BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018C04 223 bp,:Filtered

Length=200
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074309.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  75.9    1e-14   Sesamum indicum [beniseed]
ref|XP_011074310.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  73.9    2e-14   Sesamum indicum [beniseed]
gb|EYU36415.1|  hypothetical protein MIMGU_mgv1a009474mg              75.1    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_011100978.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  75.1    3e-14   Sesamum indicum [beniseed]
ref|XP_006356804.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  73.9    6e-14   Solanum tuberosum [potatoes]
ref|XP_010320270.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  73.2    6e-14   Solanum lycopersicum
ref|XP_009767648.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.8    7e-14   Nicotiana sylvestris
ref|XP_009762289.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  73.6    9e-14   Nicotiana sylvestris
ref|XP_009595725.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.4    9e-14   Nicotiana tomentosiformis
ref|XP_011100979.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.8    9e-14   Sesamum indicum [beniseed]
ref|XP_009762291.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.4    9e-14   Nicotiana sylvestris
ref|XP_009767647.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.8    9e-14   Nicotiana sylvestris
ref|XP_009629045.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.0    1e-13   Nicotiana tomentosiformis
ref|XP_009595724.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  73.2    1e-13   Nicotiana tomentosiformis
ref|XP_009767646.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  73.2    1e-13   Nicotiana sylvestris
ref|XP_009762290.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.0    1e-13   Nicotiana sylvestris
ref|XP_004238049.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.8    2e-13   Solanum lycopersicum
ref|XP_009629044.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.4    2e-13   Nicotiana tomentosiformis
ref|XP_010320268.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.8    2e-13   Solanum lycopersicum
ref|XP_009629043.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.4    2e-13   Nicotiana tomentosiformis
ref|XP_010320269.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  71.6    2e-13   Solanum lycopersicum
emb|CDP00982.1|  unnamed protein product                              70.9    6e-13   Coffea canephora [robusta coffee]
ref|XP_004252730.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  71.2    6e-13   Solanum lycopersicum
gb|EPS59391.1|  hypothetical protein M569_15417                       69.7    1e-12   Genlisea aurea
ref|XP_002466534.1|  hypothetical protein SORBIDRAFT_01g009550        69.3    4e-12   Sorghum bicolor [broomcorn]
ref|NP_001149374.1|  inositol-tetrakisphosphate 1-kinase 3            68.9    4e-12   Zea mays [maize]
ref|NP_001183007.1|  uncharacterized protein LOC100501327             67.8    4e-12   Zea mays [maize]
gb|EEE59845.1|  hypothetical protein OsJ_12420                        68.9    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132657.1|  uncharacterized protein LOC100194132             68.9    5e-12   Zea mays [maize]
ref|XP_010230632.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  67.8    5e-12   Brachypodium distachyon [annual false brome]
ref|XP_004981920.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  68.9    5e-12   Setaria italica
sp|B8AR41.1|ITPK3_ORYSI  RecName: Full=Inositol-tetrakisphosphate...  68.9    5e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001051133.1|  Os03g0726200                                     68.9    5e-12   
ref|XP_003560387.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  68.9    6e-12   Brachypodium distachyon [annual false brome]
ref|XP_004981921.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  68.2    6e-12   
ref|XP_006650525.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  68.9    6e-12   Oryza brachyantha
gb|KJB64014.1|  hypothetical protein B456_010G029600                  67.0    6e-12   Gossypium raimondii
gb|EMT18536.1|  Inositol-tetrakisphosphate 1-kinase 2                 68.6    7e-12   Aegilops tauschii
ref|XP_010664463.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  66.6    9e-12   Vitis vinifera
gb|EMS48261.1|  Inositol-tetrakisphosphate 1-kinase 2                 68.2    9e-12   Triticum urartu
gb|KDP41554.1|  hypothetical protein JCGZ_15961                       68.2    1e-11   Jatropha curcas
gb|KHG24474.1|  Inositol-tetrakisphosphate 1-kinase 2 -like protein   68.2    1e-11   Gossypium arboreum [tree cotton]
gb|KJB64016.1|  hypothetical protein B456_010G029600                  67.8    1e-11   Gossypium raimondii
gb|KJB64015.1|  hypothetical protein B456_010G029600                  67.4    2e-11   Gossypium raimondii
ref|XP_010061594.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  65.9    2e-11   Eucalyptus grandis [rose gum]
gb|KJB64017.1|  hypothetical protein B456_010G029600                  66.6    2e-11   Gossypium raimondii
gb|KJB64013.1|  hypothetical protein B456_010G029600                  67.0    2e-11   Gossypium raimondii
ref|XP_002285550.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  67.4    2e-11   Vitis vinifera
gb|KDO81371.1|  hypothetical protein CISIN_1g019319mg                 65.5    2e-11   Citrus sinensis [Valencia orange]
gb|KJB58739.1|  hypothetical protein B456_009G224300                  65.5    2e-11   Gossypium raimondii
ref|XP_010664462.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  66.6    2e-11   Vitis vinifera
emb|CBI19336.3|  unnamed protein product                              66.2    3e-11   Vitis vinifera
gb|KCW68585.1|  hypothetical protein EUGRSUZ_F02197                   65.9    4e-11   Eucalyptus grandis [rose gum]
ref|XP_008219148.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  64.7    5e-11   Prunus mume [ume]
ref|XP_002306515.2|  hypothetical protein POPTR_0005s19370g           66.2    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007137272.1|  hypothetical protein PHAVU_009G113600g           66.2    5e-11   Phaseolus vulgaris [French bean]
emb|CAY10405.1|  inositol 1,3,4-triphosphate 5/6-kinase               64.3    6e-11   Phaseolus vulgaris [French bean]
ref|XP_006852757.1|  hypothetical protein AMTR_s00033p00122000        67.4    6e-11   
ref|XP_011014078.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  65.9    6e-11   Populus euphratica
ref|XP_007018386.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  65.9    6e-11   Theobroma cacao [chocolate]
ref|XP_007018385.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  65.9    7e-11   Theobroma cacao [chocolate]
ref|XP_007018384.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  65.9    8e-11   Theobroma cacao [chocolate]
gb|KJB58745.1|  hypothetical protein B456_009G224300                  65.5    8e-11   Gossypium raimondii
ref|XP_006578248.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    9e-11   Glycine max [soybeans]
ref|XP_008444979.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    9e-11   Cucumis melo [Oriental melon]
gb|KJB58741.1|  hypothetical protein B456_009G224300                  64.7    1e-10   Gossypium raimondii
ref|XP_010556496.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    1e-10   Tarenaya hassleriana [spider flower]
gb|KJB58742.1|  hypothetical protein B456_009G224300                  64.7    1e-10   Gossypium raimondii
ref|XP_006580905.1|  PREDICTED: inositol phosphate kinase isoform X2  63.5    1e-10   Glycine max [soybeans]
ref|XP_010245607.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.5    1e-10   Nelumbo nucifera [Indian lotus]
gb|KHG16711.1|  Inositol-tetrakisphosphate 1-kinase 2 -like protein   64.7    1e-10   Gossypium arboreum [tree cotton]
gb|KJB58744.1|  hypothetical protein B456_009G224300                  64.7    1e-10   Gossypium raimondii
gb|KDO81366.1|  hypothetical protein CISIN_1g019319mg                 65.1    1e-10   Citrus sinensis [Valencia orange]
ref|XP_010266775.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  65.1    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_004162980.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  64.3    1e-10   
ref|XP_006853727.1|  hypothetical protein AMTR_s00056p00164210        65.1    2e-10   
ref|XP_006472364.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.2    2e-10   
gb|KDO81373.1|  hypothetical protein CISIN_1g019319mg                 63.2    2e-10   Citrus sinensis [Valencia orange]
ref|XP_010245608.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.5    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010692649.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  64.7    2e-10   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KJB58743.1|  hypothetical protein B456_009G224300                  64.3    2e-10   Gossypium raimondii
ref|XP_011464780.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.2    2e-10   Fragaria vesca subsp. vesca
ref|XP_010245606.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  64.7    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006433700.1|  hypothetical protein CICLE_v10001756mg           63.5    2e-10   Citrus clementina
ref|XP_009335474.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_008378690.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    2e-10   
gb|KDO81372.1|  hypothetical protein CISIN_1g019319mg                 63.2    3e-10   Citrus sinensis [Valencia orange]
ref|XP_009392949.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN08196.1|  Inositol-tetrakisphosphate 1-kinase 2                 63.9    3e-10   Glycine soja [wild soybean]
ref|XP_003522727.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    3e-10   Glycine max [soybeans]
ref|XP_010936234.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    3e-10   Elaeis guineensis
ref|NP_001237484.1|  inositol phosphate kinase                        63.9    3e-10   Glycine max [soybeans]
ref|XP_008219147.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    3e-10   Prunus mume [ume]
ref|XP_007222539.1|  hypothetical protein PRUPE_ppa008332mg           63.9    3e-10   Prunus persica
gb|KDO81367.1|  hypothetical protein CISIN_1g019319mg                 63.2    3e-10   Citrus sinensis [Valencia orange]
ref|XP_002510017.1|  Inositol-tetrakisphosphate 1-kinase, putative    63.9    3e-10   Ricinus communis
ref|XP_008444978.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    3e-10   Cucumis melo [Oriental melon]
ref|XP_009392388.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.9    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004148431.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.5    4e-10   
ref|XP_004496803.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.2    4e-10   
gb|KGN62786.1|  hypothetical protein Csa_2G372810                     63.9    4e-10   Cucumis sativus [cucumbers]
gb|AHN60080.1|  inositol 1,3,4-trisphosphate 5/6 kinase-4             63.5    4e-10   Glycine max [soybeans]
gb|KEH27336.1|  inositol 1,3,4-trisphosphate 5/6-kinase               62.8    4e-10   Medicago truncatula
gb|KEH27333.1|  inositol 1,3,4-trisphosphate 5/6-kinase               63.5    4e-10   Medicago truncatula
ref|XP_006472363.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.2    4e-10   Citrus sinensis [Valencia orange]
ref|XP_006649677.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.2    5e-10   
ref|XP_006472362.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.5    5e-10   Citrus sinensis [Valencia orange]
ref|XP_006433699.1|  hypothetical protein CICLE_v10001756mg           63.5    5e-10   Citrus clementina
gb|KEH27335.1|  inositol 1,3,4-trisphosphate 5/6-kinase               63.2    5e-10   Medicago truncatula
ref|XP_003610643.1|  Inositol-tetrakisphosphate 1-kinase              63.5    5e-10   Medicago truncatula
ref|XP_004299849.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.2    5e-10   Fragaria vesca subsp. vesca
ref|XP_010104536.1|  Inositol-tetrakisphosphate 1-kinase 2            63.9    6e-10   Morus notabilis
ref|XP_010556495.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.5    6e-10   Tarenaya hassleriana [spider flower]
gb|KDO81364.1|  hypothetical protein CISIN_1g019319mg                 63.2    6e-10   Citrus sinensis [Valencia orange]
gb|KEH43982.1|  inositol 1,3,4-trisphosphate 5/6-kinase               63.2    7e-10   Medicago truncatula
ref|XP_006649675.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  63.2    7e-10   Oryza brachyantha
gb|KEH27334.1|  inositol 1,3,4-trisphosphate 5/6-kinase               62.4    7e-10   Medicago truncatula
gb|KHN23182.1|  Inositol-tetrakisphosphate 1-kinase 2                 62.8    8e-10   Glycine soja [wild soybean]
ref|XP_006649676.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    8e-10   
ref|XP_004496800.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    8e-10   Cicer arietinum [garbanzo]
ref|XP_002522099.1|  Inositol-tetrakisphosphate 1-kinase, putative    62.8    8e-10   
gb|KJB59870.1|  hypothetical protein B456_009G277900                  62.0    8e-10   Gossypium raimondii
gb|EEE58643.1|  hypothetical protein OsJ_10020                        62.8    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936231.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    9e-10   Elaeis guineensis
ref|NP_001049457.1|  Os03g0230500                                     62.8    9e-10   
ref|NP_001237500.1|  inositol phosphate kinase                        62.8    9e-10   Glycine max [soybeans]
ref|XP_004496802.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    9e-10   
dbj|BAJ88512.1|  predicted protein                                    62.8    9e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008790412.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.8    1e-09   
ref|XP_006649674.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    1e-09   
gb|AAO00682.1|  Putative inositol 1,3,4-trisphosphate 5/6-kinase      62.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007143146.1|  hypothetical protein PHAVU_007G047700g           62.4    1e-09   Phaseolus vulgaris [French bean]
ref|NP_849342.1|  inositol-tetrakisphosphate 1-kinase 2               61.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649673.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.8    1e-09   
ref|XP_006288032.1|  hypothetical protein CARUB_v10001263mg           61.6    1e-09   Capsella rubella
ref|XP_006606008.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.2    1e-09   Glycine max [soybeans]
gb|KEH43981.1|  inositol 1,3,4-trisphosphate 5/6-kinase               62.0    1e-09   Medicago truncatula
ref|XP_006588357.1|  PREDICTED: inositol phosphate kinase isoform X1  61.2    1e-09   Glycine max [soybeans]
gb|ABS78989.1|  At4g08170-like protein                                59.3    1e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_009335473.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_010939316.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    1e-09   Elaeis guineensis
ref|XP_010520809.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.4    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_008378689.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    1e-09   Malus domestica [apple tree]
ref|XP_010496551.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.1    2e-09   Camelina sativa [gold-of-pleasure]
gb|EMT25398.1|  Inositol-tetrakisphosphate 1-kinase 2                 62.4    2e-09   Aegilops tauschii
gb|ABS78976.1|  At4g08170-like protein                                59.3    2e-09   Arabidopsis lyrata subsp. petraea
gb|ABS78975.1|  At4g08170-like protein                                58.9    2e-09   Arabidopsis lyrata subsp. petraea
ref|XP_010095746.1|  Inositol-tetrakisphosphate 1-kinase 2            62.0    2e-09   Morus notabilis
ref|XP_010939317.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    2e-09   Elaeis guineensis
ref|XP_010455235.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.2    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_007143147.1|  hypothetical protein PHAVU_007G047700g           61.2    2e-09   Phaseolus vulgaris [French bean]
ref|XP_010520808.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    2e-09   Tarenaya hassleriana [spider flower]
emb|CAB45787.1|  inositol 1, 3, 4-trisphosphate 5/6-kinase-like p...  62.0    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KHN01570.1|  Inositol-tetrakisphosphate 1-kinase 2                 61.6    2e-09   Glycine soja [wild soybean]
ref|XP_003555305.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    2e-09   Glycine max [soybeans]
gb|ABS78973.1|  At4g08170-like protein                                59.3    2e-09   Arabidopsis halleri subsp. halleri
ref|XP_006288033.1|  hypothetical protein CARUB_v10001263mg           62.0    2e-09   Capsella rubella
ref|XP_010438590.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.5    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010520811.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.2    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_010936232.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    2e-09   Elaeis guineensis
ref|XP_010455233.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010438566.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008790410.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    2e-09   Phoenix dactylifera
ref|XP_010455236.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.1    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008790411.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    2e-09   Phoenix dactylifera
ref|NP_001190687.1|  inositol-tetrakisphosphate 1-kinase 2            60.1    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008785700.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    2e-09   Phoenix dactylifera
gb|ABS78974.1|  At4g08170-like protein                                58.9    2e-09   Arabidopsis lyrata subsp. petraea
gb|EMS58471.1|  Inositol-tetrakisphosphate 1-kinase 2                 62.0    2e-09   Triticum urartu
ref|XP_008785701.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.2    2e-09   
ref|XP_011002444.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.1    2e-09   Populus euphratica
