BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP018B08 584 bp,

Length=584
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABK94124.1|  unknown                                                 263   4e-85   Populus trichocarpa [western balsam poplar]
ref|XP_009622620.1|  PREDICTED: myosin-1-like                           282   6e-85   Nicotiana tomentosiformis
ref|XP_009783184.1|  PREDICTED: myosin-1-like                           282   6e-85   Nicotiana sylvestris
gb|ABJ53200.1|  myosin VIII-1                                           281   1e-84   Nicotiana benthamiana
ref|XP_004231522.1|  PREDICTED: myosin-1                                281   2e-84   Solanum lycopersicum
ref|XP_006345301.1|  PREDICTED: myosin-1-like                           281   2e-84   Solanum tuberosum [potatoes]
emb|CDP18554.1|  unnamed protein product                                277   5e-83   Coffea canephora [robusta coffee]
ref|XP_010067014.1|  PREDICTED: myosin-1                                277   5e-83   Eucalyptus grandis [rose gum]
gb|KDO69897.1|  hypothetical protein CISIN_1g0010671mg                  271   2e-82   Citrus sinensis [Valencia orange]
ref|XP_007043232.1|  Myosin 1 isoform 2                                 273   4e-82   Theobroma cacao [chocolate]
gb|KDO69895.1|  hypothetical protein CISIN_1g0010671mg                  270   4e-82   Citrus sinensis [Valencia orange]
gb|KDO69891.1|  hypothetical protein CISIN_1g0010671mg                  271   1e-81   Citrus sinensis [Valencia orange]
gb|KHF99826.1|  Unconventional myosin-Va                                273   1e-81   Gossypium arboreum [tree cotton]
ref|XP_006605841.1|  PREDICTED: myosin-1-like isoform X3                273   1e-81   
gb|KDO69889.1|  hypothetical protein CISIN_1g0010671mg                  271   1e-81   Citrus sinensis [Valencia orange]
ref|XP_007142759.1|  hypothetical protein PHAVU_007G014600g             268   2e-81   Phaseolus vulgaris [French bean]
gb|KHN23106.1|  Unconventional myosin-Va                                271   2e-81   Glycine soja [wild soybean]
ref|XP_007043231.1|  Myosin 1 isoform 1                                 272   2e-81   Theobroma cacao [chocolate]
ref|XP_006605839.1|  PREDICTED: myosin-1-like isoform X1                272   3e-81   Glycine max [soybeans]
ref|XP_011022005.1|  PREDICTED: myosin-1-like isoform X1                272   3e-81   Populus euphratica
ref|XP_011022009.1|  PREDICTED: myosin-1-like isoform X2                271   5e-81   Populus euphratica
ref|XP_009351748.1|  PREDICTED: myosin-1-like isoform X1                271   6e-81   Pyrus x bretschneideri [bai li]
ref|XP_009351750.1|  PREDICTED: myosin-1-like isoform X2                271   6e-81   Pyrus x bretschneideri [bai li]
ref|XP_006437635.1|  hypothetical protein CICLE_v10030552mg             271   8e-81   Citrus clementina
ref|XP_004497240.1|  PREDICTED: myosin-J heavy chain-like isoform X1    271   8e-81   Cicer arietinum [garbanzo]
ref|XP_002307152.1|  myosin-related family protein                      271   8e-81   Populus trichocarpa [western balsam poplar]
ref|XP_006484499.1|  PREDICTED: myosin-1-like                           271   8e-81   Citrus sinensis [Valencia orange]
emb|CBI35399.3|  unnamed protein product                                271   9e-81   Vitis vinifera
ref|XP_008445889.1|  PREDICTED: myosin-1-like                           271   1e-80   Cucumis melo [Oriental melon]
ref|XP_002273898.1|  PREDICTED: myosin-1                                271   1e-80   Vitis vinifera
ref|XP_004497241.1|  PREDICTED: myosin-J heavy chain-like isoform X2    271   1e-80   
gb|KJB31871.1|  hypothetical protein B456_005G212100                    270   1e-80   Gossypium raimondii
ref|XP_008340433.1|  PREDICTED: myosin-1 isoform X1                     270   1e-80   Malus domestica [apple tree]
ref|XP_008389065.1|  PREDICTED: myosin-1-like                           270   1e-80   Malus domestica [apple tree]
gb|KJB31872.1|  hypothetical protein B456_005G212100                    270   1e-80   Gossypium raimondii
ref|XP_008340434.1|  PREDICTED: myosin-1 isoform X2                     270   2e-80   
ref|XP_010103613.1|  Myosin-2 heavy chain                               270   2e-80   Morus notabilis
ref|XP_006589741.1|  PREDICTED: myosin-1-like isoform X2                270   2e-80   
ref|XP_004147135.1|  PREDICTED: myosin-J heavy chain-like               270   2e-80   Cucumis sativus [cucumbers]
emb|CAN82090.1|  hypothetical protein VITISV_032704                     270   2e-80   Vitis vinifera
ref|XP_003536741.2|  PREDICTED: myosin-1-like isoform X1                269   4e-80   Glycine max [soybeans]
gb|KHN37364.1|  Myosin-J heavy chain                                    269   4e-80   Glycine soja [wild soybean]
ref|XP_003592738.1|  Myosin-like protein                                269   5e-80   Medicago truncatula
ref|XP_011012312.1|  PREDICTED: myosin-1-like isoform X2                269   5e-80   Populus euphratica
ref|XP_011012310.1|  PREDICTED: myosin-1-like isoform X1                269   5e-80   Populus euphratica
gb|KHN46512.1|  Myosin-J heavy chain                                    268   5e-80   Glycine soja [wild soybean]
ref|XP_011012313.1|  PREDICTED: myosin-1-like isoform X3                268   6e-80   Populus euphratica
ref|XP_003533701.1|  PREDICTED: myosin-1-like isoform X1                268   6e-80   
ref|XP_008221075.1|  PREDICTED: myosin-1                                268   1e-79   Prunus mume [ume]
ref|XP_007142760.1|  hypothetical protein PHAVU_007G014600g             267   1e-79   Phaseolus vulgaris [French bean]
gb|KJB79817.1|  hypothetical protein B456_013G068300                    265   2e-79   Gossypium raimondii
gb|KJB79824.1|  hypothetical protein B456_013G068300                    265   2e-79   Gossypium raimondii
ref|XP_003556592.1|  PREDICTED: myosin-1-like                           266   3e-79   Glycine max [soybeans]
gb|KHM99077.1|  Myosin-J heavy chain                                    266   3e-79   Glycine soja [wild soybean]
ref|XP_007225432.1|  hypothetical protein PRUPE_ppa000435mg             266   4e-79   Prunus persica
gb|KJB49958.1|  hypothetical protein B456_008G147000                    266   5e-79   Gossypium raimondii
ref|XP_002310637.2|  hypothetical protein POPTR_0007s07320g             265   7e-79   Populus trichocarpa [western balsam poplar]
gb|KDP37497.1|  hypothetical protein JCGZ_05936                         263   1e-78   Jatropha curcas
ref|XP_002523758.1|  myosin vIII, putative                              265   1e-78   
gb|KJB79823.1|  hypothetical protein B456_013G068300                    265   1e-78   Gossypium raimondii
gb|KJB79819.1|  hypothetical protein B456_013G068300                    265   2e-78   Gossypium raimondii
gb|KJB79818.1|  hypothetical protein B456_013G068300                    264   2e-78   Gossypium raimondii
gb|KJB79822.1|  hypothetical protein B456_013G068300                    265   2e-78   Gossypium raimondii
gb|KJB79821.1|  hypothetical protein B456_013G068300                    265   2e-78   Gossypium raimondii
ref|XP_004297721.1|  PREDICTED: myosin-1-like                           264   3e-78   Fragaria vesca subsp. vesca
ref|XP_007153036.1|  hypothetical protein PHAVU_003G002200g             259   2e-76   Phaseolus vulgaris [French bean]
ref|XP_003589756.1|  LRR receptor-like protein kinase                   252   4e-76   
ref|XP_004498109.1|  PREDICTED: myosin-J heavy chain-like               257   8e-76   Cicer arietinum [garbanzo]
ref|XP_011070461.1|  PREDICTED: myosin-1                                256   2e-75   Sesamum indicum [beniseed]
gb|KEH40947.1|  P-loop nucleoside triphosphate hydrolase superfam...    254   9e-75   Medicago truncatula
gb|AAB71526.1|  unconventional myosin                                   252   3e-74   Helianthus annuus
ref|XP_010688651.1|  PREDICTED: myosin-1-like                           251   9e-74   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010279450.1|  PREDICTED: myosin-1-like                           250   8e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010249396.1|  PREDICTED: myosin-1-like                           245   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_002883217.1|  hypothetical protein ARALYDRAFT_479514             244   5e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_010487954.1|  PREDICTED: myosin-1-like                           242   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006296853.1|  hypothetical protein CARUB_v10012840mg             242   2e-70   Capsella rubella
ref|XP_010466165.1|  PREDICTED: myosin-1                                242   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010508266.1|  PREDICTED: myosin-1-like                           242   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006406435.1|  hypothetical protein EUTSA_v10019925mg             242   3e-70   Eutrema salsugineum
ref|NP_188630.1|  myosin 1                                              241   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAM14075.1|  putative myosin                                         241   6e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CAB61875.1|  myosin                                                 241   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154628.2|  myosin 1                                           240   9e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135657.1|  PREDICTED: myosin-1-like                           238   4e-69   Brassica rapa
emb|CDX82270.1|  BnaA03g35510D                                          238   6e-69   Brassica napus [oilseed rape]
ref|XP_010523208.1|  PREDICTED: myosin-1-like                           237   1e-68   Tarenaya hassleriana [spider flower]
emb|CDY36068.1|  BnaC03g41300D                                          236   1e-68   Brassica napus [oilseed rape]
ref|XP_010557555.1|  PREDICTED: myosin-1-like                           236   2e-68   Tarenaya hassleriana [spider flower]
emb|CDY25361.1|  BnaA05g19230D                                          237   4e-68   Brassica napus [oilseed rape]
emb|CDY24591.1|  BnaC05g32750D                                          235   7e-68   Brassica napus [oilseed rape]
ref|XP_009145709.1|  PREDICTED: myosin-1 isoform X2                     234   2e-67   Brassica rapa
ref|XP_009145706.1|  PREDICTED: myosin-1 isoform X1                     233   2e-67   Brassica rapa
ref|XP_006306608.1|  hypothetical protein CARUB_v10008120mg             227   6e-65   Capsella rubella
ref|XP_002891568.1|  hypothetical protein ARALYDRAFT_474163             226   1e-64   Arabidopsis lyrata subsp. lyrata
gb|EYU39409.1|  hypothetical protein MIMGU_mgv1a000419mg                226   1e-64   Erythranthe guttata [common monkey flower]
gb|EYU35564.1|  hypothetical protein MIMGU_mgv1a000458mg                223   8e-64   Erythranthe guttata [common monkey flower]
ref|XP_010500596.1|  PREDICTED: myosin-3                                223   9e-64   Camelina sativa [gold-of-pleasure]
gb|EPS68761.1|  hypothetical protein M569_06006                         222   2e-63   Genlisea aurea
dbj|BAD93813.1|  myosin                                                 222   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175453.2|  myosin VIIIA                                          222   3e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50052.1|AC007980_17  Highly similar to myosin                     222   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479488.1|  PREDICTED: myosin-3-like                           221   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006393159.1|  hypothetical protein EUTSA_v10011193mg             221   1e-62   Eutrema salsugineum
emb|CDY42506.1|  BnaC06g03520D                                          219   4e-62   Brassica napus [oilseed rape]
gb|ACN26349.1|  unknown                                                 201   2e-58   Zea mays [maize]
ref|XP_009147843.1|  PREDICTED: myosin-3                                208   3e-58   Brassica rapa
emb|CDY22791.1|  BnaA06g02860D                                          208   3e-58   Brassica napus [oilseed rape]
