYVFGLTLLTLSASVPGLKPGNCNSDTCHPSSDQTAVFFVALYM  148

Query  580  ISLGL  594
            I+LG+
Sbjct  149  IALGI  153



>gb|KHG09768.1| hypothetical protein F383_13158 [Gossypium arboreum]
Length=584

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 57/99 (58%), Gaps = 0/99 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I +   ERF F G+A NL+TYLT+       +AAK VN W G +++ PLL A +
Sbjct  33   KAAFFVISVEMAERFAFYGLAGNLITYLTNNLGEPVITAAKNVNTWVGVSAIFPLLGAFI  92

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNA  537
            ADSYL  + TIL S+  Y LG++ L+ +    P  S  A
Sbjct  93   ADSYLGRFKTILASSVIYFLGMVLLSLSVSVIPMHSRKA  131



>ref|XP_011094926.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Sesamum indicum]
Length=588

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 69/123 (56%), Gaps = 6/123 (5%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I I   ER ++ G+A +L+ YLT V      +AAK VN W G T+++PLL   +
Sbjct  39   KASLFIIAIEFSERLSYFGLATSLIIYLTKVIHEDLKTAAKRVNYWSGVTTLMPLLGGFV  98

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGS----NNAQKISSSSLSWPLHLI  582
            AD+YL  +ST+L S+  Y+LGL+ LT + +  G  P         ++I        ++LI
Sbjct  99   ADAYLGRFSTVLISSVIYLLGLLVLTMSRVVPGLKPCDVGICERPRRIHEVFFFLAIYLI  158

Query  583  SLG  591
            S+G
Sbjct  159  SIG  161



>emb|CAN70960.1| hypothetical protein VITISV_025055 [Vitis vinifera]
Length=565

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  262  VIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDS  441
            V+   ERF + GVA NL TYLT+V     ++AAK VN W G +++ PLL   +ADSYL  
Sbjct  29   VVEMAERFAYYGVAGNLFTYLTNVLGEHTATAAKNVNTWVGVSAIFPLLGGFIADSYLGR  88

Query  442  YSTILGSAFFYILGLIALT  498
            + TI+ S+  Y+ GL+ +T
Sbjct  89   FKTIIASSVIYLAGLLLMT  107



>ref|XP_009593536.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana tomentosiformis]
Length=588

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 0/109 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + G+ +NL+ YLT     S ++AA+ VN W G  S+ PLL A +ADS+
Sbjct  59   LIICVEIAERFAYYGINSNLINYLTGPLGQSTAAAAENVNAWSGTASLTPLLGALVADSF  118

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHL  579
            L  Y TI+ ++ FYILGL  LT +A+     S+N Q   ++    P  L
Sbjct  119  LGRYRTIVFASLFYILGLGLLTLSAVFPFFSSSNCQTTDNADACSPPRL  167



>ref|XP_004147936.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Cucumis sativus]
 gb|KGN54305.1| hypothetical protein Csa_4G303040 [Cucumis sativus]
Length=607

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I +   ER ++ G+A +L+ YLT V      +AA+ VN W G T+++PLL   L
Sbjct  49   KASLFIIAMEFGERLSYFGIATSLIIYLTKVLHEDLKTAARSVNYWTGVTTLMPLLGGFL  108

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAM  510
            AD+Y   Y+T+L S+  Y+LGLI LT +A+
Sbjct  109  ADAYFGRYATVLFSSVLYVLGLILLTMSAL  138



>ref|XP_010683004.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=579

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ER  + G++ANL+++LT   + S + AA  +N W G +S++P+L A LADS+
Sbjct  47   FIIWVEMAERLAYYGISANLISFLTGKLEQSTAMAAANINAWSGVSSLLPILGAVLADSF  106

Query  433  LDSYSTILGSAFFYILGLIALTSTAM  510
            L  Y TI+GS+  YILGL  LT +AM
Sbjct  107  LGKYYTIIGSSIIYILGLGLLTLSAM  132



>gb|KDP40528.1| hypothetical protein JCGZ_24527 [Jatropha curcas]
Length=590

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I +   ERF F G+A NL+TYLT+      ++A K VN W G +++ P+  A L
Sbjct  44   KAALFIIFVEMAERFAFYGLAGNLITYLTNELHQPTATAVKNVNTWIGVSAIFPIFGAVL  103