ref|XP_010496546.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.1    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010520810.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.8    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_008785699.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.2    3e-09   Phoenix dactylifera
ref|XP_008382922.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  59.3    4e-09   
ref|XP_007042700.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  59.7    5e-09   Theobroma cacao [chocolate]
gb|KDP44556.1|  hypothetical protein JCGZ_16389                       60.5    5e-09   Jatropha curcas
ref|XP_008787235.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.9    6e-09   Phoenix dactylifera
ref|XP_010530696.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.9    6e-09   Tarenaya hassleriana [spider flower]
emb|CDO97311.1|  unnamed protein product                              60.1    7e-09   Coffea canephora [robusta coffee]
ref|NP_567334.1|  inositol-tetrakisphosphate 1-kinase 2               60.5    7e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49519.1|  hypothetical protein CISIN_1g0190762mg                58.5    7e-09   Citrus sinensis [Valencia orange]
ref|XP_004289707.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.1    7e-09   Fragaria vesca subsp. vesca
ref|XP_002313195.2|  hypothetical protein POPTR_0009s08800g           59.3    7e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006409646.1|  hypothetical protein EUTSA_v10022771mg           60.1    8e-09   Eutrema salsugineum
ref|XP_007042697.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  60.1    8e-09   Theobroma cacao [chocolate]
ref|XP_008787233.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  59.7    9e-09   Phoenix dactylifera
ref|XP_007042699.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  59.7    1e-08   Theobroma cacao [chocolate]
ref|XP_010530695.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.1    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_010530694.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.1    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_002465608.1|  hypothetical protein SORBIDRAFT_01g042010        59.7    1e-08   Sorghum bicolor [broomcorn]
gb|KFK39974.1|  hypothetical protein AALP_AA3G313500                  59.7    1e-08   Arabis alpina [alpine rockcress]
gb|ACN27814.1|  unknown                                               59.7    1e-08   Zea mays [maize]
ref|XP_002885929.1|  hypothetical protein ARALYDRAFT_343072           59.7    1e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_006422737.1|  hypothetical protein CICLE_v100287892mg          58.5    1e-08   Citrus clementina
ref|XP_010691534.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  59.7    1e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
sp|A2Z4C5.1|ITPK1_ORYSI  RecName: Full=Inositol-tetrakisphosphate...  59.7    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_002874521.1|  predicted protein                                59.7    1e-08   Arabidopsis lyrata subsp. lyrata
ref|NP_001064019.1|  Os10g0103800                                     59.3    1e-08   
ref|XP_011002432.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  59.7    1e-08   Populus euphratica
ref|XP_006422735.1|  hypothetical protein CICLE_v100287892mg          58.2    2e-08   Citrus clementina
gb|KDO49518.1|  hypothetical protein CISIN_1g0190762mg                57.8    2e-08   Citrus sinensis [Valencia orange]
ref|NP_001149152.1|  inositol-tetrakisphosphate 1-kinase 3            59.3    2e-08   Zea mays [maize]
emb|CDY65442.1|  BnaCnng47190D                                        58.9    2e-08   Brassica napus [oilseed rape]
ref|XP_004985117.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.9    2e-08   Setaria italica
ref|XP_006486873.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    2e-08   
gb|KDO49516.1|  hypothetical protein CISIN_1g0190762mg                57.8    3e-08   Citrus sinensis [Valencia orange]
ref|XP_010942049.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    3e-08   Elaeis guineensis
ref|XP_006486875.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  57.8    3e-08   
emb|CDX93142.1|  BnaA03g38640D                                        58.2    3e-08   Brassica napus [oilseed rape]
gb|KDO49520.1|  hypothetical protein CISIN_1g0190762mg                56.6    3e-08   Citrus sinensis [Valencia orange]
gb|AAK00417.2|  Putative inositol 1,3,4-trisphosphate 5/6-kinase      58.5    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662130.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    3e-08   Oryza brachyantha
ref|XP_009136248.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    4e-08   Brassica rapa
ref|XP_009335375.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    4e-08   Pyrus x bretschneideri [bai li]
ref|XP_006486871.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    4e-08   Citrus sinensis [Valencia orange]
emb|CDX75380.1|  BnaA01g03220D                                        56.6    4e-08   Brassica napus [oilseed rape]
ref|XP_006486872.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    4e-08   
ref|XP_006486874.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  57.0    5e-08   Citrus sinensis [Valencia orange]
ref|XP_009108776.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  56.2    6e-08   Brassica rapa
ref|XP_003573753.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  57.4    7e-08   Brachypodium distachyon [annual false brome]
emb|CDX72427.1|  BnaC07g44490D                                        57.4    8e-08   Brassica napus [oilseed rape]
ref|XP_009138214.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  57.4    8e-08   Brassica rapa
emb|CDY49374.1|  BnaA03g50630D                                        57.4    8e-08   Brassica napus [oilseed rape]
ref|XP_008372953.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  55.1    1e-07   Malus domestica [apple tree]
gb|KCW56832.1|  hypothetical protein EUGRSUZ_I02502                   56.2    1e-07   Eucalyptus grandis [rose gum]
ref|XP_001785995.1|  predicted protein                                57.0    1e-07   Physcomitrella patens
ref|XP_008236242.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  56.6    1e-07   Prunus mume [ume]
ref|XP_007199195.1|  hypothetical protein PRUPE_ppa021570mg           56.6    1e-07   Prunus persica
ref|XP_010029880.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  56.2    1e-07   Eucalyptus grandis [rose gum]
ref|XP_006283878.1|  hypothetical protein CARUB_v10004995mg           56.6    2e-07   Capsella rubella
ref|XP_008372954.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  55.1    2e-07   Malus domestica [apple tree]
ref|NP_195103.3|  inositol-tetrakisphosphate 1-kinase 3               56.6    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124138.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  56.2    2e-07   Brassica rapa
ref|XP_010686679.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  53.9    2e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009108774.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  56.2    2e-07   Brassica rapa
gb|AID60099.1|  inositol 1,3,4-trisphosphate 5/6-kinase family pr...  56.2    2e-07   Brassica napus [oilseed rape]
ref|XP_009108775.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  55.8    2e-07   Brassica rapa
emb|CDY28319.1|  BnaC03g66400D                                        55.8    2e-07   Brassica napus [oilseed rape]
ref|NP_001078490.1|  inositol-tetrakisphosphate 1-kinase 3            55.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001779145.1|  predicted protein                                55.8    2e-07   Physcomitrella patens
ref|XP_010437720.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  56.2    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002867160.1|  inositol 1,3,4-trisphosphate 5/6-kinase fami...  56.2    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_006412314.1|  hypothetical protein EUTSA_v10025442mg           55.8    3e-07   Eutrema salsugineum
emb|CDY70702.1|  BnaAnng34680D                                        55.8    3e-07   Brassica napus [oilseed rape]
emb|CDX69005.1|  BnaC01g04480D                                        55.8    3e-07   Brassica napus [oilseed rape]
gb|KFK30006.1|  hypothetical protein AALP_AA7G205500                  55.8    3e-07   Arabis alpina [alpine rockcress]
emb|CAA20590.1|  putative protein                                     55.8    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119433.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  55.8    3e-07   Brassica rapa
ref|XP_001761051.1|  predicted protein                                55.1    4e-07   Physcomitrella patens
ref|XP_010432517.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  55.5    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010447198.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  55.5    4e-07   Camelina sativa [gold-of-pleasure]
gb|EPS73197.1|  hypothetical protein M569_01552                       54.7    7e-07   Genlisea aurea
ref|XP_010908482.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  54.3    1e-06   Elaeis guineensis
gb|KJB32207.1|  hypothetical protein B456_005G229400                  52.8    3e-06   Gossypium raimondii
gb|KJB32208.1|  hypothetical protein B456_005G229400                  52.8    3e-06   Gossypium raimondii
emb|CAL49035.1|  inositol phosphate kinase                            52.8    4e-06   Hordeum vulgare [barley]
gb|EMS68297.1|  Inositol-tetrakisphosphate 1-kinase 1                 52.8    4e-06   Triticum urartu
gb|KJB32206.1|  hypothetical protein B456_005G229400                  52.0    5e-06   Gossypium raimondii
ref|XP_011082357.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  52.4    5e-06   Sesamum indicum [beniseed]
ref|XP_010235046.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  52.0    6e-06   Brachypodium distachyon [annual false brome]
ref|XP_010695549.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  52.0    6e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EYU34149.1|  hypothetical protein MIMGU_mgv1a027043mg              52.0    7e-06   Erythranthe guttata [common monkey flower]
sp|Q7XBW0.1|ITPK5_ORYSJ  RecName: Full=Inositol-tetrakisphosphate...  51.6    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065485.1|  Os10g0576100                                     51.6    7e-06   
ref|XP_011088037.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  51.6    8e-06   Sesamum indicum [beniseed]
gb|EAY79626.1|  hypothetical protein OsI_34771                        51.6    8e-06   Oryza sativa Indica Group [Indian rice]
gb|ACR36742.1|  unknown                                               51.2    8e-06   Zea mays [maize]
ref|XP_002464877.1|  hypothetical protein SORBIDRAFT_01g028090        51.6    9e-06   Sorghum bicolor [broomcorn]
ref|XP_011088035.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  51.2    9e-06   Sesamum indicum [beniseed]
ref|XP_009396845.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  51.2    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105901.1|  inositol-tetrakisphosphate 1-kinase 1            51.2    1e-05   Zea mays [maize]
gb|ACG37127.1|  inositol-tetrakisphosphate 1-kinase 1                 51.2    1e-05   Zea mays [maize]
ref|XP_004983548.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  51.2    1e-05   Setaria italica
ref|XP_010274276.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  50.8    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_002279736.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  50.8    2e-05   Vitis vinifera
ref|XP_006662634.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  50.4    2e-05   Oryza brachyantha
ref|XP_007040636.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  50.8    2e-05   Theobroma cacao [chocolate]
gb|EYU37541.1|  hypothetical protein MIMGU_mgv1a009632mg              50.4    2e-05   Erythranthe guttata [common monkey flower]
gb|KJB39835.1|  hypothetical protein B456_007G033100                  50.4    2e-05   
ref|XP_010495234.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    2e-05   
gb|KCW77969.1|  hypothetical protein EUGRSUZ_D02214                   50.1    2e-05   
gb|EYU37540.1|  hypothetical protein MIMGU_mgv1a009632mg              50.1    2e-05   
gb|KFK25896.1|  hypothetical protein AALP_AA8G176700                  50.1    2e-05   
ref|XP_010053625.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-tet...  50.4    2e-05   
ref|XP_008465996.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  50.1    3e-05   
ref|XP_008465995.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  50.1    3e-05   
ref|XP_007158285.1|  hypothetical protein PHAVU_002G139700g           49.7    4e-05   
ref|XP_002974206.1|  hypothetical protein SELMODRAFT_232261           49.7    4e-05   
gb|KJB37539.1|  hypothetical protein B456_006G217500                  49.7    4e-05   
ref|XP_004300416.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.7    4e-05   
gb|KJB37538.1|  hypothetical protein B456_006G217500                  49.7    4e-05   
ref|XP_002975059.1|  hypothetical protein SELMODRAFT_228325           49.3    4e-05   
ref|XP_004509737.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    4e-05   
ref|XP_003628787.1|  Inositol-tetrakisphosphate 1-kinase              49.3    5e-05   
emb|CDP13058.1|  unnamed protein product                              49.3    5e-05   
ref|XP_002303428.2|  hypothetical protein POPTR_0003s09290g           49.3    5e-05   
ref|XP_011018535.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    5e-05   
ref|XP_006368380.1|  hypothetical protein POPTR_0001s02250g           49.3    5e-05   
ref|XP_011028157.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    5e-05   
ref|XP_008448667.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    5e-05   
ref|XP_004148764.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    5e-05   
ref|NP_001237829.1|  inositol phosphate kinase                        49.3    6e-05   
ref|XP_004165320.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    6e-05   
ref|XP_004136195.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    6e-05   
emb|CDX69422.1|  BnaA10g17710D                                        48.9    6e-05   
ref|XP_006400218.1|  hypothetical protein EUTSA_v10014130mg           48.9    6e-05   
ref|XP_009121452.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    6e-05   
emb|CDY16981.1|  BnaC09g41080D                                        48.9    6e-05   
ref|XP_009340198.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    6e-05   
ref|XP_008340742.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    6e-05   
ref|XP_008373591.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    6e-05   
ref|XP_008238214.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    6e-05   
ref|XP_007210517.1|  hypothetical protein PRUPE_ppa007677mg           49.3    6e-05   
ref|XP_010492601.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    6e-05   
ref|XP_010240892.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    6e-05   
ref|XP_010055298.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    6e-05   
ref|XP_010453843.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    7e-05   
ref|NP_197178.1|  inositol-tetrakisphosphate 1-kinase 1               48.9    7e-05   
ref|XP_002871735.1|  inositol 1,3,4-trisphosphate 5/6-kinase          48.9    7e-05   
gb|AAC28859.1|  inositol 1,3,4-trisphosphate 5/6-kinase               48.5    8e-05   
ref|XP_009781195.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    8e-05   
ref|XP_010420378.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    8e-05   
ref|XP_010325561.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    8e-05   
ref|NP_001274792.1|  inositol polyphosphate kinase                    48.9    8e-05   
ref|XP_006288234.1|  hypothetical protein CARUB_v10001475mg           48.5    8e-05   
ref|XP_010096964.1|  Inositol-tetrakisphosphate 1-kinase 1            48.9    8e-05   
gb|EPS70258.1|  hypothetical protein M569_04497                       48.5    8e-05   
emb|CDX70710.1|  BnaC03g07940D                                        48.5    8e-05   
ref|XP_010682778.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    1e-04   
ref|XP_004244396.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    1e-04   
ref|XP_006367451.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    1e-04   
ref|XP_009622646.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    1e-04   
gb|KHN04867.1|  Inositol-tetrakisphosphate 1-kinase 1                 48.1    1e-04   
ref|XP_002270915.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.1    1e-04   
gb|KHN38938.1|  Inositol-tetrakisphosphate 1-kinase 1                 48.1    1e-04   
ref|XP_003534282.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.1    1e-04   
ref|XP_010558621.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.1    1e-04   
emb|CAN68038.1|  hypothetical protein VITISV_018923                   48.1    1e-04   
ref|XP_009804255.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.1    1e-04   
ref|XP_007156414.1|  hypothetical protein PHAVU_003G284100g           47.8    2e-04   
ref|XP_009615323.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.8    2e-04   
gb|KDO52497.1|  hypothetical protein CISIN_1g047754mg                 47.4    2e-04   
ref|XP_006443289.1|  hypothetical protein CICLE_v10024568mg           47.4    2e-04   
ref|XP_004241443.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.0    3e-04   
ref|XP_006347589.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.0    3e-04   
ref|XP_010549846.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.0    3e-04   
emb|CDX78705.1|  BnaA03g06170D                                        47.0    3e-04   
ref|XP_006443251.1|  hypothetical protein CICLE_v10024487mg           46.6    4e-04   
ref|XP_004977967.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  45.4    5e-04   
ref|XP_009131556.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  46.2    5e-04   
gb|KDO47226.1|  hypothetical protein CISIN_1g037279mg                 45.8    7e-04   
ref|XP_004235341.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  45.8    7e-04   
ref|XP_006443245.1|  hypothetical protein CICLE_v10021128mg           45.8    8e-04   
ref|XP_001769918.1|  predicted protein                                45.8    8e-04   
ref|XP_006347338.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  45.8    8e-04   