ref|XP_009124542.1|  PREDICTED: myosin-3-like                           206   2e-57   Brassica rapa
emb|CDY29324.1|  BnaA05g15910D                                          206   2e-57   Brassica napus [oilseed rape]
emb|CDY53932.1|  BnaCnng25790D                                          203   2e-56   Brassica napus [oilseed rape]
ref|XP_008802972.1|  PREDICTED: myosin-1-like                           203   2e-56   Phoenix dactylifera
ref|XP_010933291.1|  PREDICTED: myosin-1-like                           203   2e-56   Elaeis guineensis
ref|XP_008664832.1|  PREDICTED: myosin-1                                201   8e-56   Zea mays [maize]
ref|XP_008797209.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-1-like      201   1e-55   Phoenix dactylifera
gb|AAD31926.1|AF147738_1  myosin VIII ZMM3                              200   1e-55   Zea mays [maize]
ref|XP_010935561.1|  PREDICTED: myosin-1-like                           199   3e-55   Elaeis guineensis
ref|XP_009406771.1|  PREDICTED: myosin-1-like                           199   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008812673.1|  PREDICTED: myosin-1-like isoform X4                198   6e-55   Phoenix dactylifera
ref|NP_001064913.1|  Os10g0488800                                       197   6e-55   
ref|XP_008812672.1|  PREDICTED: myosin-1-like isoform X3                198   8e-55   Phoenix dactylifera
gb|ABB47808.1|  Myosin head family protein, expressed                   197   8e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812671.1|  PREDICTED: myosin-1-like isoform X2                198   9e-55   Phoenix dactylifera
ref|XP_002467046.1|  hypothetical protein SORBIDRAFT_01g018770          198   1e-54   Sorghum bicolor [broomcorn]
ref|XP_008812670.1|  PREDICTED: myosin-1-like isoform X1                198   1e-54   Phoenix dactylifera
ref|XP_004982778.1|  PREDICTED: myosin-J heavy chain-like isoform X2    198   1e-54   Setaria italica
ref|XP_004982777.1|  PREDICTED: myosin-J heavy chain-like isoform X1    198   1e-54   
gb|AAL31066.1|AC090120_12  putative myosin                              197   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|AFW68522.1|  hypothetical protein ZEAMMB73_631881                    197   2e-54   Zea mays [maize]
gb|EEC67214.1|  hypothetical protein OsI_34110                          197   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_006661886.1|  PREDICTED: myosin-1-like                           196   4e-54   Oryza brachyantha
ref|XP_003574095.1|  PREDICTED: myosin-1-like                           194   2e-53   Brachypodium distachyon [annual false brome]
dbj|BAK01852.1|  predicted protein                                      182   5e-53   Hordeum vulgare subsp. vulgare [barley]
gb|EMT12170.1|  Myosin-J heavy chain                                    189   2e-51   Aegilops tauschii
ref|XP_010918414.1|  PREDICTED: myosin-1-like                           188   3e-51   Elaeis guineensis
ref|XP_009389227.1|  PREDICTED: myosin-1-like                           187   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003589382.1|  Unconventional myosin                              172   5e-50   Medicago truncatula
ref|XP_010463346.1|  PREDICTED: myosin-3-like                           174   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006847798.1|  hypothetical protein AMTR_s00029p00027850          173   5e-46   
dbj|BAD94297.1|  myosin                                                 158   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841789.1|  hypothetical protein AMTR_s00003p00267250          168   5e-44   
emb|CDY71633.1|  BnaCnng73730D                                          152   8e-43   Brassica napus [oilseed rape]
gb|ACL52804.1|  unknown                                                 147   5e-41   Zea mays [maize]
ref|XP_002975651.1|  hypothetical protein SELMODRAFT_103418             153   6e-39   Selaginella moellendorffii
gb|KHM98905.1|  hypothetical protein glysoja_039075                     141   6e-39   Glycine soja [wild soybean]
ref|XP_002978834.1|  hypothetical protein SELMODRAFT_109322             152   8e-39   Selaginella moellendorffii
ref|XP_003562871.1|  PREDICTED: myosin-3                                148   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_008800396.1|  PREDICTED: myosin-1-like                           147   1e-36   Phoenix dactylifera
ref|XP_006370337.1|  hypothetical protein POPTR_0001s41770g             146   1e-36   Populus trichocarpa [western balsam poplar]
gb|EMT14738.1|  Myosin-2 heavy chain                                    146   1e-36   Aegilops tauschii
dbj|BAJ99526.1|  predicted protein                                      146   2e-36   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008345270.1|  PREDICTED: myosin-2-like isoform X2                145   4e-36   Malus domestica [apple tree]
ref|XP_008345271.1|  PREDICTED: myosin-2-like isoform X3                145   4e-36   Malus domestica [apple tree]
ref|XP_008345269.1|  PREDICTED: myosin-2-like isoform X1                145   4e-36   Malus domestica [apple tree]
gb|EMS56234.1|  Myosin-2 heavy chain                                    144   1e-35   Triticum urartu
ref|XP_001755337.1|  predicted protein                                  143   2e-35   Physcomitrella patens
ref|XP_001768683.1|  predicted protein                                  141   7e-35   Physcomitrella patens
ref|XP_002281748.1|  PREDICTED: myosin-2                                141   1e-34   Vitis vinifera
emb|CBI20376.3|  unnamed protein product                                140   2e-34   Vitis vinifera
ref|XP_006584303.1|  PREDICTED: probable inactive leucine-rich re...    134   2e-34   Glycine max [soybeans]
ref|XP_011044539.1|  PREDICTED: myosin-2                                140   2e-34   Populus euphratica
ref|XP_009342449.1|  PREDICTED: myosin-2 isoform X1                     140   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_008226710.1|  PREDICTED: myosin-2 isoform X1                     140   2e-34   Prunus mume [ume]
ref|XP_009342451.1|  PREDICTED: myosin-2 isoform X3                     140   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_009342450.1|  PREDICTED: myosin-2 isoform X2                     140   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_009342454.1|  PREDICTED: myosin-2 isoform X5                     140   2e-34   Pyrus x bretschneideri [bai li]
gb|EEC82270.1|  hypothetical protein OsI_26483                          139   4e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_007212835.1|  hypothetical protein PRUPE_ppa020758mg             139   6e-34   Prunus persica
ref|XP_001774306.1|  predicted protein                                  139   6e-34   Physcomitrella patens
gb|KJB13459.1|  hypothetical protein B456_002G076300                    137   7e-34   Gossypium raimondii
gb|KJB13460.1|  hypothetical protein B456_002G076300                    137   7e-34   Gossypium raimondii
gb|KJB13461.1|  hypothetical protein B456_002G076300                    137   7e-34   Gossypium raimondii
ref|XP_008366419.1|  PREDICTED: myosin-2 isoform X2                     138   1e-33   Malus domestica [apple tree]
ref|XP_008366425.1|  PREDICTED: myosin-2 isoform X3                     138   1e-33   Malus domestica [apple tree]
ref|XP_008366413.1|  PREDICTED: myosin-2 isoform X1                     138   1e-33   Malus domestica [apple tree]
gb|EEE67412.1|  hypothetical protein OsJ_24744                          138   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009334585.1|  PREDICTED: myosin-2 isoform X2                     138   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_009334584.1|  PREDICTED: myosin-2 isoform X1                     138   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_009334586.1|  PREDICTED: myosin-2 isoform X3                     138   1e-33   Pyrus x bretschneideri [bai li]
gb|KJB13457.1|  hypothetical protein B456_002G076300                    138   1e-33   Gossypium raimondii
gb|KJB13454.1|  hypothetical protein B456_002G076300                    138   1e-33   Gossypium raimondii
gb|KJB13453.1|  hypothetical protein B456_002G076300                    138   1e-33   Gossypium raimondii
ref|XP_001777862.1|  predicted protein                                  136   3e-33   Physcomitrella patens
ref|XP_010268832.1|  PREDICTED: myosin-2                                136   7e-33   Nelumbo nucifera [Indian lotus]
gb|AEM05968.1|  myosin VIII D                                           135   9e-33   Physcomitrella patens
ref|XP_010905050.1|  PREDICTED: myosin-1                                135   9e-33   Elaeis guineensis
ref|XP_009412435.1|  PREDICTED: myosin-1-like                           135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEM05969.1|  myosin VIII E                                           135   1e-32   Physcomitrella patens
ref|XP_010905572.1|  PREDICTED: myosin-1-like                           135   1e-32   Elaeis guineensis
ref|XP_006657835.1|  PREDICTED: myosin-2-like                           135   1e-32   Oryza brachyantha
ref|XP_007021262.1|  Myosin 2 isoform 2                                 134   2e-32   Theobroma cacao [chocolate]
ref|XP_007021261.1|  Myosin 2 isoform 1                                 134   2e-32   Theobroma cacao [chocolate]
ref|XP_008806763.1|  PREDICTED: myosin-1-like                           133   5e-32   Phoenix dactylifera
ref|XP_010062907.1|  PREDICTED: myosin-2                                132   1e-31   Eucalyptus grandis [rose gum]
ref|XP_011029402.1|  PREDICTED: myosin-2-like                           131   2e-31   Populus euphratica
ref|XP_002316933.2|  hypothetical protein POPTR_0011s12670g             131   3e-31   Populus trichocarpa [western balsam poplar]
gb|AEM05967.1|  myosin VIII B                                           130   7e-31   Physcomitrella patens
ref|XP_010278387.1|  PREDICTED: myosin-1 isoform X3                     129   9e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010278386.1|  PREDICTED: myosin-2 isoform X2                     129   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010278385.1|  PREDICTED: myosin-2 isoform X1                     129   1e-30   Nelumbo nucifera [Indian lotus]
tpg|DAA63129.1|  TPA: hypothetical protein ZEAMMB73_109792              129   1e-30   Zea mays [maize]
ref|XP_008654108.1|  PREDICTED: myosin-1-like                           129   2e-30   Zea mays [maize]
gb|KDO74222.1|  hypothetical protein CISIN_1g000931mg                   128   3e-30   Citrus sinensis [Valencia orange]
ref|XP_006464677.1|  PREDICTED: myosin-2-like isoform X6                128   3e-30   Citrus sinensis [Valencia orange]
ref|XP_006451994.1|  hypothetical protein CICLE_v10007271mg             128   3e-30   Citrus clementina
dbj|BAL60532.2|  myosin VIII                                            128   3e-30   Marchantia polymorpha
gb|KDO74224.1|  hypothetical protein CISIN_1g000931mg                   127   5e-30   Citrus sinensis [Valencia orange]
ref|XP_006464672.1|  PREDICTED: myosin-2-like isoform X1                127   6e-30   Citrus sinensis [Valencia orange]
gb|KDO74218.1|  hypothetical protein CISIN_1g000931mg                   127   6e-30   Citrus sinensis [Valencia orange]
ref|XP_006451996.1|  hypothetical protein CICLE_v10007271mg             127   6e-30   Citrus clementina
gb|KHG19058.1|  Myosin-2 heavy chain                                    125   2e-29   Gossypium arboreum [tree cotton]
gb|KHG13556.1|  Myosin-2 heavy chain                                    125   2e-29   Gossypium arboreum [tree cotton]
gb|KJB62696.1|  hypothetical protein B456_009G430900                    125   3e-29   Gossypium raimondii
ref|XP_004294488.1|  PREDICTED: myosin-2                                125   4e-29   Fragaria vesca subsp. vesca
ref|XP_010101784.1|  Myosin-2 heavy chain                               124   8e-29   Morus notabilis
ref|XP_002525757.1|  myosin vIII, putative                              124   8e-29   Ricinus communis
ref|XP_010324344.1|  PREDICTED: myosin-2-like isoform X2                124   9e-29   Solanum lycopersicum