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADS+L  ++TIL ++  Y +G++ LT
Sbjct  104  ADSFLGRFTTILLASIIYFIGMVLLT  129



>ref|XP_008793798.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X2 [Phoenix 
dactylifera]
Length=484

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 7/84 (8%)
 Frame = +1

Query  340  MSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTILGSAFFYILGLIALTSTAMGWP  519
            MS SSAAK ++ W G TSM+PL+ A LADSY D YSTI+ S+  Y++GL+ LT  A+   
Sbjct  1    MSTSSAAKSISTWVGLTSMLPLVSAILADSYWDRYSTIMASSLLYVMGLVGLTLWAL---  57

Query  520  PGSNNAQKISSSSLSWPLHLISLG  591
                   ++ +SSL  PL+LIS+G
Sbjct  58   ----LCARMPASSLFIPLYLISVG  77



>ref|XP_010428067.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like isoform X1 [Camelina 
sativa]
Length=558

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+A+NL++YLT     S + AA  VN W G  +++PLL A +AD++
Sbjct  39   FIIGVEVAERFAYFGIASNLISYLTGPLGQSTAVAAVNVNAWSGIATLLPLLGAFVADAF  98

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWP---PGSNNAQKISSSSLSWPLHLISLG  591
            L  Y TI+ S+F Y+LGL  LT +A   P    GS++   + ++   + L+L+++G
Sbjct  99   LGRYRTIIISSFIYVLGLAFLTLSAFLIPNTTEGSSSPSSLLNAFFFFSLYLVAIG  154



>ref|XP_010251739.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Nelumbo nucifera]
Length=563

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  I +I +   ERF + G++ANL+TYLTDV     ++AA  VN W G  +++PLL A +
Sbjct  33   RSSIYIIGVEAAERFAYYGMSANLITYLTDVLLEPTATAAMNVNIWSGVATVLPLLGAFM  92

Query  421  ADSYLDSYSTILGSAFFYILGLIAL  495
            ADSYL  + TI+ S+  Y++GL+ L
Sbjct  93   ADSYLGRFKTIIISSAIYLMGLVML  117



>ref|XP_004507202.1| PREDICTED: probable peptide/nitrate transporter At3g53960-like 
[Cicer arietinum]
Length=595

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I I   ER ++ G+A +LV YLT V      +A K VN W G T+++PL    L
Sbjct  41   KAAFFIIAIEFSERLSYFGIATSLVIYLTKVMHQDLKTAVKNVNYWSGVTTLMPLFGGFL  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSYL  Y+T++ S   Y++GLI LT
Sbjct  101  ADSYLGRYNTVIASCIIYLMGLILLT  126



>gb|EMT03148.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=545

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = +1

Query  244  PCILLIV-IAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            P  L +V +   ERF F G+++NL+TYLT     S +SAA  VN W G   ++PLL A +
Sbjct  28   PAALFVVGVEVAERFAFAGISSNLITYLTGPLGQSTASAAAAVNVWAGVAMLLPLLGAAV  87

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPP----GSNNAQKISSS  555
            ADS+L  Y TI+ ++  YILGL  LT ++   PP    G+ ++ + S+S
Sbjct  88   ADSWLGRYRTIVYASGLYILGLAMLTVSSA--PPAACAGTPDSAECSAS  134



>ref|XP_009357420.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Pyrus x bretschneideri]
Length=571

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 55/96 (57%), Gaps = 0/96 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I +   ERF + G A NL+TYLT+        AAK VN W G +S++P++ A +AD+
Sbjct  40   IFIIFVEMAERFAYYGTAGNLITYLTNELHEPIPMAAKNVNTWVGVSSLLPIIGAFVADA  99

Query  430  YLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNA  537
            +L  ++TILGS+  Y   LI LT T    P     A
Sbjct  100  FLGRFNTILGSSIIYCFALIMLTLTVSIMPRHYRKA  135



>ref|XP_008448441.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Cucumis melo]
Length=605

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +I +   ER ++ G+A +L+ YLT V      +AA+ VN W G T+++PLL   L
Sbjct  47   KASLFIIAMEFGERLSYFGIATSLIIYLTKVLHEELKTAARSVNYWTGVTTLMPLLGGFL  106

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAM  510
            AD+Y   Y+T+L S+  Y+LGLI LT +A 
Sbjct  107  ADAYFGRYATVLFSSVLYVLGLILLTMSAF  136