>ref|XP_011074309.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Sesamum 
indicum]
Length=346

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYDE SLQ LEPPLVLQEFINHG
Sbjct  182  VAKPLVAKSHELSLAYDEFSLQKLEPPLVLQEFINHG  218



>ref|XP_011074310.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Sesamum 
indicum]
Length=210

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYDE SLQ LEPPLVLQEFINHG
Sbjct  46   VAKPLVAKSHELSLAYDEFSLQKLEPPLVLQEFINHG  82



>gb|EYU36415.1| hypothetical protein MIMGU_mgv1a009474mg [Erythranthe guttata]
Length=340

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYDE SLQ LEPPLVLQEFINHG
Sbjct  178  VAKPLVAKSHELSLAYDEFSLQKLEPPLVLQEFINHG  214



>ref|XP_011100978.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Sesamum indicum]
Length=352

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYDE SLQ LEPPLVLQEFINHG
Sbjct  188  VAKPLVAKSHELSLAYDEFSLQNLEPPLVLQEFINHG  224



>ref|XP_006356804.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Solanum 
tuberosum]
Length=337

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  172  VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  208



>ref|XP_010320270.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X4 [Solanum 
lycopersicum]
Length=274

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  177  VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  213



>ref|XP_009767648.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Nicotiana sylvestris]
Length=210

 Score = 72.8 bits (177),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD LSLQ LEPPLVLQEFINHG
Sbjct  46   VAKPLVAKSHELSLAYDTLSLQKLEPPLVLQEFINHG  82



>ref|XP_009762289.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Nicotiana sylvestris]
Length=340

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  175  VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  211



>ref|XP_009595725.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=210

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  46   VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  82



>ref|XP_011100979.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Sesamum indicum]
Length=268

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYDE SLQ LEPPLVLQEFINHG
Sbjct  104  VAKPLVAKSHELSLAYDEFSLQNLEPPLVLQEFINHG  140



>ref|XP_009762291.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Nicotiana sylvestris]
Length=211

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  46   VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  82



>ref|XP_009767647.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Nicotiana sylvestris]
Length=281

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD LSLQ LEPPLVLQEFINHG
Sbjct  117  VAKPLVAKSHELSLAYDTLSLQKLEPPLVLQEFINHG  153



>ref|XP_009629045.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Nicotiana tomentosiformis]
Length=210

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD LSLQ LEPPLVLQEFINHG
Sbjct  46   VAKPLVAKSHELSLAYDMLSLQKLEPPLVLQEFINHG  82



>ref|XP_009595724.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=339

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  175  VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  211



>ref|XP_009767646.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Nicotiana sylvestris]
Length=338

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD LSLQ LEPPLVLQEFINHG
Sbjct  174  VAKPLVAKSHELSLAYDTLSLQKLEPPLVLQEFINHG  210



>ref|XP_009762290.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Nicotiana sylvestris]
Length=256

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  91   VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  127



>ref|XP_004238049.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Solanum 
lycopersicum]
Length=333

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  168  VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  204



>ref|XP_009629044.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=324

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD LSLQ LEPPLVLQEFINHG
Sbjct  174  VAKPLVAKSHELSLAYDMLSLQKLEPPLVLQEFINHG  210



>ref|XP_010320268.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Solanum 
lycopersicum]
Length=342

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  177  VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  213



>ref|XP_009629043.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=338

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD LSLQ LEPPLVLQEFINHG
Sbjct  174  VAKPLVAKSHELSLAYDMLSLQKLEPPLVLQEFINHG  210



>ref|XP_010320269.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X3 [Solanum 
lycopersicum]
Length=285

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL AKSHELSLAYD+ SLQ+LEPPLVLQEFINHG
Sbjct  120  VAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHG  156



>emb|CDP00982.1| unnamed protein product [Coffea canephora]
Length=302

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD+ SL+ LEPPLVLQEFINHG
Sbjct  138  VAKPLVAKSHELSLAYDQYSLKKLEPPLVLQEFINHG  174



>ref|XP_004252730.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 [Solanum lycopersicum]
Length=338

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD +SLQ LEPPLVLQEFINHG
Sbjct  174  VAKPLVAKSHELSLAYDMVSLQKLEPPLVLQEFINHG  210