ref|XP_009420769.1|  PREDICTED: myosin-2-like isoform X2                120   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010324342.1|  PREDICTED: myosin-2-like isoform X1                122   2e-28   Solanum lycopersicum
ref|XP_009420767.1|  PREDICTED: myosin-2-like isoform X1                119   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001775964.1|  predicted protein                                  122   4e-28   Physcomitrella patens
emb|CDP05853.1|  unnamed protein product                                122   4e-28   Coffea canephora [robusta coffee]
ref|XP_008454630.1|  PREDICTED: myosin-2-like                           122   4e-28   Cucumis melo [Oriental melon]
gb|EYU19161.1|  hypothetical protein MIMGU_mgv1a000383mg                121   7e-28   Erythranthe guttata [common monkey flower]
ref|XP_011098363.1|  PREDICTED: myosin-2-like                           121   9e-28   Sesamum indicum [beniseed]
ref|XP_006362935.1|  PREDICTED: myosin-2-like isoform X2                119   4e-27   Solanum tuberosum [potatoes]
ref|XP_006362934.1|  PREDICTED: myosin-2-like isoform X1                119   4e-27   Solanum tuberosum [potatoes]
ref|XP_006592898.1|  PREDICTED: myosin-2-like isoform X3                119   6e-27   Glycine max [soybeans]
ref|XP_003539582.1|  PREDICTED: myosin-2-like isoform X1                118   9e-27   Glycine max [soybeans]
ref|XP_006592897.1|  PREDICTED: myosin-2-like isoform X2                118   9e-27   Glycine max [soybeans]
gb|KHN28019.1|  Myosin-J heavy chain                                    118   1e-26   Glycine soja [wild soybean]
gb|EMS67686.1|  Myosin-J heavy chain                                    118   1e-26   Triticum urartu
ref|XP_009792547.1|  PREDICTED: myosin-2-like isoform X1                117   2e-26   Nicotiana sylvestris
ref|XP_009792549.1|  PREDICTED: myosin-2-like isoform X2                117   2e-26   Nicotiana sylvestris
ref|XP_006279905.1|  hypothetical protein CARUB_v10025758mg             116   3e-26   Capsella rubella
ref|XP_009589778.1|  PREDICTED: myosin-2-like isoform X1                115   6e-26   Nicotiana tomentosiformis
ref|XP_009589781.1|  PREDICTED: myosin-2-like isoform X2                115   6e-26   Nicotiana tomentosiformis
ref|XP_011095261.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-2-like      115   7e-26   Sesamum indicum [beniseed]
ref|XP_006401589.1|  hypothetical protein EUTSA_v10012475mg             115   8e-26   Eutrema salsugineum
ref|XP_007149632.1|  hypothetical protein PHAVU_005G085900g             114   1e-25   Phaseolus vulgaris [French bean]
ref|XP_003541859.1|  PREDICTED: myosin-2-like                           115   1e-25   Glycine max [soybeans]
ref|XP_002993349.1|  hypothetical protein SELMODRAFT_137032             115   1e-25   Selaginella moellendorffii
ref|XP_004487658.1|  PREDICTED: myosin-J heavy chain-like isoform X1    115   1e-25   Cicer arietinum [garbanzo]
ref|XP_002972734.1|  hypothetical protein SELMODRAFT_98074              114   2e-25   Selaginella moellendorffii
ref|XP_009773271.1|  PREDICTED: myosin-2-like isoform X2                114   2e-25   Nicotiana sylvestris
ref|XP_010446745.1|  PREDICTED: myosin-2-like                           114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010443003.1|  PREDICTED: myosin-2                                114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004487659.1|  PREDICTED: myosin-J heavy chain-like isoform X2    114   2e-25   
ref|XP_010520892.1|  PREDICTED: myosin-2-like                           114   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_007149633.1|  hypothetical protein PHAVU_005G085900g             114   2e-25   Phaseolus vulgaris [French bean]
ref|XP_007149634.1|  hypothetical protein PHAVU_005G085900g             114   2e-25   Phaseolus vulgaris [French bean]
ref|XP_010694427.1|  PREDICTED: myosin-2 isoform X2                     114   2e-25   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010694426.1|  PREDICTED: myosin-2 isoform X1                     114   2e-25   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009773270.1|  PREDICTED: myosin-2-like isoform X1                114   3e-25   Nicotiana sylvestris
ref|XP_002866036.1|  predicted protein                                  114   3e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_010482837.1|  PREDICTED: myosin-2-like                           113   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009119961.1|  PREDICTED: myosin-2-like                           113   5e-25   Brassica rapa
emb|CDY14319.1|  BnaA10g07360D                                          113   6e-25   Brassica napus [oilseed rape]
ref|XP_004248278.1|  PREDICTED: myosin-2-like isoform X1                112   7e-25   Solanum lycopersicum
ref|XP_010327147.1|  PREDICTED: myosin-2-like isoform X2                112   7e-25   Solanum lycopersicum
ref|NP_001078755.1|  myosin 2                                           112   8e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01329.1|  myosin heavy chain                                     112   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568806.3|  myosin 2                                              112   9e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10751.1|  myosin heavy chain                                     112   9e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAA84065.1|  myosin                                                 112   9e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ABJ53201.1|  myosin VIII-2                                           112   1e-24   Nicotiana benthamiana
ref|XP_010922002.1|  PREDICTED: myosin-1-like                           112   1e-24   Elaeis guineensis
ref|XP_009603975.1|  PREDICTED: myosin-2-like isoform X2                111   2e-24   Nicotiana tomentosiformis
ref|XP_008805849.1|  PREDICTED: myosin-1-like                           111   2e-24   Phoenix dactylifera
ref|XP_009603974.1|  PREDICTED: myosin-2-like isoform X1                111   2e-24   Nicotiana tomentosiformis
emb|CDY52239.1|  BnaC02g44600D                                          111   2e-24   Brassica napus [oilseed rape]
ref|XP_004146844.1|  PREDICTED: myosin-2 heavy chain-like               111   3e-24   Cucumis sativus [cucumbers]
emb|CDY28777.1|  BnaA02g09690D                                          111   3e-24   Brassica napus [oilseed rape]
ref|XP_009127101.1|  PREDICTED: myosin-2                                111   3e-24   Brassica rapa
emb|CDY18321.1|  BnaC09g30710D                                          110   4e-24   Brassica napus [oilseed rape]
ref|XP_003596488.1|  Myosin-like protein                                110   4e-24   
gb|AES66739.2|  P-loop nucleoside triphosphate hydrolase superfam...    110   4e-24   Medicago truncatula
gb|KDP38945.1|  hypothetical protein JCGZ_00702                         107   3e-23   Jatropha curcas
gb|EYU33558.1|  hypothetical protein MIMGU_mgv1a000433mg                107   3e-23   Erythranthe guttata [common monkey flower]
ref|NP_001059992.1|  Os07g0562800                                       107   7e-23   
gb|ABJ53202.1|  myosin VIII-B                                           107   7e-23   
ref|XP_004958024.1|  PREDICTED: unconventional myosin-Va-like           106   1e-22   
ref|XP_010536994.1|  PREDICTED: myosin-2-like isoform X2                105   2e-22   
ref|XP_010536993.1|  PREDICTED: myosin-2-like isoform X1                105   2e-22   
ref|XP_009402609.1|  PREDICTED: myosin-2-like                           101   3e-22   
gb|AAG49341.1|  myosin subfamily VIII heavy chain                     97.8    1e-19   
ref|XP_007133144.1|  hypothetical protein PHAVU_011G155300g           96.3    3e-19   
gb|KHN46956.1|  Myosin-J heavy chain                                  95.9    5e-19   
ref|XP_003526112.1|  PREDICTED: myosin-2-like isoform X1              95.9    5e-19   
ref|XP_006582193.1|  PREDICTED: myosin-2-like isoform X2              95.9    5e-19   
ref|NP_194467.5|  myosin heavy chain-like protein                     95.5    7e-19   
emb|CAA19731.1|  myosin heavy chain-like protein                      95.5    7e-19   
emb|CAB81387.1|  myosin heavy chain-like protein                      95.1    8e-19   
gb|KEH19592.1|  P-loop nucleoside triphosphate hydrolase superfam...  94.4    1e-18   
ref|XP_009420533.1|  PREDICTED: myosin-2-like                         90.5    3e-18   
ref|XP_004510018.1|  PREDICTED: unconventional myosin-Va-like         92.8    5e-18   
ref|XP_002867507.1|  hypothetical protein ARALYDRAFT_492062           91.7    1e-17   
ref|XP_003541108.1|  PREDICTED: myosin-2-like                         90.5    3e-17   
ref|XP_009385074.1|  PREDICTED: myosin-2-like                         87.0    4e-17   
ref|XP_006283030.1|  hypothetical protein CARUB_v10004022mg           89.0    8e-17   
ref|XP_010448147.1|  PREDICTED: myosin-4-like                         89.0    9e-17   
ref|XP_010438625.1|  PREDICTED: myosin-4-like                         88.6    1e-16   
gb|EPS62979.1|  hypothetical protein M569_11810                       80.9    3e-15   
ref|XP_003057663.1|  predicted protein                                82.4    2e-14   
gb|KHF97725.1|  Membrane antigen containing repeating peptides        77.4    6e-14   
gb|KFK29252.1|  hypothetical protein AALP_AA7G109000                  79.3    2e-13   
gb|KFK29251.1|  hypothetical protein AALP_AA7G109000                  79.3    2e-13   
ref|XP_009382696.1|  PREDICTED: myosin-2-like                         76.3    8e-13   
gb|EPS70501.1|  hypothetical protein M569_04240                       76.3    2e-12   
ref|XP_006413084.1|  hypothetical protein EUTSA_v10024254mg           75.9    2e-12   
ref|XP_002501869.1|  predicted protein                                75.5    3e-12   
gb|KJB81873.1|  hypothetical protein B456_013G166000                  72.4    3e-11   
gb|KJB81875.1|  hypothetical protein B456_013G166000                  72.4    3e-11   
gb|KJB81874.1|  hypothetical protein B456_013G166000                  72.4    3e-11   
gb|KJB81876.1|  hypothetical protein B456_013G166000                  72.4    3e-11   
ref|XP_009143365.1|  PREDICTED: myosin-4                              71.6    5e-11   
emb|CDO99630.1|  unnamed protein product                              64.3    3e-09   
ref|XP_006663390.1|  PREDICTED: myosin-1-like                         63.5    9e-09   
ref|XP_011096207.1|  PREDICTED: myosin-2-like                         63.5    1e-08   
dbj|BAK06656.1|  predicted protein                                    62.8    2e-08   
ref|XP_009801337.1|  PREDICTED: myosin-2-like                         62.0    4e-08   
gb|EAY86343.1|  hypothetical protein OsI_07720                        60.1    1e-07   
ref|NP_001067772.1|  Os11g0424400                                     58.9    4e-07   
ref|XP_010316685.1|  PREDICTED: myosin-3-like isoform X2              58.2    7e-07   
ref|XP_002451578.1|  hypothetical protein SORBIDRAFT_04g004170        57.4    1e-06   
ref|XP_003576065.2|  PREDICTED: myosin-2-like                         57.4    1e-06   
gb|EEC75625.1|  hypothetical protein OsI_12352                        52.8    2e-06   
ref|XP_002956099.1|  type VIII myosin heavy chain MyoC                57.4    2e-06   
gb|KJB13456.1|  hypothetical protein B456_002G076300                  56.2    4e-06   
gb|KDO74223.1|  hypothetical protein CISIN_1g000931mg                 55.8    6e-06   
gb|KJB13458.1|  hypothetical protein B456_002G076300                  55.5    6e-06   
ref|NP_001130272.1|  hypothetical protein                             54.3    1e-05   
ref|XP_002463024.1|  hypothetical protein SORBIDRAFT_02g036390        53.9    2e-05   
emb|CDX98429.1|  BnaC05g39460D                                        50.8    1e-04   
ref|XP_009105704.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-4-like    51.6    1e-04   
gb|EPS65807.1|  hypothetical protein M569_08970                       50.1    4e-04   
ref|XP_002459709.1|  hypothetical protein SORBIDRAFT_02g009180        49.3    5e-04   