>ref|XP_010089167.1| hypothetical protein L484_000371 [Morus notabilis]
 gb|EXC36135.1| hypothetical protein L484_000371 [Morus notabilis]
Length=134

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G++ANL+TYLT   + S +SAA  VN W G   ++PLL A +ADS+L  Y TI 
Sbjct  56   ERFAYYGISANLITYLTGTLRQSTASAAASVNAWSGAAFLLPLLGAFVADSFLGRYRTIA  115

Query  457  GSAFFYILGLI  489
             ++F YIL ++
Sbjct  116  LASFLYILSIL  126



>ref|XP_002534074.1| Peptide transporter, putative [Ricinus communis]
 gb|EEF28309.1| Peptide transporter, putative [Ricinus communis]
Length=1133

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 7/127 (6%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I I   ER ++ G+A +L+ YLT V      +AAK VN W G T+++PL  
Sbjct  580  GVWKASLFIIAIEFSERLSYFGIATSLIIYLTKVIHQDLKTAAKSVNYWSGVTTLMPLFG  639

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTST-------AMGWPPGSNNAQKISSSSLSWP  570
              LAD+Y   YST+L S+  Y+ GLI LT +       A         A+KI        
Sbjct  640  GFLADAYWGRYSTVLVSSIIYLTGLILLTMSQFVPSLKACDATDECGQARKIHEVVFFLA  699

Query  571  LHLISLG  591
            ++L+S+G
Sbjct  700  IYLVSIG  706


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I I   ER ++ G+A +L+ YLT V      +AA+ VN W G T+++PLL 
Sbjct  39   GVWKASLFIIAIEFSERLSYFGIATSLIIYLTRVMHEDLKTAARSVNYWSGVTTLMPLLG  98

Query  412  APLADSYLDSYSTILGSAFFY  474
              +AD+YL  YST+  S+  Y
Sbjct  99   GFVADAYLGRYSTVFVSSIMY  119



>ref|XP_007020109.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY17334.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=552

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 15/127 (12%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             LI     ERF + G+++NL+TYLT    +S SSAA+ VN W G   ++P + A +ADS+
Sbjct  45   FLIAAEVAERFAYYGISSNLITYLTGPLGLSTSSAAENVNAWLGTDLLLPFIGAYVADSF  104

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSN-----NAQKISSSSLS--------WPL  573
            L  Y TI  S+  Y+LGL  LT +A    P SN     NA  + S S S        + L
Sbjct  105  LGHYRTIFISSIIYVLGLGLLTVSAT--LPSSNACSYPNANTVKSCSPSQLQVTVFFFSL  162

Query  574  HLISLGL  594
            +LI++GL
Sbjct  163  YLIAIGL  169



>ref|XP_011091838.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Sesamum indicum]
Length=549

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  I +I +   ERF + GVA NL+ YLT V     ++AAK VN W G +++ P++   L
Sbjct  16   KSAIFIIFVEVAERFAYYGVAGNLMMYLTRVLGQPTATAAKNVNIWEGVSAVFPVVGGFL  75

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPP  522
            ADSY+  + TIL ++  Y++GL+ LT      PP
Sbjct  76   ADSYVGRFRTILLASTIYLIGLVLLTVAVSAVPP  109



>ref|XP_010923254.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6 [Elaeis guineensis]
Length=606

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I I   ER ++ G++ NL+ YLT V      +AAK VN W G T+M+PL+ 
Sbjct  41   GVWKASLFIIAIEFSERLSYFGLSTNLIIYLTKVLHQELKTAAKNVNYWSGVTTMMPLVG  100

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAM  510
              +AD+YL  +ST++ S+  Y+ GLI LT + +
Sbjct  101  GFVADAYLGRFSTVIFSSLIYLAGLILLTMSQL  133



>ref|XP_009783108.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana sylvestris]
Length=588

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 63/106 (59%), Gaps = 0/106 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF + G+ +NL+ YLT     S ++AA+ VN W G  S+ PLL A +ADS+
Sbjct  58   LIICVEIAERFAYYGINSNLINYLTGPLGQSTAAAAENVNAWSGTASLTPLLGALVADSF  117

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWP  570
            L  Y TI+ ++ FYILGL  LT +A+     S+N Q   ++    P
Sbjct  118  LGRYRTIVFASLFYILGLGLLTLSAVFPFFSSSNCQTTDNADACSP  163



>ref|XP_004308593.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Fragaria vesca 
subsp. vesca]
Length=553