>gb|EPS59391.1| hypothetical protein M569_15417 [Genlisea aurea]
Length=259

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+AKSH+LS+AYDE +LQ LEPPL+LQEFINHG
Sbjct  161  VAKPLIAKSHDLSIAYDEFALQKLEPPLLLQEFINHG  197



>ref|XP_002466534.1| hypothetical protein SORBIDRAFT_01g009550 [Sorghum bicolor]
 gb|EER93532.1| hypothetical protein SORBIDRAFT_01g009550 [Sorghum bicolor]
Length=351

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  172  VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  208



>ref|NP_001149374.1| inositol-tetrakisphosphate 1-kinase 3 [Zea mays]
 gb|ACG35194.1| inositol-tetrakisphosphate 1-kinase 3 [Zea mays]
Length=341

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  170  VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  206



>ref|NP_001183007.1| uncharacterized protein LOC100501327 [Zea mays]
 gb|ACR35416.1| unknown [Zea mays]
 tpg|DAA51119.1| TPA: hypothetical protein ZEAMMB73_765373 [Zea mays]
Length=213

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  37   VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  73



>gb|EEE59845.1| hypothetical protein OsJ_12420 [Oryza sativa Japonica Group]
Length=334

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD +SL  LEPPLVLQEF+NHG
Sbjct  158  VAKPLVAKSHELSLAYDPISLTKLEPPLVLQEFVNHG  194



>ref|NP_001132657.1| uncharacterized protein LOC100194132 [Zea mays]
 gb|ACF81590.1| unknown [Zea mays]
 gb|ACG38324.1| inositol-tetrakisphosphate 1-kinase 3 [Zea mays]
 tpg|DAA51118.1| TPA: inositol-tetrakisphosphate 1-kinase 3 [Zea mays]
Length=348

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  169  VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  205



>ref|XP_010230632.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Brachypodium 
distachyon]
Length=251

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  75   VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  111



>ref|XP_004981920.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Setaria italica]
Length=346

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  170  VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  206



>sp|B8AR41.1|ITPK3_ORYSI RecName: Full=Inositol-tetrakisphosphate 1-kinase 3; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 3; Short=Inositol-triphosphate 
5/6-kinase 3; Short=Ins(1,3,4)P(3) 5/6-kinase 
3; Short=OsITP5/6K-3; Short=OsITPK3 [Oryza sativa Indica 
Group]
 gb|EEC76104.1| hypothetical protein OsI_13362 [Oryza sativa Indica Group]
Length=357

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD +SL  LEPPLVLQEF+NHG
Sbjct  181  VAKPLVAKSHELSLAYDPISLTKLEPPLVLQEFVNHG  217



>ref|NP_001051133.1| Os03g0726200 [Oryza sativa Japonica Group]
 sp|Q75GI4.1|ITPK3_ORYSJ RecName: Full=Inositol-tetrakisphosphate 1-kinase 3; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 3; Short=Inositol-triphosphate 
5/6-kinase 3; Short=Ins(1,3,4)P(3) 5/6-kinase 
3; Short=OsITP5/6K-3; Short=OsITPK3 [Oryza sativa Japonica 
Group]
 gb|AAS07160.1| putative inositol 1,3,4-trisphosphate 5/6-kinase [Oryza sativa 
Japonica Group]
 gb|AAT77080.1| putative inositol phosphate kinase [Oryza sativa Japonica Group]
 gb|ABF98644.1| inositol 1, 3, 4-trisphosphate 5/6-kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13047.1| Os03g0726200 [Oryza sativa Japonica Group]
 dbj|BAG90250.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD +SL  LEPPLVLQEF+NHG
Sbjct  181  VAKPLVAKSHELSLAYDPISLTKLEPPLVLQEFVNHG  217



>ref|XP_003560387.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Brachypodium 
distachyon]
Length=343

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  167  VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  203



>ref|XP_004981921.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Setaria italica]
Length=312

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  170  VAKPLVAKSHELSLAYDPTSLTKLEPPLVLQEFVNHG  206



>ref|XP_006650525.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Oryza 
brachyantha]
Length=347

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD +SL  LEPPLVLQEF+NHG
Sbjct  171  VAKPLVAKSHELSLAYDPISLTKLEPPLVLQEFVNHG  207



>gb|KJB64014.1| hypothetical protein B456_010G029600 [Gossypium raimondii]
Length=211

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYDE SLQ LEPPLVLQEF+NHG
Sbjct  37   VAKPLVADGSAKSHELSLAYDEYSLQKLEPPLVLQEFVNHG  77



>gb|EMT18536.1| Inositol-tetrakisphosphate 1-kinase 2 [Aegilops tauschii]
Length=344

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  141  VAKPLVAKSHELSLAYDSASLTKLEPPLVLQEFVNHG  177



>ref|XP_010664463.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X3 [Vitis 
vinifera]
Length=223

 Score = 66.6 bits (161),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVVDGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  86



>gb|EMS48261.1| Inositol-tetrakisphosphate 1-kinase 2 [Triticum urartu]
Length=365

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  137  VAKPLVAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVAKSHELSLAYD  SL  LEPPLVLQEF+NHG
Sbjct  121  VAKPLVAKSHELSLAYDAASLTKLEPPLVLQEFVNHG  157



>gb|KDP41554.1| hypothetical protein JCGZ_15961 [Jatropha curcas]
Length=354

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+LSLQ LEPPLVLQEF+NHG
Sbjct  179  VAKPLVADGSAKSHELSLAYDQLSLQKLEPPLVLQEFVNHG  219



>gb|KHG24474.1| Inositol-tetrakisphosphate 1-kinase 2 -like protein [Gossypium 
arboreum]
Length=373

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYDE SLQ LEPPLVLQEF+NHG
Sbjct  165  VAKPLVADGSAKSHELSLAYDEYSLQKLEPPLVLQEFVNHG  205



>gb|KJB64016.1| hypothetical protein B456_010G029600 [Gossypium raimondii]
Length=366

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYDE SLQ LEPPLVLQEF+NHG
Sbjct  165  VAKPLVADGSAKSHELSLAYDEYSLQKLEPPLVLQEFVNHG  205



>gb|KJB64015.1| hypothetical protein B456_010G029600 [Gossypium raimondii]
Length=362

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYDE SLQ LEPPLVLQEF+NHG
Sbjct  165  VAKPLVADGSAKSHELSLAYDEYSLQKLEPPLVLQEFVNHG  205



>ref|XP_010061594.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Eucalyptus 
grandis]
 ref|XP_010061595.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Eucalyptus 
grandis]
Length=221

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD  SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDRYSLQKLEPPLVLQEFVNHG  86



>gb|KJB64017.1| hypothetical protein B456_010G029600 [Gossypium raimondii]
Length=285

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYDE SLQ LEPPLVLQEF+NHG
Sbjct  165  VAKPLVADGSAKSHELSLAYDEYSLQKLEPPLVLQEFVNHG  205



>gb|KJB64013.1| hypothetical protein B456_010G029600 [Gossypium raimondii]
Length=339

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYDE SLQ LEPPLVLQEF+NHG
Sbjct  165  VAKPLVADGSAKSHELSLAYDEYSLQKLEPPLVLQEFVNHG  205



>ref|XP_002285550.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Vitis 
vinifera]
Length=347

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  170  VAKPLVVDGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  210



>gb|KDO81371.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=223

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 4/42 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHGM  24
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHGM
Sbjct  164  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGM  205



>gb|KJB58739.1| hypothetical protein B456_009G224300 [Gossypium raimondii]
Length=220

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  86



>ref|XP_010664462.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Vitis 
vinifera]
Length=300

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  123  VAKPLVVDGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  163



>emb|CBI19336.3| unnamed protein product [Vitis vinifera]
Length=315

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  138  VAKPLVVDGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  178



>gb|KCW68585.1| hypothetical protein EUGRSUZ_F02197 [Eucalyptus grandis]
Length=297

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD  SLQ LEPPLVLQEF+NHG
Sbjct  198  VAKPLVADGSAKSHELSLAYDRYSLQKLEPPLVLQEFVNHG  238



>ref|XP_008219148.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Prunus mume]
 ref|XP_008219149.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Prunus mume]
Length=220

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLA+D  SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVNDGSAKSHELSLAFDRYSLQKLEPPLVLQEFVNHG  86



>ref|XP_002306515.2| hypothetical protein POPTR_0005s19370g [Populus trichocarpa]
 gb|EEE93511.2| hypothetical protein POPTR_0005s19370g [Populus trichocarpa]
Length=357

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  174  VAKPLVADGSAKSHELSLAYDQQSLQKLEPPLVLQEFVNHG  214



>ref|XP_007137272.1| hypothetical protein PHAVU_009G113600g [Phaseolus vulgaris]
 gb|ESW09266.1| hypothetical protein PHAVU_009G113600g [Phaseolus vulgaris]
Length=350

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAY++ SLQ LEPPLVLQEF+NHG
Sbjct  176  VAKPLVADGSAKSHELSLAYEQFSLQKLEPPLVLQEFVNHG  216



>emb|CAY10405.1| inositol 1,3,4-triphosphate 5/6-kinase [Phaseolus vulgaris]
 emb|CAY10403.1| inositol 1,3,4-triphosphate 5/6-kinase [Phaseolus vulgaris]
Length=202

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAY++ SLQ LEPPLVLQEF+NHG
Sbjct  28   VAKPLVADGSAKSHELSLAYEQFSLQKLEPPLVLQEFVNHG  68



>ref|XP_006852757.1| hypothetical protein AMTR_s00033p00122000 [Amborella trichopoda]
 gb|ERN14224.1| hypothetical protein AMTR_s00033p00122000 [Amborella trichopoda]
Length=780

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+LSL  LEPPLVLQEF+NHG
Sbjct  171  VAKPLVVDGSAKSHELSLAYDQLSLSQLEPPLVLQEFVNHG  211



>ref|XP_011014078.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Populus 
euphratica]
Length=349

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  175  VAKPLVADGSAKSHELSLAYDQQSLQKLEPPLVLQEFVNHG  215



>ref|XP_007018386.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
3 [Theobroma cacao]
 gb|EOY15611.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
3 [Theobroma cacao]
Length=336

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  173  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  213



>ref|XP_007018385.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
2 [Theobroma cacao]
 gb|EOY15610.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
2 [Theobroma cacao]
Length=347

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  173  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  213



>ref|XP_007018384.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOY15609.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
1 [Theobroma cacao]
Length=351

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  177  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  217



>gb|KJB58745.1| hypothetical protein B456_009G224300 [Gossypium raimondii]
Length=348

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  174  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  214



>ref|XP_006578248.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Glycine max]
 ref|XP_006578249.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Glycine max]
Length=218

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAY+  SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYEHFSLQNLEPPLVLQEFVNHG  86



>ref|XP_008444979.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Cucumis 
melo]
Length=221

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH+LSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSEKSHQLSLAYDKYSLQKLEPPLVLQEFVNHG  86



>gb|KJB58741.1| hypothetical protein B456_009G224300 [Gossypium raimondii]
Length=296

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  174  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  214



>ref|XP_010556496.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010556497.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Tarenaya 
hassleriana]
Length=228

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHE+SLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHEMSLAYDQQSLKKLEPPLVLQEFVNHG  86



>gb|KJB58742.1| hypothetical protein B456_009G224300 [Gossypium raimondii]
Length=294

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  174  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  214



>ref|XP_006580905.1| PREDICTED: inositol phosphate kinase isoform X2 [Glycine max]
 ref|XP_006580906.1| PREDICTED: inositol phosphate kinase isoform X3 [Glycine max]
 ref|XP_006580907.1| PREDICTED: inositol phosphate kinase isoform X4 [Glycine max]
Length=218

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAY+  SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYEHFSLQNLEPPLVLQEFVNHG  86