>gb|ABK94124.1| unknown [Populus trichocarpa]
Length=252

 Score =   263 bits (673),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYE+RWSEYELKMKSMEE+WQKQMRSLQSSLSIAKKSL++DDS RNS
Sbjct  64   KEEENDILHQRLQQYESRWSEYELKMKSMEEMWQKQMRSLQSSLSIAKKSLSVDDSERNS  123

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNAS++++ +WD G+N    ENNGVRP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  124  DASVNASEERDFSWDTGSNHRGQENNGVRPISAGLSVISRLAEEFEQRSQVFGDDAKFLV  183

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+I +KLG++EGA D++KKKWW
Sbjct  184  EVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGALDRVKKKWW  243

Query  581  G  583
            G
Sbjct  244  G  244



>ref|XP_009622620.1| PREDICTED: myosin-1-like [Nicotiana tomentosiformis]
Length=1151

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL LDDS RNS
Sbjct  963   KEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSLTLDDSRRNS  1022

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +D+KES+W+ G+N  A E+NG RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1023  DASVNPTDEKESSWETGSNHRARESNGARPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1082

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGS+EGASDKMKKKWW
Sbjct  1083  EVKSGQVEANLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGASDKMKKKWW  1142

Query  581   G  583
             G
Sbjct  1143  G  1143



>ref|XP_009783184.1| PREDICTED: myosin-1-like [Nicotiana sylvestris]
Length=1151

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL LDDS RNS
Sbjct  963   KEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSLTLDDSRRNS  1022

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +D+KES+W+ G+N  A E+NG RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1023  DASVNPTDEKESSWETGSNHRARESNGARPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1082

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGS+EGASDKMKKKWW
Sbjct  1083  EVKSGQVEANLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGASDKMKKKWW  1142

Query  581   G  583
             G
Sbjct  1143  G  1143



>gb|ABJ53200.1| myosin VIII-1 [Nicotiana benthamiana]
Length=1150

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SL LDDS RNS
Sbjct  963   KEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSLTLDDS-RNS  1021

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +D+KES+W+ G+N  A E+NG RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1022  DASVNPTDEKESSWETGSNHRARESNGARPMNAGLSVISRLAEEFEQRSQVFGDDAKFLV  1081

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EANLNPDHELRRLK MFE+WKKDYG RL+ETKVI  KLGS+EGASDKMKKKWW
Sbjct  1082  EVKSGQVEANLNPDHELRRLKQMFEAWKKDYGSRLRETKVILSKLGSDEGASDKMKKKWW  1141

Query  581   G  583
             G
Sbjct  1142  G  1142



>ref|XP_004231522.1| PREDICTED: myosin-1 [Solanum lycopersicum]
Length=1157

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SLALDDS RNS
Sbjct  969   KEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSLALDDSRRNS  1028

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +D+KES+W+ G+N+ A E+NGVRP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1029  DASVNPTDEKESSWETGSNQRARESNGVRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1088

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETKVI +KLGS+EG SDKMKKKWW
Sbjct  1089  EVKSGQVEANLSPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGGSDKMKKKWW  1148

Query  581   G  583
             G
Sbjct  1149  G  1149



>ref|XP_006345301.1| PREDICTED: myosin-1-like [Solanum tuberosum]
Length=1157

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SLALDDS RNS
Sbjct  969   KEEENDILHQRLQQYENRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSLALDDSRRNS  1028

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +D+KES+W+ G+N+ A E+NGVRP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1029  DASVNPTDEKESSWETGSNQRARESNGVRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1088

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETKVI +KLGS+EG SDKMKKKWW
Sbjct  1089  EVKSGQVEANLSPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGSDEGGSDKMKKKWW  1148

Query  581   G  583
             G
Sbjct  1149  G  1149



>emb|CDP18554.1| unnamed protein product [Coffea canephora]
Length=1129

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLALDDS RNS
Sbjct  941   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLALDDSHRNS  1000

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+E++WD G+N    ++NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1001  DASVNASDDRETSWDAGSNFRVSDSNGMRPMNAGLSVISRLAEEFEQRSQVFGDDAKFLV  1060