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I +   ERF++ G++ NL+TYLT+  K     A K VN W G ++++PLL A +ADS
Sbjct  35   IFIIFVEMAERFSYYGMSGNLITYLTNELKEPIPVAVKDVNTWTGVSALLPLLGAFIADS  94

Query  430  YLDSYSTILGSAFFYILGLIALTST  504
            YL  ++TIL S+  Y LG+  LT T
Sbjct  95   YLGRFTTILVSSIIYCLGMGLLTVT  119



>ref|XP_004492370.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Cicer arietinum]
Length=595

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 7/124 (6%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  + +  I   ER ++ G+A +LV YLT V      +AAK VN W G T+++PL    +
Sbjct  42   KAALFIFAIEFSERLSYFGIATSLVLYLTKVMHQDLKTAAKNVNYWAGVTTLMPLFGGFI  101

Query  421  ADSYLDSYSTILGSAFFYILGLIALTST-------AMGWPPGSNNAQKISSSSLSWPLHL  579
            AD+YL  YST+  S   Y++GLI LT +       +       N  +KI        +++
Sbjct  102  ADAYLGRYSTVFASCIVYLMGLILLTLSWFLPILKSCNHTNMCNEPRKIHEVVFFLAIYM  161

Query  580  ISLG  591
            ISLG
Sbjct  162  ISLG  165



>ref|XP_007220562.1| hypothetical protein PRUPE_ppa003298mg [Prunus persica]
 gb|EMJ21761.1| hypothetical protein PRUPE_ppa003298mg [Prunus persica]
Length=587

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I++   ERF + G+A NL+TYLT+        AAK VN W G +S++PLL A +AD+
Sbjct  56   IFIILVEVAERFAYYGMAGNLITYLTNELHEPIPMAAKNVNTWVGVSSLLPLLGAFIADA  115

Query  430  YLDSYSTILGSAFFYILGLIALTST  504
            +L  +STI  S+  Y+L ++ LT T
Sbjct  116  FLGRFSTIFVSSIIYLLAMVLLTIT  140



>ref|XP_011006628.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like isoform X1 [Populus 
euphratica]
Length=587

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I I   ER ++ GVA +L+ YLT V      +AA+ VN W G T+++PLL 
Sbjct  36   GVWKATLFIIAIEFSERLSYFGVATSLIIYLTKVIHQDLKTAARNVNYWAGVTTLMPLLG  95

Query  412  APLADSYLDSYSTILGSAFFYILGLIALT  498
              LAD+YL  ++T+  S+  Y+LGLI LT
Sbjct  96   GFLADAYLGRFTTVFLSSVVYLLGLILLT  124



>gb|KHG04630.1| hypothetical protein F383_29596 [Gossypium arboreum]
Length=598

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 71/113 (63%), Gaps = 4/113 (4%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +IV+   ERF + G+++NL+TYLT     S ++AA  VN W G  S++PLL A +ADS+
Sbjct  68   FIIVVEIAERFAYYGISSNLITYLTGPLGESTATAAAQVNAWNGAASLLPLLGAFIADSF  127

Query  433  LDSYSTILGSAFFYIL--GLIALTST-AMGWPPGSNNAQKIS-SSSLSWPLHL  579
            L  Y TI+ ++  Y+L  GL+AL++T +     G  NA  I+ SSSL + + L
Sbjct  128  LGRYRTIILASLVYVLGIGLLALSATLSSISSSGGQNADDIALSSSLQFQVIL  180



>ref|XP_009380625.1| PREDICTED: protein NRT1/ PTR FAMILY 5.7-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=580

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G  K  + +IVI   ER ++ G+A NL+ YLT V      +AAK VN W G T+M+PL+ 
Sbjct  30   GCWKASLFIIVIEFSERLSYFGLATNLIIYLTKVLHEEVKTAAKNVNYWSGVTTMMPLVG  89

Query  412  APLADSYLDSYSTILGSAFFYILGLIAL  495
              +AD+YL  +ST++ S+  YI GL+ L
Sbjct  90   GFVADAYLGRFSTVVISSLIYIAGLVLL  117



>gb|KGN52717.1| hypothetical protein Csa_5G652230 [Cucumis sativus]
Length=178

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            ++I +   ERF F G++ NLV+YLT     S + AA+ VN W G  S++PLL A  ADS+
Sbjct  66   VIIGVEIAERFAFFGISTNLVSYLTVEMGQSMADAAQNVNLWVGTASLLPLLAASFADSF  125