>ref|XP_010245607.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010245609.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010245610.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Nelumbo nucifera]
Length=223

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VAKPLVVDGSAKSHELSLAYDQFSLAKLEPPLVLQEFVNHG  86



>gb|KHG16711.1| Inositol-tetrakisphosphate 1-kinase 2 -like protein [Gossypium 
arboreum]
Length=308

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  175  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  215



>gb|KJB58744.1| hypothetical protein B456_009G224300 [Gossypium raimondii]
Length=317

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  174  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  214



>gb|KDO81366.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=337

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG+L
Sbjct  164  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHGVL  206



>ref|XP_010266775.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 [Nelumbo nucifera]
Length=358

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  169  VAKPLVVDGSAKSHELSLAYDQFSLSKLEPPLVLQEFVNHG  209



>ref|XP_004162980.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like, partial 
[Cucumis sativus]
Length=302

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH+LSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  127  VAKPLVADGSEKSHQLSLAYDKYSLQKLEPPLVLQEFVNHG  167



>ref|XP_006853727.1| hypothetical protein AMTR_s00056p00164210 [Amborella trichopoda]
 gb|ERN15194.1| hypothetical protein AMTR_s00056p00164210 [Amborella trichopoda]
Length=403

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLV    AKSHELSLAYDELSL  LEPPLVLQEF+NHG
Sbjct  212  VVKPLVVDGTAKSHELSLAYDELSLSQLEPPLVLQEFVNHG  252



>ref|XP_006472364.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Citrus sinensis]
 ref|XP_006472365.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Citrus sinensis]
 ref|XP_006472366.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X5 [Citrus sinensis]
Length=220

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  86



>gb|KDO81373.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
 gb|KDO81374.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
 gb|KDO81375.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=220

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  86



>ref|XP_010245608.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Nelumbo nucifera]
Length=250

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  73   VAKPLVVDGSAKSHELSLAYDQFSLAKLEPPLVLQEFVNHG  113



>ref|XP_010692649.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+A    KSHELSLAYD+ SLQ LEPPL+LQEF+NHG
Sbjct  177  VAKPLIADGSAKSHELSLAYDQYSLQKLEPPLILQEFVNHG  217



>gb|KJB58743.1| hypothetical protein B456_009G224300 [Gossypium raimondii]
Length=324

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  174  VAKPLVADGSAKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  214



>ref|XP_011464780.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=220

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSH+LSLAYD  SLQ LEPPLVLQEF+NHG
Sbjct  46   VAKPLVNDGSVKSHQLSLAYDRYSLQKLEPPLVLQEFVNHG  86



>ref|XP_010245606.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Nelumbo nucifera]
Length=347

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  170  VAKPLVVDGSAKSHELSLAYDQFSLAKLEPPLVLQEFVNHG  210



>ref|XP_006433700.1| hypothetical protein CICLE_v10001756mg [Citrus clementina]
 gb|ESR46940.1| hypothetical protein CICLE_v10001756mg [Citrus clementina]
 gb|KDO81368.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
 gb|KDO81369.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
 gb|KDO81370.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=264

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  164  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  204



>ref|XP_009335474.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009335475.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Pyrus x bretschneideri]
Length=220

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSHELSLAYD  SLQ L+PPLVLQEF+NHG
Sbjct  46   VAKPLVNDGSKKSHELSLAYDRYSLQKLDPPLVLQEFVNHG  86



>ref|XP_008378690.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Malus 
domestica]
Length=220

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSHELSLAYD  SLQ L+PPLVLQEF+NHG
Sbjct  46   VAKPLVNDGSKKSHELSLAYDRYSLQKLDPPLVLQEFVNHG  86



>gb|KDO81372.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=274

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  100  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  140



>ref|XP_009392949.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=345

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYDE SL  L+PP VLQEFINHG
Sbjct  168  VAKPLVVDGSAKSHELSLAYDEFSLSKLDPPFVLQEFINHG  208



>gb|KHN08196.1| Inositol-tetrakisphosphate 1-kinase 2 [Glycine soja]
Length=354

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAY+  SLQ LEPPLVLQEF+NHG
Sbjct  182  VAKPLVADGSAKSHELSLAYEHFSLQNLEPPLVLQEFVNHG  222



>ref|XP_003522727.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Glycine max]
Length=354

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAY+  SLQ LEPPLVLQEF+NHG
Sbjct  182  VAKPLVADGSAKSHELSLAYEHFSLQNLEPPLVLQEFVNHG  222



>ref|XP_010936234.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Elaeis guineensis]
Length=251

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  L+PPLVLQEF+NHG
Sbjct  46   VAKPLVVDGSAKSHELSLAYDQFSLSKLDPPLVLQEFVNHG  86



>ref|NP_001237484.1| inositol phosphate kinase [Glycine max]
 ref|XP_006580904.1| PREDICTED: inositol phosphate kinase isoform X1 [Glycine max]
 gb|ABU93833.1| inositol phosphate kinase [Glycine max]
 gb|AHX24357.1| inositol 1,3,4 tris phosphate 5/6 kinase-3 [Glycine max]
 gb|KHN37206.1| Inositol-tetrakisphosphate 1-kinase 2 [Glycine soja]
Length=354

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAY+  SLQ LEPPLVLQEF+NHG
Sbjct  182  VAKPLVADGSAKSHELSLAYEHFSLQNLEPPLVLQEFVNHG  222



>ref|XP_008219147.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Prunus mume]
Length=336

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLA+D  SLQ LEPPLVLQEF+NHG
Sbjct  162  VAKPLVNDGSAKSHELSLAFDRYSLQKLEPPLVLQEFVNHG  202



>ref|XP_007222539.1| hypothetical protein PRUPE_ppa008332mg [Prunus persica]
 gb|EMJ23738.1| hypothetical protein PRUPE_ppa008332mg [Prunus persica]
Length=336

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLA+D  SLQ LEPPLVLQEF+NHG
Sbjct  162  VAKPLVNDGSAKSHELSLAFDRYSLQKLEPPLVLQEFVNHG  202



>gb|KDO81367.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=282

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  164  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  204



>ref|XP_002510017.1| Inositol-tetrakisphosphate 1-kinase, putative [Ricinus communis]
 gb|EEF52204.1| Inositol-tetrakisphosphate 1-kinase, putative [Ricinus communis]
Length=355

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  181  VAKPLVADGSAKSHELSLAYDQESLQKLEPPLVLQEFVNHG  221



>ref|XP_008444978.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Cucumis 
melo]
Length=347

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH+LSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  172  VAKPLVADGSEKSHQLSLAYDKYSLQKLEPPLVLQEFVNHG  212



>ref|XP_009392388.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=347

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYDE SL  L+PPLVLQEF+NHG
Sbjct  171  VAKPLVVDGSAKSHELSLAYDEFSLSKLDPPLVLQEFVNHG  211



>ref|XP_004148431.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Cucumis 
sativus]
Length=326

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH+LSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  151  VAKPLVADGSEKSHQLSLAYDKYSLQKLEPPLVLQEFVNHG  191



>ref|XP_004496803.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Cicer arietinum]
Length=287

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  170  VAKPLVVDGSAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  212



>gb|KGN62786.1| hypothetical protein Csa_2G372810 [Cucumis sativus]
Length=347

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH+LSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  172  VAKPLVADGSEKSHQLSLAYDKYSLQKLEPPLVLQEFVNHG  212



>gb|AHN60080.1| inositol 1,3,4-trisphosphate 5/6 kinase-4 [Glycine max]
Length=333

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  +EPPLVLQEF+NHG L
Sbjct  165  VAKPLVVDGTAKSHELFLAYDEFSLSAVEPPLVLQEFVNHGGL  207



>gb|KEH27336.1| inositol 1,3,4-trisphosphate 5/6-kinase [Medicago truncatula]
Length=282

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL +AYDELSL  LEPPLVLQEF+NHG L
Sbjct  113  VAKPLVVDGSAKSHELCIAYDELSLLKLEPPLVLQEFVNHGGL  155



>gb|KEH27333.1| inositol 1,3,4-trisphosphate 5/6-kinase [Medicago truncatula]
Length=317

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL +AYDELSL  LEPPLVLQEF+NHG L
Sbjct  148  VAKPLVVDGSAKSHELCIAYDELSLLKLEPPLVLQEFVNHGGL  190



>ref|XP_006472363.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Citrus sinensis]
Length=291

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  117  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  157



>ref|XP_006649677.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X5 [Oryza brachyantha]
Length=318

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG
Sbjct  114  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHG  154



>ref|XP_006472362.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Citrus sinensis]
Length=338

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  164  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  204



>ref|XP_006433699.1| hypothetical protein CICLE_v10001756mg [Citrus clementina]
 gb|ESR46939.1| hypothetical protein CICLE_v10001756mg [Citrus clementina]
 gb|KDO81365.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=338

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  164  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  204



>gb|KEH27335.1| inositol 1,3,4-trisphosphate 5/6-kinase [Medicago truncatula]
Length=306

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL +AYDELSL  LEPPLVLQEF+NHG L
Sbjct  137  VAKPLVVDGSAKSHELCIAYDELSLLKLEPPLVLQEFVNHGGL  179



>ref|XP_003610643.1| Inositol-tetrakisphosphate 1-kinase [Medicago truncatula]
 gb|AES93601.1| inositol 1,3,4-trisphosphate 5/6-kinase [Medicago truncatula]
Length=375

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL +AYDELSL  LEPPLVLQEF+NHG L
Sbjct  148  VAKPLVVDGSAKSHELCIAYDELSLLKLEPPLVLQEFVNHGGL  190



>ref|XP_004299849.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=344

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSH+LSLAYD  SLQ LEPPLVLQEF+NHG
Sbjct  170  VAKPLVNDGSVKSHQLSLAYDRYSLQKLEPPLVLQEFVNHG  210



>ref|XP_010104536.1| Inositol-tetrakisphosphate 1-kinase 2 [Morus notabilis]
 gb|EXC01137.1| Inositol-tetrakisphosphate 1-kinase 2 [Morus notabilis]
Length=456

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLA+D  SLQ LEPPLVLQEF+NHG
Sbjct  203  VAKPLVADGSAKSHELSLAFDRYSLQKLEPPLVLQEFVNHG  243



>ref|XP_010556495.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Tarenaya 
hassleriana]
Length=373

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHE+SLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  191  VAKPLVADGSAKSHEMSLAYDQQSLKKLEPPLVLQEFVNHG  231



>gb|KDO81364.1| hypothetical protein CISIN_1g019319mg [Citrus sinensis]
Length=343

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  164  VAKPLVADGSAKSHELSLAYDQYSLKKLEPPLVLQEFVNHG  204



>gb|KEH43982.1| inositol 1,3,4-trisphosphate 5/6-kinase [Medicago truncatula]
Length=342

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  167  VAKPLVVDGSAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  209



>ref|XP_006649675.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Oryza brachyantha]
Length=347

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG
Sbjct  171  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHG  211



>gb|KEH27334.1| inositol 1,3,4-trisphosphate 5/6-kinase [Medicago truncatula]
Length=289

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL +AYDELSL  LEPPLVLQEF+NHG L
Sbjct  120  VAKPLVVDGSAKSHELCIAYDELSLLKLEPPLVLQEFVNHGGL  162



>gb|KHN23182.1| Inositol-tetrakisphosphate 1-kinase 2 [Glycine soja]
Length=317

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  +EPPLVLQEF+NHG L
Sbjct  165  VAKPLVVDGTAKSHELFLAYDEFSLSAVEPPLVLQEFVNHGGL  207



>ref|XP_006649676.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Oryza brachyantha]
Length=326

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG
Sbjct  171  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHG  211



>ref|XP_004496800.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496801.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Cicer arietinum]
Length=345

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  170  VAKPLVVDGSAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  212