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETKVI HKLGS+EG+ DK +KKWW
Sbjct  1061  EVKSGQAEANLDPDRELRRLKQMFEAWKKDYGSRLRETKVILHKLGSDEGSGDKGRKKWW  1120

Query  581   G  583
             G
Sbjct  1121  G  1121



>ref|XP_010067014.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 ref|XP_010067015.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 gb|KCW65077.1| hypothetical protein EUGRSUZ_G02585 [Eucalyptus grandis]
Length=1175

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDSARNS
Sbjct  987   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSARNS  1046

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN SDD++S WD G++    ++NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1047  DASVNNSDDRDSNWDTGSSYKGQDSNGMRPMNAGLSVISRLAEEFEQRSQVFGDDAKFLV  1106

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A+LNPD ELRRLK MFE+WKKDYGVRL+ETKVI HKLGS+EGA+D+ KKKWW
Sbjct  1107  EVKSGQVDASLNPDRELRRLKQMFEAWKKDYGVRLRETKVILHKLGSDEGAADRAKKKWW  1166

Query  581   G  583
             G
Sbjct  1167  G  1167



>gb|KDO69897.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69898.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=745

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  557  KEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  616

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNASD+ E +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQVFGDDAKFLV
Sbjct  617  DASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQVFGDDAKFLV  676

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSEEGA D++KKKWW
Sbjct  677  EVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGAIDRVKKKWW  736

Query  581  G  583
            G
Sbjct  737  G  737



>ref|XP_007043232.1| Myosin 1 isoform 2 [Theobroma cacao]
 gb|EOX99063.1| Myosin 1 isoform 2 [Theobroma cacao]
Length=920

 Score =   273 bits (697),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S RNS
Sbjct  732  KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERNS  791

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNASDD+E +WD G+N    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  792  DASVNASDDREYSWDTGSNHKGPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  851

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVI +KLG+EEGA D++KKKWW
Sbjct  852  EVKSGQVEASLNPDRELRRLKQMFETWKKDYASRLRETKVILNKLGNEEGALDRVKKKWW  911

Query  581  G  583
            G
Sbjct  912  G  912



>gb|KDO69895.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69896.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=793

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  605  KEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  664

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNASD+ E +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQVFGDDAKFLV
Sbjct  665  DASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQVFGDDAKFLV  724

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSEEGA D++KKKWW
Sbjct  725  EVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGAIDRVKKKWW  784

Query  581  G  583
            G
Sbjct  785  G  785



>gb|KDO69891.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=906

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  718  KEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  777

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNASD+ E +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQVFGDDAKFLV
Sbjct  778  DASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQVFGDDAKFLV  837

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSEEGA D++KKKWW
Sbjct  838  EVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGAIDRVKKKWW  897

Query  581  G  583
            G
Sbjct  898  G  898



>gb|KHF99826.1| Unconventional myosin-Va [Gossypium arboreum]
Length=1179

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  990   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDSERNS  1049

Query  221   DASVN-ASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFL  397
             DASVN ASDD+E +WD G N    E+NG+RP  AGLSVI +LAEEFEQRSQVFGDDAKFL
Sbjct  1050  DASVNNASDDREYSWDTGTNHNGPESNGLRPTSAGLSVISRLAEEFEQRSQVFGDDAKFL  1109

Query  398   VEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKW  577
             VEVKSG  EANLNPD ELRRLK MFE+WKKDY VRL+ETKV+ +KLG+EEGA D++KKKW
Sbjct  1110  VEVKSGQVEANLNPDRELRRLKQMFETWKKDYSVRLRETKVVLNKLGNEEGALDRVKKKW  1169

Query  578   WG  583
             WG
Sbjct  1170  WG  1171



>ref|XP_006605841.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1059

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  871   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  930

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD++ +WD+G N    E+NG R + AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  931   DASVNASDDRDFSWDVGTNHRRQESNGARSMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  990

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HKLGSE+G+ +K+KK WW
Sbjct  991   EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGSIEKVKKSWW  1050

Query  581   G  583
             G
Sbjct  1051  G  1051



>gb|KDO69889.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
 gb|KDO69890.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=907

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  719  KEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  778

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNASD+ E +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQVFGDDAKFLV
Sbjct  779  DASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQVFGDDAKFLV  838

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSEEGA D++KKKWW
Sbjct  839  EVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGAIDRVKKKWW  898

Query  581  G  583
            G
Sbjct  899  G  899



>ref|XP_007142759.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14753.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=745

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQY++RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  557  KEEENDILHQRLQQYDSRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  616

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNASD+++ +WD+G N    E+NGVR + AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  617  DASVNASDERDFSWDVGTNHRRQESNGVRSMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  676

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVI HKLGSE+G+ DK+KK WW
Sbjct  677  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYNARLRETKVILHKLGSEDGSIDKVKKSWW  736

Query  581  G  583
            G
Sbjct  737  G  737



>gb|KHN23106.1| Unconventional myosin-Va [Glycine soja]
Length=947

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  759  KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  818

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DASVNASDD++ +WD+G N    E+NG R + AGLSVI +LAEEFEQRSQVFGDD+KFLV
Sbjct  819  DASVNASDDRDFSWDVGTNHRRQESNGARSMSAGLSVISRLAEEFEQRSQVFGDDSKFLV  878

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HKLGSE+G+ +K+KK WW
Sbjct  879  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGSIEKVKKSWW  938

Query  581  G  583
            G
Sbjct  939  G  939



>ref|XP_007043231.1| Myosin 1 isoform 1 [Theobroma cacao]
 gb|EOX99062.1| Myosin 1 isoform 1 [Theobroma cacao]
Length=1153

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S RNS
Sbjct  965   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERNS  1024

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+E +WD G+N    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1025  DASVNASDDREYSWDTGSNHKGPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1084

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVI +KLG+EEGA D++KKKWW
Sbjct  1085  EVKSGQVEASLNPDRELRRLKQMFETWKKDYASRLRETKVILNKLGNEEGALDRVKKKWW  1144

Query  581   G  583
             G
Sbjct  1145  G  1145



>ref|XP_006605839.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006605840.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1170

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  982   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  1041

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD++ +WD+G N    E+NG R + AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1042  DASVNASDDRDFSWDVGTNHRRQESNGARSMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1101

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HKLGSE+G+ +K+KK WW
Sbjct  1102  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGSIEKVKKSWW  1161

Query  581   G  583
             G
Sbjct  1162  G  1162



>ref|XP_011022005.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022006.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022007.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022008.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1173

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEND+LHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  985   KEEENDVLHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1044

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD++E +WD G+N    E+N  RP+ AGLSVI ++AEEFEQRSQVFGDDAKFLV
Sbjct  1045  DASVNASDERECSWDTGSNHRGQESNSARPMSAGLSVISRMAEEFEQRSQVFGDDAKFLV  1104

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLG+EEGA D++K+KWW
Sbjct  1105  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGTEEGALDRVKRKWW  1164

Query  581   G  583
             G
Sbjct  1165  G  1165



>ref|XP_011022009.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1118

 Score =   271 bits (694),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEND+LHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  930   KEEENDVLHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  989

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD++E +WD G+N    E+N  RP+ AGLSVI ++AEEFEQRSQVFGDDAKFLV
Sbjct  990   DASVNASDERECSWDTGSNHRGQESNSARPMSAGLSVISRMAEEFEQRSQVFGDDAKFLV  1049

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLG+EEGA D++K+KWW
Sbjct  1050  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGTEEGALDRVKRKWW  1109

Query  581   G  583
             G
Sbjct  1110  G  1110



>ref|XP_009351748.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351749.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
Length=1175

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  986   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1045

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+E +WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQVFGDDAKFLV
Sbjct  1046  DASVNASDDREYSWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQVFGDDAKFLV  1105

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS-DKMKKKW  577
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HK+G+EEG S D++KKKW
Sbjct  1106  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGGSADRVKKKW  1165

Query  578   WG  583
             WG
Sbjct  1166  WG  1167



>ref|XP_009351750.1| PREDICTED: myosin-1-like isoform X2 [Pyrus x bretschneideri]
Length=1163

 Score =   271 bits (693),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  974   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1033

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+E +WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQVFGDDAKFLV
Sbjct  1034  DASVNASDDREYSWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQVFGDDAKFLV  1093

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS-DKMKKKW  577
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HK+G+EEG S D++KKKW
Sbjct  1094  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGGSADRVKKKW  1153

Query  578   WG  583
             WG
Sbjct  1154  WG  1155



>ref|XP_006437635.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
 gb|ESR50875.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
Length=1168

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  980   KEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1039

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+ E +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQVFGDDAKFLV
Sbjct  1040  DASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQVFGDDAKFLV  1099

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSEEGA D++KKKWW
Sbjct  1100  EVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGAIDRVKKKWW  1159

Query  581   G  583
             G
Sbjct  1160  G  1160



>ref|XP_004497240.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1176

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEENDILHQRLQQY+NRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  988   KDEENDILHQRLQQYDNRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  1047

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDDKE +WDIGN+    E++G R + AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1048  DASVNASDDKEYSWDIGNHHRRQESSGTRSMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1107

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD EL RLK MFE+WKKDYG RL+ETKVI HKLGSE G+ +K KKKWW
Sbjct  1108  EVKSGQVEASLNPDRELGRLKQMFEAWKKDYGSRLRETKVILHKLGSENGSVEKAKKKWW  1167

Query  581   G  583
             G
Sbjct  1168  G  1168



>ref|XP_002307152.1| myosin-related family protein [Populus trichocarpa]
 gb|EEE94148.1| myosin-related family protein [Populus trichocarpa]
Length=1173

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEND+LHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  985   KEEENDVLHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1044

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD++E +WD G+N    E+N  RP+ AGLSVI ++AEEFEQRSQVFGDDAKFLV
Sbjct  1045  DASVNASDEREFSWDTGSNHRGQESNSARPMSAGLSVISRMAEEFEQRSQVFGDDAKFLV  1104