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGS  528
            L  Y TI+ ++  YILGL  LT +A+   P S
Sbjct  126  LGRYLTIILASALYILGLGLLTLSAILASPSS  157



>gb|KDP35100.1| hypothetical protein JCGZ_10942 [Jatropha curcas]
Length=552

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+A+NL+TYLT     S ++AA+ VN W G T+++PLL A +ADS+L  Y TI+
Sbjct  51   ERFAYYGIASNLITYLTGSLGQSMAAAAENVNTWSGTTTLLPLLGAVVADSFLGRYRTII  110

Query  457  GSAFFYILGLIALT  498
             ++  YILGL  LT
Sbjct  111  YASIIYILGLGLLT  124



>ref|XP_007020108.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY17333.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=1036

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 15/127 (12%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             LI     ERF + G+++NL+TYLT    +S SSAA+ VN W G   ++P + A +ADS+
Sbjct  45   FLIAAEVAERFAYYGISSNLITYLTGPLGLSTSSAAENVNAWLGTDLLLPFIGAYVADSF  104

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSN-----NAQKISSSSLS--------WPL  573
            L  Y TI  S+  Y+LGL  LT +A    P SN     NA  + S S S        + L
Sbjct  105  LGHYRTIFISSIIYVLGLGLLTVSAT--LPSSNACSYPNANTVKSCSPSQLQVTVFFFSL  162

Query  574  HLISLGL  594
            +LI++GL
Sbjct  163  YLIAIGL  169


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I +   ERF + G+A NL+TYLT    +S + AA+ VN W G  S++PLL A +
Sbjct  555  KSASFIIAVEVAERFAYYGIANNLITYLTGPLGLSMAVAAENVNAWSGVGSLLPLLGAFV  614

Query  421  ADSYLDSYSTILGSAFFYI  477
            ADS+L  Y TIL S+  YI
Sbjct  615  ADSFLGRYRTILLSSAIYI  633



>gb|KHG26072.1| hypothetical protein F383_04504 [Gossypium arboreum]
Length=562

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 65/112 (58%), Gaps = 6/112 (5%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+++NL+TYLT    +S ++AA  VN+W G  +++PLL A LADS+L  Y TI+
Sbjct  48   ERFAYYGISSNLITYLTGPLGLSTAAAAAQVNSWSGVATLLPLLGAFLADSFLGRYRTII  107

Query  457  GSAFFYILGLIALT------STAMGWPPGSNNAQKISSSSLSWPLHLISLGL  594
             ++  YILGL  LT      S      P ++N    +SS L + + L    L
Sbjct  108  LASLVYILGLGLLTLSATLPSVTTSGAPNADNVTLNTSSMLQYQVILFFFSL  159



>ref|XP_002265817.2| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Vitis vinifera]
Length=711

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            +  I +I +   ERF++ GV+ NL+TYLT V     ++AAK VN W G + + P+L A +
Sbjct  110  RSAIFVIFVEVAERFSYYGVSGNLITYLTIVLGQPTATAAKNVNMWAGVSMVSPILGAIV  169

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSYL  + TI+ S+  Y +G++ LT
Sbjct  170  ADSYLGRFKTIIISSIIYFMGVLLLT  195



>ref|XP_002521809.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF40619.1| oligopeptide transporter, putative [Ricinus communis]
Length=1070

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+++NL+TYLT     S ++AA+ VN W G  +++PLL A +ADS+
Sbjct  53   FIIAVEVAERFAYFGISSNLITYLTGYLGQSTATAAENVNTWSGTATLLPLLGAAIADSF  112

Query  433  LDSYSTILGSAFFYILGLIALTSTA  507
            L  Y TI+ S+  Y+LGL  LT +A
Sbjct  113  LGRYCTIIVSSVIYVLGLGLLTLSA  137


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+++NL+TYLT     S ++AA+ VN W G  +++PLL   +AD +L  Y TI+
Sbjct  599  ERFAYYGISSNLITYLTGSLGQSTAAAAESVNTWSGVAALLPLLGGVVADFFLGRYLTII  658

Query  457  GSAFFYILGLIALTSTA  507
             ++  YILGL  LT +A
Sbjct  659  LASLVYILGLGMLTLSA  675



>ref|XP_006390700.1| hypothetical protein EUTSA_v10018035mg [Eutrema salsugineum]
 gb|ESQ27986.1| hypothetical protein EUTSA_v10018035mg [Eutrema salsugineum]
Length=1120