>ref|XP_002522099.1| Inositol-tetrakisphosphate 1-kinase, putative [Ricinus communis]
 gb|EEF40299.1| Inositol-tetrakisphosphate 1-kinase, putative [Ricinus communis]
Length=327

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYDE SL  LEPP+VLQEF+NHG
Sbjct  166  VAKPLVVDGTAKSHELFLAYDEFSLSELEPPMVLQEFVNHG  206



>gb|KJB59870.1| hypothetical protein B456_009G277900, partial [Gossypium raimondii]
Length=287

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKP V     KSHELSLAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  125  VAKPFVNDGSEKSHELSLAYDQYSLQKLEPPLVLQEFVNHG  165



>gb|EEE58643.1| hypothetical protein OsJ_10020 [Oryza sativa Japonica Group]
Length=349

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG
Sbjct  173  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHG  213



>ref|XP_010936231.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Elaeis guineensis]
Length=371

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  L+PPLVLQEF+NHG
Sbjct  166  VAKPLVVDGSAKSHELSLAYDQFSLSKLDPPLVLQEFVNHG  206



>ref|NP_001049457.1| Os03g0230500 [Oryza sativa Japonica Group]
 sp|Q10PL5.1|ITPK2_ORYSJ RecName: Full=Inositol-tetrakisphosphate 1-kinase 2; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 2; Short=Inositol-triphosphate 
5/6-kinase 2; Short=Ins(1,3,4)P(3) 5/6-kinase 
2; Short=OsITP5/6K-2; Short=OsITPK2; AltName: Full=OsITL1; 
AltName: Full=Protein DROUGHT- AND SALT-SENSITIVE MUTANT 3; 
Short=OsDSM3 [Oryza sativa Japonica Group]
 sp|B8AJL9.1|ITPK2_ORYSI RecName: Full=Inositol-tetrakisphosphate 1-kinase 2; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 2; Short=Inositol-triphosphate 
5/6-kinase 2; Short=Ins(1,3,4)P(3) 5/6-kinase 
2; Short=OsITP5/6K-2; Short=OsITPK2 [Oryza sativa Indica 
Group]
 gb|AAQ02374.1| inositol 1,3,4-trisphosphate 5/6-kinase [Oryza sativa]
 gb|ABF94780.1| inositol 1, 3, 4-trisphosphate 5/6-kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11371.1| Os03g0230500 [Oryza sativa Japonica Group]
 dbj|BAG94858.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74810.1| hypothetical protein OsI_10626 [Oryza sativa Indica Group]
Length=349

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG
Sbjct  173  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHG  213



>ref|NP_001237500.1| inositol phosphate kinase [Glycine max]
 gb|ABU93834.1| inositol phosphate kinase [Glycine max]
Length=341

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  +EPPLVLQEF+NHG L
Sbjct  165  VAKPLVVDGTAKSHELFLAYDEFSLSAVEPPLVLQEFVNHGGL  207



>ref|XP_004496802.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Cicer arietinum]
Length=347

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  172  VAKPLVVDGSAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  214



>dbj|BAJ88512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG
Sbjct  172  VAKPLVVDGTSKSHELSLAYDEASLPMLDPPLVLQEFVNHG  212



>ref|XP_008790412.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008790413.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008790414.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Phoenix dactylifera]
Length=218

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD  SL  L+PPLVLQEF+NHG
Sbjct  46   VAKPLVVDGSAKSHELSLAYDRFSLSKLDPPLVLQEFVNHG  86



>ref|XP_006649674.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Oryza brachyantha]
Length=363

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG +
Sbjct  171  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHGGI  213



>gb|AAO00682.1| Putative inositol 1,3,4-trisphosphate 5/6-kinase [Oryza sativa 
Japonica Group]
 gb|AAO06958.1| Putative inositol 1,3,4-trisphosphate 5/6-kinase [Oryza sativa 
Japonica Group]
Length=357

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG +
Sbjct  181  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHGGI  223



>ref|XP_007143146.1| hypothetical protein PHAVU_007G047700g [Phaseolus vulgaris]
 gb|ESW15140.1| hypothetical protein PHAVU_007G047700g [Phaseolus vulgaris]
Length=339

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG
Sbjct  164  VAKPLVVDGTAKSHELFLAYDEFSLSELEPPLVLQEFVNHG  204



>ref|NP_849342.1| inositol-tetrakisphosphate 1-kinase 2 [Arabidopsis thaliana]
 gb|AEE82602.1| inositol-tetrakisphosphate 1-kinase 2 [Arabidopsis thaliana]
Length=265

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  87   VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  127



>ref|XP_006649673.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Oryza brachyantha]
Length=375

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG +
Sbjct  171  VAKPLVVDGTSKSHELSLAYDEASLSMLDPPLVLQEFVNHGGI  213



>ref|XP_006288032.1| hypothetical protein CARUB_v10001263mg [Capsella rubella]
 gb|EOA20930.1| hypothetical protein CARUB_v10001263mg [Capsella rubella]
Length=270

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  92   VAKPLVADGSAKSHELSLAYDQNSLLKLEPPLVLQEFVNHG  132



>ref|XP_006606008.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Glycine max]
Length=265

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  90   VAKPLVVDGTAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  132



>gb|KEH43981.1| inositol 1,3,4-trisphosphate 5/6-kinase [Medicago truncatula]
Length=312

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  137  VAKPLVVDGSAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  179



>ref|XP_006588357.1| PREDICTED: inositol phosphate kinase isoform X1 [Glycine max]
Length=266

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  +EPPLVLQEF+NHG L
Sbjct  90   VAKPLVVDGTAKSHELFLAYDEFSLSAVEPPLVLQEFVNHGGL  132



>gb|ABS78989.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ +L  LEPPLVLQEF+NHG
Sbjct  37   VAKPLVADGSAKSHELSLAYDQHALLKLEPPLVLQEFVNHG  77



>ref|XP_009335473.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=341

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSHELSLAYD  SLQ L+PPLVLQEF+NHG
Sbjct  167  VAKPLVNDGSKKSHELSLAYDRYSLQKLDPPLVLQEFVNHG  207



>ref|XP_010939316.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Elaeis guineensis]
Length=341

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  L PPLVLQEF+NHG
Sbjct  165  VAKPLVVDGSAKSHELSLAYDQFSLSKLNPPLVLQEFVNHG  205



>ref|XP_010520809.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Tarenaya hassleriana]
Length=369

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  185  VVKPLVADGSAKSHELSLAYDQHSLRKLEPPLVLQEFVNHG  225



>ref|XP_008378689.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Malus 
domestica]
Length=341

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSHELSLAYD  SLQ L+PPLVLQEF+NHG
Sbjct  167  VAKPLVNDGSKKSHELSLAYDRYSLQKLDPPLVLQEFVNHG  207



>ref|XP_010496551.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Camelina 
sativa]
Length=157

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  86



>gb|EMT25398.1| Inositol-tetrakisphosphate 1-kinase 2 [Aegilops tauschii]
Length=436

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = -1

Query  155  QLFCLSVAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
             L    VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG +
Sbjct  199  NLSSFYVAKPLVVDGTSKSHELSLAYDEASLPMLDPPLVLQEFVNHGGI  247



>gb|ABS78976.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78995.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79000.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79003.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=87

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ +L  LEPPLVLQEF+NHG
Sbjct  37   VAKPLVADGSAKSHELSLAYDQHALLKLEPPLVLQEFVNHG  77



>gb|ABS78975.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78977.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78978.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78979.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78983.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78984.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78993.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78997.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=86

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ +L  LEPPLVLQEF+NHG
Sbjct  37   VAKPLVADGSAKSHELSLAYDQHALLKLEPPLVLQEFVNHG  77



>ref|XP_010095746.1| Inositol-tetrakisphosphate 1-kinase 2 [Morus notabilis]
 gb|EXB62129.1| Inositol-tetrakisphosphate 1-kinase 2 [Morus notabilis]
Length=351

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSHEL LAYD+ SLQ LEPPLVLQEF+NHG
Sbjct  167  VAKPLLVDGTAKSHELFLAYDQFSLQELEPPLVLQEFVNHG  207



>ref|XP_010939317.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010939318.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Elaeis guineensis]
Length=324

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  L PPLVLQEF+NHG
Sbjct  148  VAKPLVVDGSAKSHELSLAYDQFSLSKLNPPLVLQEFVNHG  188



>ref|XP_010455235.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Camelina sativa]
Length=280

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  102  VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  142



>ref|XP_007143147.1| hypothetical protein PHAVU_007G047700g [Phaseolus vulgaris]
 gb|ESW15141.1| hypothetical protein PHAVU_007G047700g [Phaseolus vulgaris]
Length=276

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG
Sbjct  101  VAKPLVVDGTAKSHELFLAYDEFSLSELEPPLVLQEFVNHG  141



>ref|XP_010520808.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Tarenaya hassleriana]
Length=372

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  188  VVKPLVADGSAKSHELSLAYDQHSLRKLEPPLVLQEFVNHG  228



>emb|CAB45787.1| inositol 1, 3, 4-trisphosphate 5/6-kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB81153.1| inositol 1, 3, 4-trisphosphate 5/6-kinase-like protein [Arabidopsis 
thaliana]
Length=338

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  175  VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  215



>gb|KHN01570.1| Inositol-tetrakisphosphate 1-kinase 2 [Glycine soja]
Length=320

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  163  VAKPLVVDGTAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  205



>ref|XP_003555305.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Glycine max]
Length=338

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    AKSHEL LAYDE SL  LEPPLVLQEF+NHG L
Sbjct  163  VAKPLVVDGTAKSHELFLAYDEFSLSELEPPLVLQEFVNHGGL  205



>gb|ABS78973.1| At4g08170-like protein, partial [Arabidopsis halleri subsp. halleri]
 gb|ABS78981.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78982.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78985.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78986.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78987.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78988.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78990.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78991.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78994.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78996.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78998.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78999.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79001.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79002.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79004.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ +L  LEPPLVLQEF+NHG
Sbjct  45   VAKPLVADGSAKSHELSLAYDQHALLKLEPPLVLQEFVNHG  85



>ref|XP_006288033.1| hypothetical protein CARUB_v10001263mg [Capsella rubella]
 gb|EOA20931.1| hypothetical protein CARUB_v10001263mg [Capsella rubella]
Length=358

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  180  VAKPLVADGSAKSHELSLAYDQNSLLKLEPPLVLQEFVNHG  220



>ref|XP_010438590.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X4 [Camelina 
sativa]
 ref|XP_010438596.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X4 [Camelina 
sativa]
 ref|XP_010438603.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X4 [Camelina 
sativa]
Length=224

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  86



>ref|XP_010520811.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Tarenaya hassleriana]
Length=286

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  102  VVKPLVADGSAKSHELSLAYDQHSLRKLEPPLVLQEFVNHG  142



>ref|XP_010936232.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Elaeis guineensis]
Length=340

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD+ SL  L+PPLVLQEF+NHG
Sbjct  135  VAKPLVVDGSAKSHELSLAYDQFSLSKLDPPLVLQEFVNHG  175



>ref|XP_010455233.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010455234.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Camelina sativa]
Length=362

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  184  VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  224



>ref|XP_010438566.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010438572.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X2 [Camelina 
sativa]
 ref|XP_010438582.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 isoform X3 [Camelina 
sativa]
Length=362

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  184  VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  224



>ref|XP_008790410.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Phoenix dactylifera]
Length=338

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD  SL  L+PPLVLQEF+NHG
Sbjct  166  VAKPLVVDGSAKSHELSLAYDRFSLSKLDPPLVLQEFVNHG  206



>ref|XP_010455236.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Camelina sativa]
 ref|XP_010455237.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Camelina sativa]
 ref|XP_010455238.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Camelina sativa]
 ref|XP_010455239.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X4 [Camelina sativa]
Length=224