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLG+EEGA D++K+KWW
Sbjct  1105  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILNKLGTEEGALDRVKRKWW  1164

Query  581   G  583
             G
Sbjct  1165  G  1165



>ref|XP_006484499.1| PREDICTED: myosin-1-like [Citrus sinensis]
Length=1167

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYE KMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  979   KEEENDILHQRLQQYESRWSEYEQKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1038

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+ E +WD G+N    E+NGVRP+ AGLSVI +LAEEF+QRSQVFGDDAKFLV
Sbjct  1039  DASVNASDEVEYSWDTGSNCKGQESNGVRPMSAGLSVISRLAEEFDQRSQVFGDDAKFLV  1098

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSEEGA D++KKKWW
Sbjct  1099  EVKSGQVEASLNPDKELRRLKQMFEAWKKDYGSRLRETKVILNKLGSEEGAIDRVKKKWW  1158

Query  581   G  583
             G
Sbjct  1159  G  1159



>emb|CBI35399.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score =   271 bits (692),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  947   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSRRNS  1006

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +DD++S+WD G+N    E+NG+RP+ AGL+VI ++AEEFEQRSQVFGDDAKFLV
Sbjct  1007  DASVNLTDDRDSSWDTGSNFRGQESNGMRPMSAGLTVISRMAEEFEQRSQVFGDDAKFLV  1066

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG TEA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI  KLG+EEG+ DK +KKWW
Sbjct  1067  EVKSGQTEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILQKLGNEEGSGDKARKKWW  1126



>ref|XP_008445889.1| PREDICTED: myosin-1-like [Cucumis melo]
Length=1175

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQ+QMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  988   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQRQMRSLQSSLSIAKKSLAVDDSERNS  1047

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+  +W++G+N TA E+NGVRP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1048  DASVNASDDRGYSWEVGSNNTANESNGVRPMNAGLSVISRLAEEFEQRSQVFGDDAKFLV  1107

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVI +KLG+ EGA D++KKKWW
Sbjct  1108  EVKSGQVEASLDPDRELRRLKQMFEAWKKDYGGRLRETKVILNKLGN-EGAMDRVKKKWW  1166

Query  581   G  583
             G
Sbjct  1167  G  1167



>ref|XP_002273898.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656029.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656030.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656031.1| PREDICTED: myosin-1 [Vitis vinifera]
Length=1197

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  1009  KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSRRNS  1068

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +DD++S+WD G+N    E+NG+RP+ AGL+VI ++AEEFEQRSQVFGDDAKFLV
Sbjct  1069  DASVNLTDDRDSSWDTGSNFRGQESNGMRPMSAGLTVISRMAEEFEQRSQVFGDDAKFLV  1128

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG TEA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI  KLG+EEG+ DK +KKWW
Sbjct  1129  EVKSGQTEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILQKLGNEEGSGDKARKKWW  1188



>ref|XP_004497241.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1159

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEENDILHQRLQQY+NRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  971   KDEENDILHQRLQQYDNRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  1030

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDDKE +WDIGN+    E++G R + AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1031  DASVNASDDKEYSWDIGNHHRRQESSGTRSMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1090

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD EL RLK MFE+WKKDYG RL+ETKVI HKLGSE G+ +K KKKWW
Sbjct  1091  EVKSGQVEASLNPDRELGRLKQMFEAWKKDYGSRLRETKVILHKLGSENGSVEKAKKKWW  1150

Query  581   G  583
             G
Sbjct  1151  G  1151



>gb|KJB31871.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
 gb|KJB31873.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
Length=1145

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DD+ RNS
Sbjct  956   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDTERNS  1015

Query  221   DASVN-ASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFL  397
             DASVN ASDD+E +WD G N    E+NG+RP  AGLSVI +LAEEFEQRSQVFGDDAKFL
Sbjct  1016  DASVNNASDDREYSWDTGTNHKGPESNGLRPTSAGLSVISRLAEEFEQRSQVFGDDAKFL  1075

Query  398   VEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKW  577
             VEVKSG  EANLNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+EEGA D++KKKW
Sbjct  1076  VEVKSGQVEANLNPDRELRRLKQMFETWKKDYAARLRETKVVLNKLGNEEGALDRVKKKW  1135

Query  578   WG  583
             WG
Sbjct  1136  WG  1137



>ref|XP_008340433.1| PREDICTED: myosin-1 isoform X1 [Malus domestica]
Length=1166

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  977   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1036

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+E  WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQVFGDDAKFLV
Sbjct  1037  DASVNASDDREYGWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQVFGDDAKFLV  1096

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS-DKMKKKW  577
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HK+G+EEG S D++KKKW
Sbjct  1097  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGGSADRVKKKW  1156

Query  578   WG  583
             WG
Sbjct  1157  WG  1158



>ref|XP_008389065.1| PREDICTED: myosin-1-like [Malus domestica]
Length=1175

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  986   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSGRNS  1045

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD++ +WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQVFGDDAKFLV
Sbjct  1046  DASVNASDDRDQSWDTGSNHRGQDSNGVRPLSAGLSVISRLTEEFDQRSQVFGDDAKFLV  1105

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS-DKMKKKW  577
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETK+I HK+G+EEG S D++KKKW
Sbjct  1106  EVKSGKVEASLNPDQELRRLKQMFEAWKKDYGARLRETKLIMHKIGNEEGGSADRVKKKW  1165

Query  578   WG  583
             WG
Sbjct  1166  WG  1167



>gb|KJB31872.1| hypothetical protein B456_005G212100 [Gossypium raimondii]
Length=1147

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DD+ RNS
Sbjct  956   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDTERNS  1015

Query  221   DASVN-ASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFL  397
             DASVN ASDD+E +WD G N    E+NG+RP  AGLSVI +LAEEFEQRSQVFGDDAKFL
Sbjct  1016  DASVNNASDDREYSWDTGTNHKGPESNGLRPTSAGLSVISRLAEEFEQRSQVFGDDAKFL  1075

Query  398   VEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKW  577
             VEVKSG  EANLNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+EEGA D++KKKW
Sbjct  1076  VEVKSGQVEANLNPDRELRRLKQMFETWKKDYAARLRETKVVLNKLGNEEGALDRVKKKW  1135

Query  578   WG  583
             WG
Sbjct  1136  WG  1137



>ref|XP_008340434.1| PREDICTED: myosin-1 isoform X2 [Malus domestica]
Length=1165

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  976   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1035

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+E  WD G+N    ++NGVRP+ AGLSVI +L EEF+QRSQVFGDDAKFLV
Sbjct  1036  DASVNASDDREYGWDTGSNHRGQDSNGVRPMSAGLSVISRLTEEFDQRSQVFGDDAKFLV  1095

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS-DKMKKKW  577
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HK+G+EEG S D++KKKW
Sbjct  1096  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGTRLRETKVILHKIGNEEGGSADRVKKKW  1155

Query  578   WG  583
             WG
Sbjct  1156  WG  1157



>ref|XP_010103613.1| Myosin-2 heavy chain [Morus notabilis]
 gb|EXB96390.1| Myosin-2 heavy chain [Morus notabilis]
Length=1149

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  962   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1021

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNAS+D+E +WD G+++   E+NGVRP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1022  DASVNASEDREYSWDTGSHK-GQESNGVRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1080

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HKLGSEEG  D+ KKKWW
Sbjct  1081  EVKSGQVDASLNPDKELRRLKQMFEAWKKDYGGRLRETKVILHKLGSEEGPVDRAKKKWW  1140

Query  581   G  583
              
Sbjct  1141  A  1141



>ref|XP_006589741.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1059

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  871   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  930

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD++ +WD+G N    E+NG + + AGLSVI +LAEEFEQRSQVFGDD+KFLV
Sbjct  931   DASVNASDDRDFSWDVGTNHRRQESNGAKSMSAGLSVISRLAEEFEQRSQVFGDDSKFLV  990

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HKLGSE+G+ +K+KK WW
Sbjct  991   EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGSIEKVKKSWW  1050

Query  581   G  583
             G
Sbjct  1051  G  1051



>ref|XP_004147135.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus]
 ref|XP_004162042.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus]
 gb|KGN51557.1| hypothetical protein Csa_5G577960 [Cucumis sativus]
Length=1175

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQ+QMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  988   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQRQMRSLQSSLSIAKKSLAVDDSERNS  1047

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD+  +W++G+N TA E+NGVRP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1048  DASVNASDDRGYSWEVGSNNTANESNGVRPMNAGLSVISRLAEEFEQRSQVFGDDAKFLV  1107

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVI  KLG+ EGA D++KKKWW
Sbjct  1108  EVKSGQVEASLDPDRELRRLKQMFEAWKKDYGGRLRETKVILTKLGN-EGAMDRVKKKWW  1166

Query  581   G  583
             G
Sbjct  1167  G  1167



>emb|CAN82090.1| hypothetical protein VITISV_032704 [Vitis vinifera]
Length=1161

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  973   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSRRNS  1032

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +DD++S+WD G+N    E+NG+RP+ AGL+VI ++AEEFEQRSQVFGDDAKFLV
Sbjct  1033  DASVNLTDDRDSSWDTGSNFRGQESNGMRPMSAGLTVISRMAEEFEQRSQVFGDDAKFLV  1092

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG TEA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI  KLG+EEG+ DK +KKWW
Sbjct  1093  EVKSGQTEASLNPDRELRRLKQMFEAWKKDYGSRLRETKVILQKLGNEEGSGDKARKKWW  1152



>ref|XP_003536741.2| PREDICTED: myosin-1-like isoform X1 [Glycine max]
Length=1176

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  988   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  1047

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD++ +WD+G N    E+NG + + AGLSVI +LAEEFEQRSQVFGDD+KFLV
Sbjct  1048  DASVNASDDRDFSWDVGTNHRRQESNGAKSMSAGLSVISRLAEEFEQRSQVFGDDSKFLV  1107

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HKLGSE+G+ +K+KK WW
Sbjct  1108  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGSIEKVKKSWW  1167