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 70/117 (60%), Gaps = 1/117 (1%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K   ++I +   ERF + G+ +NL+TYLT     S +SAA+ VN W G  + +PLL A +
Sbjct  549  KSARVIICVEMAERFAYFGITSNLITYLTGPLGESTASAAENVNAWIGTMAFLPLLWAFV  608

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSSLSWPLHLISLG  591
            ADS+L  Y TI+ S+  YILGL  L+ +AM  P  S ++ ++  +     L L+++G
Sbjct  609  ADSFLGRYRTIIISSSLYILGLGLLSFSAM-IPSHSKDSNQLQVTLFVSSLCLVAIG  664


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (58%), Gaps = 6/119 (5%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+A+NL++YLT     S + AA  VN W G + ++P++ A  AD++
Sbjct  38   FIIGVEVAERFAYYGIASNLISYLTGPLGQSTAVAAANVNAWSGISCLLPIIGAFFADAF  97

Query  433  LDSYSTILGSAFFYILGLIALTSTAMGWPPGSNNAQKISSSS------LSWPLHLISLG  591
            L  Y TI+ ++  YILG+  LT +A+  P  S N +  SS S        + L+L+++G
Sbjct  98   LGRYRTIIIASLIYILGMALLTFSALLVPLTSENTEVASSHSSLLNVLFFFSLYLVAIG  156



>gb|KFK44351.1| hypothetical protein AALP_AA1G246300 [Arabis alpina]
Length=565

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+A NL+TYLT     S ++AA  VN W G  SM+P+L A +AD+Y
Sbjct  40   FIIGVEVAERFAYFGIACNLITYLTGPLGQSTATAAVNVNTWSGTASMLPILGAFVADAY  99

Query  433  LDSYSTILGSAFFYILGLIALTSTA  507
            L  Y TIL ++  YI+GL  LT +A
Sbjct  100  LGRYRTILAASLIYIVGLGLLTLSA  124



>ref|XP_004307712.1| PREDICTED: protein NRT1/ PTR FAMILY 5.1 [Fragaria vesca subsp. 
vesca]
Length=591

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +1

Query  214  AMAGGQGLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTS  393
            A+A   G  K C  L+V    ER  F G+A+NLV YLT        ++ + VNNW G   
Sbjct  23   ALATKTGKWKACAFLVVYEAFERMAFYGIASNLVNYLTTQLHEDTVTSVRNVNNWSGAVW  82

Query  394  MVPLLVAPLADSYLDSYSTILGSAFFYILGLIALT  498
            + P+L A LADSYL  + T   S+  Y++G++ LT
Sbjct  83   ITPILGAYLADSYLGRFWTFTVSSLIYVMGMMLLT  117



>ref|XP_008437001.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
 ref|XP_008437002.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
Length=585

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
            L+I +   ERF F G ++NL+ +LTD  + S + AAK +N W G  +++PLL A LAD +
Sbjct  38   LIIGVEIAERFAFYGASSNLINFLTDQLQQSTARAAKNINAWSGTAALLPLLGAFLADCF  97

Query  433  LDSYSTILGSAFFYILGLIALTSTA  507
            L  Y TI+ S+  Y+LGL  LT +A
Sbjct  98   LGRYRTIIISSALYVLGLGLLTVSA  122



>gb|KFK44350.1| hypothetical protein AALP_AA1G246200 [Arabis alpina]
Length=565

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+A+NL+TYLT     S ++AA  VN W G  S++P+L A +AD+Y
Sbjct  40   FIIGVEVAERFAYFGIASNLITYLTGPLGQSTATAAVNVNTWSGTASILPILGAFVADAY  99

Query  433  LDSYSTILGSAFFYILGLIALT  498
            L  Y TIL ++F YI+GL  LT
Sbjct  100  LGRYRTILVASFIYIIGLGLLT  121



>gb|ABR32184.1| peptide transporter [Hakea actites]
Length=567

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF++ G+  NL+TYLT   + S  +AA  VN W G  SM+PLL A +AD+YL  Y TIL
Sbjct  42   ERFSYYGIQGNLITYLTGPLQQSTVTAAVNVNTWSGVASMLPLLGAFVADAYLGRYWTIL  101