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  86



>ref|XP_008790411.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Phoenix dactylifera]
Length=327

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHELSLAYD  SL  L+PPLVLQEF+NHG
Sbjct  155  VAKPLVVDGSAKSHELSLAYDRFSLSKLDPPLVLQEFVNHG  195



>ref|NP_001190687.1| inositol-tetrakisphosphate 1-kinase 2 [Arabidopsis thaliana]
 gb|AEE82603.1| inositol-tetrakisphosphate 1-kinase 2 [Arabidopsis thaliana]
Length=224

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  86



>ref|XP_008785700.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Phoenix dactylifera]
Length=340

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLV    AKSHELSLAYD  SL  L+PPLVLQEF+NHG
Sbjct  164  VVKPLVVDGSAKSHELSLAYDRFSLSKLDPPLVLQEFVNHG  204



>gb|ABS78974.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78980.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78992.1| At4g08170-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ +L  LEPPLVLQEF+NHG
Sbjct  45   VAKPLVADGSAKSHELSLAYDQHALLKLEPPLVLQEFVNHG  85



>gb|EMS58471.1| Inositol-tetrakisphosphate 1-kinase 2 [Triticum urartu]
Length=411

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    +KSHELSLAYDE SL +L+PPLVLQEF+NHG +
Sbjct  136  VAKPLVVDGTSKSHELSLAYDEASLPMLDPPLVLQEFVNHGGI  178



>ref|XP_008785701.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Phoenix dactylifera]
Length=294

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLV    AKSHELSLAYD  SL  L+PPLVLQEF+NHG
Sbjct  118  VVKPLVVDGSAKSHELSLAYDRFSLSKLDPPLVLQEFVNHG  158



>ref|XP_011002444.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Populus euphratica]
Length=224

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLV    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VVKPLVVDGTAKSHELFLAYDQFSLSELEPPLVLQEFVNHG  86



>ref|XP_010496546.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Camelina 
sativa]
 ref|XP_010496547.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Camelina 
sativa]
 ref|XP_010496548.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Camelina 
sativa]
Length=224

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  86



>ref|XP_010520810.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X3 [Tarenaya hassleriana]
Length=289

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLVA    KSHELSLAYD+ SL+ LEPPLVLQEF+NHG
Sbjct  105  VVKPLVADGSAKSHELSLAYDQHSLRKLEPPLVLQEFVNHG  145



>ref|XP_008785699.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Phoenix dactylifera]
Length=351

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLV    AKSHELSLAYD  SL  L+PPLVLQEF+NHG
Sbjct  175  VVKPLVVDGSAKSHELSLAYDRFSLSKLDPPLVLQEFVNHG  215



>ref|XP_008382922.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like, partial 
[Malus domestica]
Length=170

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 8/55 (15%)
 Frame = -1

Query  179  VTIHYFLHQLFCLSVAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VT+ +F     C+ V KPLV    AKSHEL LAYD+ S+  LEPPLVLQEF+NHG
Sbjct  40   VTLSFF----SCVLVVKPLVVDGSAKSHELFLAYDQCSISELEPPLVLQEFVNHG  90



>ref|XP_007042700.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
4 [Theobroma cacao]
 gb|EOX98531.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
4 [Theobroma cacao]
Length=263

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  88   VAKPLVVDGSTKSHELFLAYDQFSLSELEPPLVLQEFVNHG  128



>gb|KDP44556.1| hypothetical protein JCGZ_16389 [Jatropha curcas]
Length=310

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  164  VAKPLVVDGTAKSHELFLAYDQFSLSELEPPLVLQEFVNHG  204



>ref|XP_008787235.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Phoenix dactylifera]
Length=213

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLA+D+ +L  L+PPLVLQEF+NHG
Sbjct  46   VAKPLVADGSAKSHELSLAFDQFALSKLDPPLVLQEFVNHG  86



>ref|XP_010530696.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3 isoform X3 [Tarenaya 
hassleriana]
Length=221

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSHEL LAYD  SL  LEPPLVLQEF+NHG
Sbjct  46   VAKPLLVDGTAKSHELFLAYDRFSLLDLEPPLVLQEFVNHG  86



>emb|CDO97311.1| unnamed protein product [Coffea canephora]
Length=322

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD++SL  LEPPLVLQEF+NHG
Sbjct  147  VAKPLVVDGSAKSHELFLAYDKVSLAKLEPPLVLQEFVNHG  187



>ref|NP_567334.1| inositol-tetrakisphosphate 1-kinase 2 [Arabidopsis thaliana]
 sp|Q9SUG3.2|ITPK3_ARATH RecName: Full=Inositol-tetrakisphosphate 1-kinase 3; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 3; Short=AtItpk-3; 
Short=Inositol-triphosphate 5/6-kinase 3; Short=Ins(1,3,4)P(3) 
5/6-kinase 3 [Arabidopsis thaliana]
 gb|AAK91424.1| AT4g08170/T12G13_10 [Arabidopsis thaliana]
 gb|AAL15415.1| AT4g08170/T12G13_10 [Arabidopsis thaliana]
 gb|AEE82601.1| inositol-tetrakisphosphate 1-kinase 2 [Arabidopsis thaliana]
Length=353

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  175  VAKPLVADGSAKSHELSLAYDQHSLLKLEPPLVLQEFVNHG  215



>gb|KDO49519.1| hypothetical protein CISIN_1g0190762mg, partial [Citrus sinensis]
Length=199

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  72   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  112



>ref|XP_004289707.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3 [Fragaria vesca 
subsp. vesca]
Length=349

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPL+    AKSHELSLAYD+ SL  LEPPLVLQEF+NHG
Sbjct  174  VVKPLLVDGSAKSHELSLAYDQCSLSELEPPLVLQEFVNHG  214



>ref|XP_002313195.2| hypothetical protein POPTR_0009s08800g, partial [Populus trichocarpa]
 gb|EEE87150.2| hypothetical protein POPTR_0009s08800g, partial [Populus trichocarpa]
Length=260

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSH++ LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  72   VAKPLVVDGTAKSHQMFLAYDQFSLSELEPPLVLQEFVNHG  112



>ref|XP_006409646.1| hypothetical protein EUTSA_v10022771mg [Eutrema salsugineum]
 gb|ESQ51099.1| hypothetical protein EUTSA_v10022771mg [Eutrema salsugineum]
Length=342

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSH+L LAYD LSL  LEPPLVLQEF+NHG
Sbjct  170  VAKPLLVDGTAKSHQLFLAYDRLSLAELEPPLVLQEFVNHG  210



>ref|XP_007042697.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007042698.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOX98528.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOX98529.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
1 [Theobroma cacao]
Length=329

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  154  VAKPLVVDGSTKSHELFLAYDQFSLSELEPPLVLQEFVNHG  194



>ref|XP_008787233.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Phoenix dactylifera]
Length=316

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLA+D+ +L  L+PPLVLQEF+NHG
Sbjct  149  VAKPLVADGSAKSHELSLAFDQFALSKLDPPLVLQEFVNHG  189



>ref|XP_007042699.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
3, partial [Theobroma cacao]
 gb|EOX98530.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein isoform 
3, partial [Theobroma cacao]
Length=308

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV     KSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  154  VAKPLVVDGSTKSHELFLAYDQFSLSELEPPLVLQEFVNHG  194



>ref|XP_010530695.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3 isoform X2 [Tarenaya 
hassleriana]
Length=373

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSHEL LAYD  SL  LEPPLVLQEF+NHG
Sbjct  198  VAKPLLVDGTAKSHELFLAYDRFSLLDLEPPLVLQEFVNHG  238



>ref|XP_010530694.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3 isoform X1 [Tarenaya 
hassleriana]
Length=376

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSHEL LAYD  SL  LEPPLVLQEF+NHG
Sbjct  201  VAKPLLVDGTAKSHELFLAYDRFSLLDLEPPLVLQEFVNHG  241



>ref|XP_002465608.1| hypothetical protein SORBIDRAFT_01g042010 [Sorghum bicolor]
 gb|EER92606.1| hypothetical protein SORBIDRAFT_01g042010 [Sorghum bicolor]
Length=348

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +K HEL LAYDE SL +L+PPLVLQEFINHG
Sbjct  172  VAKPLVVDGTSKGHELYLAYDEASLSMLDPPLVLQEFINHG  212



>gb|KFK39974.1| hypothetical protein AALP_AA3G313500 [Arabis alpina]
Length=341

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSH+L LAYD LSL  LEPPLVLQEF+NHG
Sbjct  160  VAKPLLVDGTAKSHQLFLAYDRLSLAELEPPLVLQEFVNHG  200



>gb|ACN27814.1| unknown [Zea mays]
 gb|AFW89098.1| hypothetical protein ZEAMMB73_287612 [Zea mays]
Length=351

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +K HEL LAYDE SL +L+PPLVLQEFINHG
Sbjct  175  VAKPLVVDGTSKGHELYLAYDEASLSMLDPPLVLQEFINHG  215



>ref|XP_002885929.1| hypothetical protein ARALYDRAFT_343072 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62188.1| hypothetical protein ARALYDRAFT_343072 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 4/42 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGM  24
            VAKPL+    AKSH+L LAYD LSL  LEPPLVLQEF+NHG+
Sbjct  164  VAKPLLVDGTAKSHQLFLAYDHLSLAELEPPLVLQEFVNHGI  205



>ref|XP_006422737.1| hypothetical protein CICLE_v100287892mg, partial [Citrus clementina]
 gb|ESR35977.1| hypothetical protein CICLE_v100287892mg, partial [Citrus clementina]
Length=249

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  72   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  112



>ref|XP_010691534.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=344

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSHEL LAYD +SL  LEPPLVLQEF+NHG
Sbjct  173  VAKPLFVDGSAKSHELFLAYDNVSLSKLEPPLVLQEFVNHG  213



>sp|A2Z4C5.1|ITPK1_ORYSI RecName: Full=Inositol-tetrakisphosphate 1-kinase 1; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 1; Short=Inositol-triphosphate 
5/6-kinase 1; Short=Ins(1,3,4)P(3) 5/6-kinase 
1; Short=OsITP5/6K-1; Short=OsITPK1 [Oryza sativa Indica 
Group]
 gb|EAY77459.1| hypothetical protein OsI_32501 [Oryza sativa Indica Group]
Length=354

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAY E SL +L+PPLVLQEF+NHG
Sbjct  178  VAKPLVVDGTSKSHELSLAYVETSLSMLDPPLVLQEFVNHG  218



>ref|XP_002874521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLAYD+ ++  LEPPLVLQEF+NHG
Sbjct  176  VAKPLVADGSAKSHELSLAYDQHAVLKLEPPLVLQEFVNHG  216



>ref|NP_001064019.1| Os10g0103800 [Oryza sativa Japonica Group]
 sp|Q33BI9.1|ITPK1_ORYSJ RecName: Full=Inositol-tetrakisphosphate 1-kinase 1; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 1; Short=Inositol-triphosphate 
5/6-kinase 1; Short=Ins(1,3,4)P(3) 5/6-kinase 
1; Short=OsITP5/6K-1; Short=OsITPK1; AltName: Full=OsITL2 
[Oryza sativa Japonica Group]
 gb|ABB46580.1| inositol 1, 3, 4-trisphosphate 5/6-kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF25933.1| Os10g0103800 [Oryza sativa Japonica Group]
 dbj|BAG97757.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50447.1| hypothetical protein OsJ_30457 [Oryza sativa Japonica Group]
Length=354

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAY E SL +L+PPLVLQEF+NHG
Sbjct  178  VAKPLVVDGTSKSHELSLAYVETSLSMLDPPLVLQEFVNHG  218



>ref|XP_011002432.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Populus euphratica]
Length=401

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLV    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  223  VVKPLVVDGTAKSHELFLAYDQFSLSELEPPLVLQEFVNHG  263