Query  457  GSAFFYILGLIALTSTAM  510
             ++  Y+LGL  LT +A+
Sbjct  102  FASLLYVLGLSFLTLSAV  119



>ref|XP_002323528.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEF05289.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=587

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +IVI   ER ++ GVA +L+ YLT V      +AA+ VN W G T+++PL  
Sbjct  36   GVWKATLFIIVIEFSERLSYFGVATSLIIYLTKVIHQDLKTAARNVNYWAGVTTLMPLFG  95

Query  412  APLADSYLDSYSTILGSAFFYILGLIALT  498
              LAD+Y   ++T+  S+  Y+LGLI LT
Sbjct  96   GFLADAYFGRFTTVFLSSVVYLLGLILLT  124



>ref|XP_003516904.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Glycine max]
Length=594

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 7/124 (6%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  I +I I   ER ++ G+A +LV YLT V      +A K VN W G T+++PLL   L
Sbjct  41   KASIFIIAIEFSERLSYFGIATSLVIYLTKVLHQDLKTAVKNVNYWSGVTTLMPLLGGFL  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAM--GWPPGSNNA-----QKISSSSLSWPLHL  579
            AD+YL  Y+T++ S   Y++GL+ L+ +    G+ P  + +     ++I        ++L
Sbjct  101  ADAYLGRYTTVITSCIVYLMGLVLLSLSWFIPGFKPCDHTSTCTEPRRIHEVVFFLGIYL  160

Query  580  ISLG  591
            IS+G
Sbjct  161  ISVG  164



>ref|XP_004308589.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Fragaria vesca 
subsp. vesca]
Length=551

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +1

Query  247  CILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLAD  426
             I +I +   ERF + G+A NL+ YLT+      ++AAK VN W G +S+ P+L A +AD
Sbjct  16   AIFIIFVEVAERFAYYGLAGNLIMYLTNELHQPTATAAKNVNMWIGLSSLFPILGAIVAD  75

Query  427  SYLDSYSTILGSAFFYILGLIALTSTA  507
            SYL  + TI+ S   Y LG++ L  +A
Sbjct  76   SYLGRFKTIIYSTCIYFLGMVMLCLSA  102



>ref|XP_009621141.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Nicotiana tomentosiformis]
Length=597

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 6/126 (5%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I I   ER ++ G+A +L+ YLT V      +AA  VN W G T+++PLL 
Sbjct  43   GVWKASLFIIAIEFSERLSYFGIATSLIIYLTKVIHQDLKTAAISVNYWSGVTTLMPLLG  102

Query  412  APLADSYLDSYSTILGSAFFYILGLIALTSTAMG---WPPGSN---NAQKISSSSLSWPL  573
              LAD+YL  +ST+L S+  Y LGL+ LT + +     P  SN    ++K+        +
Sbjct  103  GFLADAYLGRFSTVLVSSTVYFLGLLLLTMSRVVPSLKPCDSNLCDESKKVHEPIFFLAI  162

Query  574  HLISLG  591
            +LIS+G
Sbjct  163  YLISIG  168



>emb|CDP10688.1| unnamed protein product [Coffea canephora]
Length=577

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I +   ERF + G++ NL++YLT     S ++AA+ VN W G   M+PLL A +
Sbjct  44   KSASFIICVEMAERFVYYGISVNLISYLTGPLGQSTATAAENVNAWSGTAQMLPLLGAFV  103

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADS+L  Y TIL S+  YILGL  LT
Sbjct  104  ADSFLGRYRTILISSLLYILGLGFLT  129



>ref|XP_004507194.1| PREDICTED: putative peptide/nitrate transporter At2g37900-like 
[Cicer arietinum]
Length=593

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I I   ER ++ G+A +LV YLT V      +A K VN W G T+++PL    L
Sbjct  41   KAAFFIIAIEFSERLSYFGIATSLVIYLTKVMHQDLKTAVKNVNYWSGVTTLMPLFGGFL  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSYL  Y+T++ S   Y++GLI L+
Sbjct  101  ADSYLGRYTTVIASCIIYLMGLILLS  126



>gb|KHN11892.1| Putative peptide/nitrate transporter [Glycine soja]
Length=594

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 13/127 (10%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K  I +I I   ER ++ G+A +LV YLT V      +A K VN W G T+++PLL   L
Sbjct  41   KASIFIIAIEFSERLSYFGIATSLVIYLTKVLHQDLKTAVKNVNYWSGVTTLMPLLGGFL  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALTSTAMGW----------PPGSNNAQKISSSSLSWP  570
            AD+YL  Y+T++ S   Y++GL+ L+   + W          P      ++I        
Sbjct  101  ADAYLGRYTTVITSCIVYLMGLVLLS---LSWFLPGFKPCDHPSTCTEPRRIHEVVFFLG  157