>ref|XP_006422735.1| hypothetical protein CICLE_v100287892mg, partial [Citrus clementina]
 gb|ESR35975.1| hypothetical protein CICLE_v100287892mg, partial [Citrus clementina]
Length=246

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  69   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  109



>gb|KDO49518.1| hypothetical protein CISIN_1g0190762mg, partial [Citrus sinensis]
Length=220

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  72   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  112



>ref|NP_001149152.1| inositol-tetrakisphosphate 1-kinase 3 [Zea mays]
 gb|ACG34388.1| inositol-tetrakisphosphate 1-kinase 3 [Zea mays]
 gb|AFW89099.1| inositol-tetrakisphosphate 1-kinase 3 [Zea mays]
Length=386

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    +K HEL LAYDE SL +L+PPLVLQEFINHG +
Sbjct  175  VAKPLVVDGTSKGHELYLAYDEASLSMLDPPLVLQEFINHGGI  217



>emb|CDY65442.1| BnaCnng47190D [Brassica napus]
Length=358

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSH+L LAYD LSL  LEPPLVLQEF+NHG
Sbjct  169  VAKPLLVDGTAKSHQLFLAYDCLSLAKLEPPLVLQEFVNHG  209



>ref|XP_004985117.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Setaria 
italica]
Length=353

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +K HEL LAYDE SL +L PPLVLQEFINHG
Sbjct  177  VAKPLVVDGTSKGHELYLAYDEASLSMLHPPLVLQEFINHG  217



>ref|XP_006486873.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X3 [Citrus sinensis]
Length=287

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  163  VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  203



>gb|KDO49516.1| hypothetical protein CISIN_1g0190762mg, partial [Citrus sinensis]
 gb|KDO49517.1| hypothetical protein CISIN_1g0190762mg, partial [Citrus sinensis]
Length=249

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  72   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  112



>ref|XP_010942049.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Elaeis 
guineensis]
Length=310

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSHELSLA+D+ +L  L+PPLVLQEF+NHG
Sbjct  143  VAKPLVADGSAKSHELSLAFDQYALSRLDPPLVLQEFVNHG  183



>ref|XP_006486875.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X5 [Citrus sinensis]
Length=257

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  80   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  120



>emb|CDX93142.1| BnaA03g38640D [Brassica napus]
Length=309

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSH+L LAYD LSL  LEPPLVLQEF+NHG
Sbjct  119  VAKPLLVDGTAKSHQLFLAYDCLSLAELEPPLVLQEFVNHG  159



>gb|KDO49520.1| hypothetical protein CISIN_1g0190762mg, partial [Citrus sinensis]
Length=198

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  72   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  112



>gb|AAK00417.2| Putative inositol 1,3,4-trisphosphate 5/6-kinase [Oryza sativa 
Japonica Group]
Length=333

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHELSLAY E SL +L+PPLVLQEF+NHG
Sbjct  157  VAKPLVVDGTSKSHELSLAYVETSLSMLDPPLVLQEFVNHG  197



>ref|XP_006662130.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Oryza 
brachyantha]
Length=334

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    +KSHELSLAY E SL +L+PPLVLQEF+NHG +
Sbjct  158  VAKPLVVDGTSKSHELSLAYVETSLSMLDPPLVLQEFVNHGGI  200



>ref|XP_009136248.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like [Brassica 
rapa]
Length=350

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSH+L LAYD LSL  LEPPLVLQEF+NHG
Sbjct  168  VAKPLLVDGTAKSHQLFLAYDCLSLAELEPPLVLQEFVNHG  208



>ref|XP_009335375.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 [Pyrus x bretschneideri]
Length=340

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPLV    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  165  VVKPLVVDGSAKSHELFLAYDKCSLSELEPPLVLQEFVNHG  205



>ref|XP_006486871.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X1 [Citrus sinensis]
Length=340

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  163  VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  203



>emb|CDX75380.1| BnaA01g03220D [Brassica napus]
Length=217

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  39   VAKPLWIDGTAKSHQLFLAYDKHSLAELEPPLVLQEFVNHG  79



>ref|XP_006486872.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X2 [Citrus sinensis]
Length=337

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  163  VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  203



>ref|XP_006486874.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X4 [Citrus sinensis]
Length=263

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    AKSHEL LAYD  SL  LEPP++LQEF+NHG
Sbjct  86   VAKPLVVDGSAKSHELFLAYDRFSLSELEPPMLLQEFVNHG  126



>ref|XP_009108776.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X3 [Brassica rapa]
Length=221

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  46   VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  86



>ref|XP_003573753.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Brachypodium 
distachyon]
Length=349

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHGML  21
            VAKPLV    +KSHELSLAY + SL +L+PPLVLQEF+NHG +
Sbjct  173  VAKPLVVDGTSKSHELSLAYVDTSLSMLDPPLVLQEFVNHGGI  215



>emb|CDX72427.1| BnaC07g44490D [Brassica napus]
Length=394

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  209  VAKPLWIDGTAKSHQLFLAYDKRSLAELEPPLVLQEFVNHG  249



>ref|XP_009138214.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like [Brassica 
rapa]
Length=385

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  209  VAKPLWIDGTAKSHQLFLAYDKHSLAELEPPLVLQEFVNHG  249



>emb|CDY49374.1| BnaA03g50630D [Brassica napus]
Length=385

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  209  VAKPLWIDGTAKSHQLFLAYDKHSLAELEPPLVLQEFVNHG  249



>ref|XP_008372953.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X1 [Malus domestica]
Length=192

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPL+    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  17   VVKPLLVDGSAKSHELFLAYDQCSLSELEPPLVLQEFVNHG  57



>gb|KCW56832.1| hypothetical protein EUGRSUZ_I02502 [Eucalyptus grandis]
Length=276

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 5/45 (11%)
 Frame = -1

Query  146  CLS-VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            CL  VAKPLV    +KSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  88   CLPLVAKPLVVDGTSKSHELFLAYDQSSLVELEPPLVLQEFVNHG  132



>ref|XP_001785995.1| predicted protein [Physcomitrella patens]
 gb|EDQ49193.1| predicted protein [Physcomitrella patens]
Length=334

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH +SL YDE  L  L+PPLVLQEF+NHG
Sbjct  151  VAKPLVADGSPKSHAMSLVYDESCLTQLDPPLVLQEFVNHG  191



>ref|XP_008236242.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2 [Prunus mume]
Length=350

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  175  VAKPLLVDGSAKSHELFLAYDQCSLSELEPPLVLQEFVNHG  215



>ref|XP_007199195.1| hypothetical protein PRUPE_ppa021570mg [Prunus persica]
 gb|EMJ00394.1| hypothetical protein PRUPE_ppa021570mg [Prunus persica]
Length=350

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL+    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  175  VAKPLLVDGSAKSHELFLAYDQCSLSELEPPLVLQEFVNHG  215



>ref|XP_010029880.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Eucalyptus 
grandis]
Length=306

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLV    +KSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  122  VAKPLVVDGTSKSHELFLAYDQSSLVELEPPLVLQEFVNHG  162



>ref|XP_006283878.1| hypothetical protein CARUB_v10004995mg [Capsella rubella]
 gb|EOA16776.1| hypothetical protein CARUB_v10004995mg [Capsella rubella]
Length=392

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  216  VAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHG  256



>ref|XP_008372954.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like isoform 
X2 [Malus domestica]
Length=221

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            V KPL+    AKSHEL LAYD+ SL  LEPPLVLQEF+NHG
Sbjct  46   VVKPLLVDGSAKSHELFLAYDQCSLSELEPPLVLQEFVNHG  86



>ref|NP_195103.3| inositol-tetrakisphosphate 1-kinase 3 [Arabidopsis thaliana]
 sp|O81893.3|ITPK2_ARATH RecName: Full=Inositol-tetrakisphosphate 1-kinase 2; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 2; Short=AtItpk-2; 
Short=Inositol-triphosphate 5/6-kinase 2; Short=Ins(1,3,4)P(3) 
5/6-kinase 2 [Arabidopsis thaliana]
 gb|ABJ98567.1| At4g33770 [Arabidopsis thaliana]
 gb|AEE86275.1| inositol-tetrakisphosphate 1-kinase 3 [Arabidopsis thaliana]
Length=391

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  215  VAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHG  255



>ref|XP_009124138.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3 [Brassica rapa]
Length=345

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD+ SL  L+PPLVLQEF+NHG
Sbjct  170  VAKPLWIDGTAKSHQLFLAYDKRSLAELDPPLVLQEFVNHG  210



>ref|XP_010686679.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=109

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLV----AKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSHEL LAYD +SL  LEPPLVL+EF++HG
Sbjct  24   VAKPLSVDGSAKSHELFLAYDNVSLSKLEPPLVLKEFVSHG  64



>ref|XP_009108774.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X1 [Brassica rapa]
Length=345

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  170  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  210



>gb|AID60099.1| inositol 1,3,4-trisphosphate 5/6-kinase family protein [Brassica 
napus]
Length=383

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  208  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  248



>ref|XP_009108775.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3-like isoform 
X2 [Brassica rapa]
Length=344

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  169  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  209



>emb|CDY28319.1| BnaC03g66400D [Brassica napus]
Length=346

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  171  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  211



>ref|NP_001078490.1| inositol-tetrakisphosphate 1-kinase 3 [Arabidopsis thaliana]
 gb|AEE86276.1| inositol-tetrakisphosphate 1-kinase 3 [Arabidopsis thaliana]
Length=298

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  122  VAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHG  162



>ref|XP_001779145.1| predicted protein [Physcomitrella patens]
 gb|EDQ56091.1| predicted protein [Physcomitrella patens]
Length=304

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH +SL YD+  L  L+PPLVLQEF+NHG
Sbjct  120  VAKPLVADGSPKSHAMSLVYDKSCLSQLDPPLVLQEFVNHG  160



>ref|XP_010437720.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3 [Camelina sativa]
Length=389

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  213  VAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHG  253



>ref|XP_002867160.1| inositol 1,3,4-trisphosphate 5/6-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43419.1| inositol 1,3,4-trisphosphate 5/6-kinase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=391

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  215  VAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHG  255



>ref|XP_006412314.1| hypothetical protein EUTSA_v10025442mg [Eutrema salsugineum]
 gb|ESQ53767.1| hypothetical protein EUTSA_v10025442mg [Eutrema salsugineum]
Length=385

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  210  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  250



>emb|CDY70702.1| BnaAnng34680D [Brassica napus]
Length=387

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  208  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  248



>emb|CDX69005.1| BnaC01g04480D [Brassica napus]
Length=384

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  205  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  245



>gb|KFK30006.1| hypothetical protein AALP_AA7G205500 [Arabis alpina]
Length=382

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  207  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  247



>emb|CAA20590.1| putative protein [Arabidopsis thaliana]
 emb|CAB80094.1| putative protein [Arabidopsis thaliana]
Length=364

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 4/42 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHGM  24
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG+
Sbjct  192  VAKPLWIDGTAKSHQLYLAYDRRSLAELDPPLVLQEFVNHGI  233



>ref|XP_009119433.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 3 [Brassica rapa]
Length=383

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPL----VAKSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPL     AKSH+L LAYD  SL  L+PPLVLQEF+NHG
Sbjct  208  VAKPLWIDGTAKSHQLFLAYDRRSLAELDPPLVLQEFVNHG  248



>ref|XP_001761051.1| predicted protein [Physcomitrella patens]
 gb|EDQ74118.1| predicted protein [Physcomitrella patens]
Length=327

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 4/41 (10%)
 Frame = -1

Query  137  VAKPLVA----KSHELSLAYDELSLQILEPPLVLQEFINHG  27
            VAKPLVA    KSH +SLAYD   L  L+ PLVLQEF+NHG
Sbjct  140  VAKPLVADGSAKSHAMSLAYDRFGLSSLDTPLVLQEFVNHG  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565033620200