Query  571  LHLISLG  591
            ++LIS+G
Sbjct  158  IYLISVG  164



>ref|XP_010033212.1| PREDICTED: protein NRT1/ PTR FAMILY 5.6-like [Eucalyptus grandis]
 gb|KCW52791.1| hypothetical protein EUGRSUZ_J02126 [Eucalyptus grandis]
Length=600

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +1

Query  232  GLNKPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLV  411
            G+ K  + +I I   ER ++ G+A NL++YLT V      +AAK VN W G T+M+PL+ 
Sbjct  38   GVWKASLFIITIEFSERLSYFGIATNLISYLTKVIHQDLETAAKNVNYWAGVTTMMPLIG  97

Query  412  APLADSYLDSYSTILGSAFFYILGLIALT  498
              LAD+Y   ++ IL S+  Y++GL  LT
Sbjct  98   GFLADAYTGRFAIILVSSLIYLMGLSLLT  126



>ref|XP_004241845.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X1 [Solanum 
lycopersicum]
Length=566

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  253  LLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSY  432
             +I +   ERF + G+A+NL++YLT     S +SAA+ VN W G  S++PLL A +ADSY
Sbjct  43   FIIGVEVAERFAYYGIASNLISYLTGPLGQSVASAAENVNIWSGTASLLPLLGAFIADSY  102

Query  433  LDSYSTILGSAFFYILGLIALT  498
            L  Y TI+ S+  YILGL  LT
Sbjct  103  LGRYRTIIISSVLYILGLGFLT  124



>ref|XP_008245631.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Prunus mume]
Length=567

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  250  ILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADS  429
            I +I +   ++F F G+A+NL+ YLT+V     ++AAK VN W G +S+ P+L A +ADS
Sbjct  22   IFIIFVEVAQQFAFYGLASNLIMYLTNVLDQPLATAAKNVNTWLGVSSVFPVLGAFVADS  81

Query  430  YLDSYSTILGSAFFYILGLIALT  498
            YL  ++TIL S   Y +G++ LT
Sbjct  82   YLGRFTTILFSITIYFMGMVLLT  104



>ref|XP_010498730.1| PREDICTED: protein NRT1/ PTR FAMILY 5.15 isoform X1 [Camelina 
sativa]
Length=550

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G+A NL+TYLT     S ++AA  VN W G  S++P+L A LAD+YL  Y TIL
Sbjct  47   ERFAYFGIACNLITYLTGPLGQSTATAAVNVNTWSGTASLLPILGAFLADAYLGRYRTIL  106

Query  457  GSAFFYILGLIALTSTAMGWP  519
             ++  YILGL  LT +A   P
Sbjct  107  LASLVYILGLGLLTLSASAKP  127



>gb|KEH28963.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=593

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  241  KPCILLIVIAGMERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPL  420
            K    +I I   ER ++ G+A +LV YLT V      +A + VN W G T+++PL    L
Sbjct  41   KASFFIIAIEFSERLSYFGIATSLVIYLTKVMHQDLKTAVRNVNYWSGVTTLMPLFGGFL  100

Query  421  ADSYLDSYSTILGSAFFYILGLIALT  498
            ADSYL  Y+T++ S   Y++GL+ LT
Sbjct  101  ADSYLGRYTTVIASCIIYLMGLVLLT  126



>ref|XP_010091027.1| hypothetical protein L484_000418 [Morus notabilis]
 gb|EXC36653.1| hypothetical protein L484_000418 [Morus notabilis]
Length=140

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +1

Query  277  ERFTFKGVAANLVTYLTDVAKMSNSSAAKLVNNWCGFTSMVPLLVAPLADSYLDSYSTIL  456
            ERF + G++ANL+TYLT   + S +SAA  VN W G   ++PLL A +ADS+L  Y TI 
Sbjct  56   ERFAYYGISANLITYLTGTLRQSTASAAASVNAWSGAAFLLPLLGAFVADSFLGRYRTIA  115

Query  457  GSAFFYIL  480
             ++F YIL
Sbjct  116  LASFLYIL  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395