Query  581   G  583
             G
Sbjct  1168  G  1168



>gb|KHN37364.1| Myosin-J heavy chain [Glycine soja]
Length=1176

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  988   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  1047

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD++ +WD+G N    E+NG + + AGLSVI +LAEEFEQRSQVFGDD+KFLV
Sbjct  1048  DASVNASDDRDFSWDVGTNHRRQESNGAKSMSAGLSVISRLAEEFEQRSQVFGDDSKFLV  1107

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI HKLGSE+G+ +K+KK WW
Sbjct  1108  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILHKLGSEDGSIEKVKKSWW  1167

Query  581   G  583
             G
Sbjct  1168  G  1168



>ref|XP_003592738.1| Myosin-like protein [Medicago truncatula]
 gb|AES62989.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1159

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  971   KDEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  1030

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDDKE +WD+GNN    E++G R + AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1031  DASVNASDDKEYSWDMGNNHRRQESSGTRSMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1090

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE WKKDY  RL+ETKVI +KLGSE+G+ +K KKKWW
Sbjct  1091  EVKSGQIEASLNPDRELRRLKQMFEGWKKDYAARLRETKVILNKLGSEDGSIEKAKKKWW  1150

Query  581   G  583
             G
Sbjct  1151  G  1151



>ref|XP_011012312.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1187

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL++DDS RNS
Sbjct  999   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLSVDDSGRNS  1058

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +WD G+N    ENNGVRP+ AG SVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1059  DASVNASDERDVSWDTGSNHRGQENNGVRPISAGFSVISRLAEEFEQRSQVFGDDAKFLV  1118

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+I +KLG++EGA D++KKKWW
Sbjct  1119  EVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGALDRVKKKWW  1178

Query  581   G  583
             G
Sbjct  1179  G  1179



>ref|XP_011012310.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011012311.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1198

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL++DDS RNS
Sbjct  1010  KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLSVDDSGRNS  1069

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +WD G+N    ENNGVRP+ AG SVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1070  DASVNASDERDVSWDTGSNHRGQENNGVRPISAGFSVISRLAEEFEQRSQVFGDDAKFLV  1129

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+I +KLG++EGA D++KKKWW
Sbjct  1130  EVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGALDRVKKKWW  1189

Query  581   G  583
             G
Sbjct  1190  G  1190



>gb|KHN46512.1| Myosin-J heavy chain, partial [Glycine soja]
Length=1049

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  861   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  920

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +WD+G N    E+NG R   AGLSVI +LAEEFE RSQVFGDDAKFLV
Sbjct  921   DASVNASDERDYSWDVGGNHKRQESNGARSTSAGLSVISRLAEEFEHRSQVFGDDAKFLV  980

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSE+GA +KMKKKWW
Sbjct  981   EVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGALEKMKKKWW  1040

Query  581   G  583
             G
Sbjct  1041  G  1041



>ref|XP_011012313.1| PREDICTED: myosin-1-like isoform X3 [Populus euphratica]
Length=1185

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL++DDS RNS
Sbjct  997   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLSVDDSGRNS  1056

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +WD G+N    ENNGVRP+ AG SVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1057  DASVNASDERDVSWDTGSNHRGQENNGVRPISAGFSVISRLAEEFEQRSQVFGDDAKFLV  1116

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+I +KLG++EGA D++KKKWW
Sbjct  1117  EVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGALDRVKKKWW  1176

Query  581   G  583
             G
Sbjct  1177  G  1177



>ref|XP_003533701.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006587966.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
 ref|XP_006587967.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1177

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  989   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1048

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +WD+G N    E+NG R   AGLSVI +LAEEFE RSQVFGDDAKFLV
Sbjct  1049  DASVNASDERDYSWDVGGNHKRQESNGARSTSAGLSVISRLAEEFEHRSQVFGDDAKFLV  1108

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSE+GA +KMKKKWW
Sbjct  1109  EVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGALEKMKKKWW  1168

Query  581   G  583
             G
Sbjct  1169  G  1169



>ref|XP_008221075.1| PREDICTED: myosin-1 [Prunus mume]
 ref|XP_008221076.1| PREDICTED: myosin-1 [Prunus mume]
Length=1182

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  994   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDSERNS  1053

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD + +WD G+N    ++NG RP+ AGLSVI +L EEF+QRSQVFGDDAKFLV
Sbjct  1054  DASVNASDDHDYSWDTGSNHRRQDSNGARPMSAGLSVISRLTEEFDQRSQVFGDDAKFLV  1113

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETK+I HK+G+EEG  D++KKKWW
Sbjct  1114  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKLILHKIGNEEGTVDRVKKKWW  1173

Query  581   G  583
             G
Sbjct  1174  G  1174



>ref|XP_007142760.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14754.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=1177

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQY++RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  989   KEEENDILHQRLQQYDSRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNS  1048

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +WD+G N    E+NGVR + AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1049  DASVNASDERDFSWDVGTNHRRQESNGVRSMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1108

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDY  RL+ETKVI HKLGSE+G+ DK+KK WW
Sbjct  1109  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYNARLRETKVILHKLGSEDGSIDKVKKSWW  1168

Query  581   G  583
             G
Sbjct  1169  G  1169



>gb|KJB79817.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=924

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S R+S
Sbjct  735  KEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERSS  794

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DAS+N SDD+E  WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  795  DASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  854

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+E+GA DK+KKK+W
Sbjct  855  EVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGALDKVKKKFW  914

Query  581  G  583
            G
Sbjct  915  G  915



>gb|KJB79824.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=892

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S R+S
Sbjct  704  KEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERSS  763

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            DAS+N SDD+E  WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  764  DASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  823

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
            EVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+E+GA DK+KKK+W
Sbjct  824  EVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGALDKVKKKFW  883

Query  581  G  583
            G
Sbjct  884  G  884



>ref|XP_003556592.1| PREDICTED: myosin-1-like [Glycine max]
Length=1176

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  988   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1047

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             D SVNASD+++ +WD+G N    E+NG R   AGLSVI +LAEEFE RSQVFGDDAKFLV
Sbjct  1048  DTSVNASDERDYSWDVGGNHRRQESNGARSTSAGLSVISRLAEEFEHRSQVFGDDAKFLV  1107

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSE+GA +KMKKKWW
Sbjct  1108  EVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGALEKMKKKWW  1167

Query  581   G  583
             G
Sbjct  1168  G  1168



>gb|KHM99077.1| Myosin-J heavy chain [Glycine soja]
Length=1150

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  962   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1021

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             D SVNASD+++ +WD+G N    E+NG R   AGLSVI +LAEEFE RSQVFGDDAKFLV
Sbjct  1022  DTSVNASDERDYSWDVGGNHRRQESNGARSTSAGLSVISRLAEEFEHRSQVFGDDAKFLV  1081

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLGSE+GA +KMKKKWW
Sbjct  1082  EVKSGQVEASLNPDQELRRLKQMFEAWKKDYGARLRETKVIINKLGSEDGALEKMKKKWW  1141

Query  581   G  583
             G
Sbjct  1142  G  1142



>ref|XP_007225432.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
 gb|EMJ26631.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
Length=1185

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  997   KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDSERNS  1056

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD + +WD G+N    ++NG RP+ AGLSVI +L EEF+QRSQVFGDDAKFLV
Sbjct  1057  DASVNASDDHDYSWDTGSNHRRQDSNGARPMSAGLSVISRLTEEFDQRSQVFGDDAKFLV  1116

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETK+I HK+G++EG  D++KKKWW
Sbjct  1117  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKLILHKIGNDEGTVDRVKKKWW  1176

Query  581   G  583
             G
Sbjct  1177  G  1177



>gb|KJB49958.1| hypothetical protein B456_008G147000 [Gossypium raimondii]
Length=1152

 Score =   266 bits (679),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQ+LQQYE+RWSEYE+KMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S RNS
Sbjct  964   KEEENDILHQQLQQYESRWSEYEVKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERNS  1023

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN SD++E  WD G+N    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1024  DASVNTSDEREYCWDTGSNHKGPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1083

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDY VRL+ETKV+ +KLG+EEGA D++KKKWW
Sbjct  1084  EVKSGQGEASLNPDRELRRLKQMFETWKKDYAVRLRETKVVLNKLGNEEGALDRVKKKWW  1143

Query  581   G  583
             G
Sbjct  1144  G  1144



>ref|XP_002310637.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
 gb|EEE91087.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
Length=1174

 Score =   265 bits (678),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEE+WQKQMRSLQSSLSIAKKSL++DDS RNS
Sbjct  986   KEEENDILHQRLQQYESRWSEYELKMKSMEEMWQKQMRSLQSSLSIAKKSLSVDDSERNS  1045

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNAS++++ +WD G+N    ENNGVRP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1046  DASVNASEERDFSWDTGSNHRGQENNGVRPISAGLSVISRLAEEFEQRSQVFGDDAKFLV  1105

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A++N D ELRRLK MFE+WKKDYG RL+ETK+I +KLG++EGA D++KKKWW
Sbjct  1106  EVKSGQVDASMNADRELRRLKQMFEAWKKDYGSRLRETKLILNKLGTDEGALDRVKKKWW  1165

Query  581   G  583
             G
Sbjct  1166  G  1166



>gb|KDP37497.1| hypothetical protein JCGZ_05936 [Jatropha curcas]
Length=923

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 165/184 (90%), Gaps = 3/184 (2%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  732  KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  791

Query  221  DASVNA-SDDKESTWDIGNNRTALENNG--VRPVRAGLSVIGQLAEEFEQRSQVFGDDAK  391
            DASVNA SD+++ +WD G+N    E+NG  V+P+ AGLSVI +LAEEFEQRSQVFGDDAK
Sbjct  792  DASVNAPSDERDYSWDTGSNNRGQESNGHGVKPMSAGLSVISRLAEEFEQRSQVFGDDAK  851

Query  392  FLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKK  571
            FLVEVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KLG+EEGA D++KK
Sbjct  852  FLVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVILNKLGNEEGALDRVKK  911

Query  572  KWWG  583
            KWWG
Sbjct  912  KWWG  915



>ref|XP_002523758.1| myosin vIII, putative [Ricinus communis]
 gb|EEF38607.1| myosin vIII, putative [Ricinus communis]
Length=1181

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 164/183 (90%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  993   KEEENDILQQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1052

Query  221   DASVNASDDKESTWDIGNNRTALENNG--VRPVRAGLSVIGQLAEEFEQRSQVFGDDAKF  394
             DASVNASD+++  WD GNN    E+NG  VRP+ AGLSVI +LAEEFEQRSQVFGDDAKF
Sbjct  1053  DASVNASDERD--WDTGNNYRGQESNGHSVRPMSAGLSVISRLAEEFEQRSQVFGDDAKF  1110

Query  395   LVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKK  574
             LVEVKSG  EA+LNPD ELRRLK MFE+WKKDYGVRL+ETKVI +KLG+EEGA D++KKK
Sbjct  1111  LVEVKSGQVEASLNPDRELRRLKQMFEAWKKDYGVRLRETKVILNKLGNEEGALDRVKKK  1170

Query  575   WWG  583
             WWG
Sbjct  1171  WWG  1173



>gb|KJB79823.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1151

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S R+S
Sbjct  963   KEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERSS  1022

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DAS+N SDD+E  WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1023  DASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1082

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+E+GA DK+KKK+W
Sbjct  1083  EVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGALDKVKKKFW  1142

Query  581   G  583
             G
Sbjct  1143  G  1143



>gb|KJB79819.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1175

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S R+S
Sbjct  986   KEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERSS  1045

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DAS+N SDD+E  WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1046  DASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1105

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+E+GA DK+KKK+W
Sbjct  1106  EVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGALDKVKKKFW  1165

Query  581   G  583
             G
Sbjct  1166  G  1166



>gb|KJB79818.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
 gb|KJB79820.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1176

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S R+S
Sbjct  987   KEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERSS  1046

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DAS+N SDD+E  WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1047  DASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1106

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+E+GA DK+KKK+W
Sbjct  1107  EVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGALDKVKKKFW  1166

Query  581   G  583
             G
Sbjct  1167  G  1167



>gb|KJB79822.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1198

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S R+S
Sbjct  986   KEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERSS  1045

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DAS+N SDD+E  WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1046  DASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1105

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+E+GA DK+KKK+W
Sbjct  1106  EVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGALDKVKKKFW  1165

Query  581   G  583
             G
Sbjct  1166  G  1166



>gb|KJB79821.1| hypothetical protein B456_013G068300 [Gossypium raimondii]
Length=1199

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRL QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+D+S R+S
Sbjct  987   KEEENDILHQRLLQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDESERSS  1046

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DAS+N SDD+E  WD GNN    E+NG+RP+ AGLSVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1047  DASINTSDDREYCWDTGNNLKVPESNGLRPMSAGLSVISRLAEEFEQRSQVFGDDAKFLV  1106

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  +A+LNPD ELRRLK MFE+WKKDY  RL+ETKV+ +KLG+E+GA DK+KKK+W
Sbjct  1107  EVKSGQVDASLNPDRELRRLKQMFETWKKDYATRLRETKVVLNKLGNEDGALDKVKKKFW  1166

Query  581   G  583
             G
Sbjct  1167  G  1167



>ref|XP_004297721.1| PREDICTED: myosin-1-like [Fragaria vesca subsp. vesca]
Length=1168

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  980   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1039

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASDD++ +WD G+N    ++NG RP+ AGLSVI +L EEF+QRSQVF DDAKFLV
Sbjct  1040  DASVNASDDRDYSWDTGSNHRGQDSNGGRPMSAGLSVISRLTEEFDQRSQVFADDAKFLV  1099

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFE+WKKDYG RL+ETKV+  KLG+EEG  D+ KKKWW
Sbjct  1100  EVKSGQVEASLNPDRELRRLKQMFEAWKKDYGARLRETKVVLTKLGNEEGNIDRAKKKWW  1159

Query  581   G  583
             G
Sbjct  1160  G  1160



>ref|XP_007153036.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 ref|XP_007153037.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25030.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25031.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
Length=1194

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K++ENDI+ QRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  1006  KEDENDIIRQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1065

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +WD+G N    E+NG R   AGLSVI +LAEEFE RSQVFGDDAKFLV
Sbjct  1066  DASVNASDERDYSWDVGGNHRRQESNGARSTSAGLSVISRLAEEFEHRSQVFGDDAKFLV  1125

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVI +KLG+E+GA +KMKKKWW
Sbjct  1126  EVKSGQVEASLSPDQELRRLKQMFEAWKKDYGTRLRETKVILNKLGNEDGALEKMKKKWW  1185

Query  581   G  583
             G
Sbjct  1186  G  1186



>ref|XP_003589756.1| LRR receptor-like protein kinase [Medicago truncatula]
Length=671

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            KDEENDIL+QR+QQYENRWSEYELKMKSME+VWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  482  KDEENDILNQRIQQYENRWSEYELKMKSMEDVWQKQMRSLQSSLSIAKKSLAIDDSDRNS  541

Query  221  DASVN-ASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFL  397
            DASVN ASD+++ +WD G+N    E+NG R   A LSVI +LAEEFEQRSQVFGDDAKFL
Sbjct  542  DASVNNASDERDYSWDAGSNHRRQESNGTRSTSASLSVISRLAEEFEQRSQVFGDDAKFL  601

Query  398  VEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKW  577
            VEVKSG  EA+LNPD ELRRLK MFE+WK+DYG RL+ETK+I +KLG+E+ A +KMKKKW
Sbjct  602  VEVKSGQAEASLNPDQELRRLKQMFEAWKRDYGARLRETKLIINKLGTEDSALEKMKKKW  661

Query  578  WG  583
            WG
Sbjct  662  WG  663



>ref|XP_004498109.1| PREDICTED: myosin-J heavy chain-like [Cicer arietinum]
Length=1174

 Score =   257 bits (656),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL+QR+QQYE+RWSEYELKM+SMEEVWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  986   KEEENDILNQRIQQYESRWSEYELKMQSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNS  1045

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD+++ +W++G+N    E+NG R   A LSVI +LAEEFEQRSQVF DDAKFLV
Sbjct  1046  DASVNASDERDYSWEVGSNHRRQESNGTRSTSASLSVISRLAEEFEQRSQVFSDDAKFLV  1105

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             EVKSG  EA+LNPD ELRRLK MFESWK+DYG RL+ETK+I +KLGSE+GA +KMKKKWW
Sbjct  1106  EVKSGQAEASLNPDQELRRLKQMFESWKRDYGARLRETKLIINKLGSEDGALEKMKKKWW  1165

Query  581   G  583
             G
Sbjct  1166  G  1166



>ref|XP_011070461.1| PREDICTED: myosin-1 [Sesamum indicum]
Length=1163

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKM+SMEEVWQKQMRSLQSSLSIAKKSLALDDS RNS
Sbjct  974   KEEENDILHQRLQQYENRWSEYELKMRSMEEVWQKQMRSLQSSLSIAKKSLALDDSQRNS  1033

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVN +D+KE++W+  NN    ENN  R + AG+SVI +LAEEFEQRSQVFGDDAKFLV
Sbjct  1034  DASVNGNDEKETSWETHNNFRLHENNRGRSMSAGISVITRLAEEFEQRSQVFGDDAKFLV  1093

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS-DKMKKKW  577
             EVKSG  EA+L+PD ELRRLK MFE+WKKDYG RL+ETKVI +KLG+EEG+S DK++KKW
Sbjct  1094  EVKSGQAEASLDPDSELRRLKQMFEAWKKDYGARLRETKVILNKLGNEEGSSADKVRKKW  1153

Query  578   WG  583
             WG
Sbjct  1154  WG  1155



>gb|KEH40947.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1169

 Score =   254 bits (648),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEENDIL+QR+QQYENRWSEYELKMKSME+VWQKQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  980   KDEENDILNQRIQQYENRWSEYELKMKSMEDVWQKQMRSLQSSLSIAKKSLAIDDSDRNS  1039

Query  221   DASVN-ASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFL  397
             DASVN ASD+++ +WD G+N    E+NG R   A LSVI +LAEEFEQRSQVFGDDAKFL
Sbjct  1040  DASVNNASDERDYSWDAGSNHRRQESNGTRSTSASLSVISRLAEEFEQRSQVFGDDAKFL  1099

Query  398   VEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKW  577
             VEVKSG  EA+LNPD ELRRLK MFE+WK+DYG RL+ETK+I +KLG+E+ A +KMKKKW
Sbjct  1100  VEVKSGQAEASLNPDQELRRLKQMFEAWKRDYGARLRETKLIINKLGTEDSALEKMKKKW  1159

Query  578   WG  583
             WG
Sbjct  1160  WG  1161



>gb|AAB71526.1| unconventional myosin [Helianthus annuus]
Length=1120

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 155/184 (84%), Gaps = 5/184 (3%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL+ DDS RNS
Sbjct  931   KEEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLSYDDSERNS  990

Query  221   DASVN-ASDDKESTWDIGNN--RTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAK  391
             DAS+N A+D+    WD   N  R  +EN  VRP+ AGLSVI +LAEEFEQRSQVFGDDAK
Sbjct  991   DASINTANDETNPPWDAATNGRRNGVEN--VRPMSAGLSVISRLAEEFEQRSQVFGDDAK  1048

Query  392   FLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKK  571
             FLVEVKSG  EANLNPDHELRRLK MFE WKKDY  RL+ETKVI +KLG E+G  +K KK
Sbjct  1049  FLVEVKSGQVEANLNPDHELRRLKQMFEGWKKDYTARLRETKVILNKLGHEDGDGEKGKK  1108

Query  572   KWWG  583
             KWWG
Sbjct  1109  KWWG  1112



>ref|XP_010688651.1| PREDICTED: myosin-1-like [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   251 bits (641),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 160/182 (88%), Gaps = 2/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN+ILHQRL+QYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLA+DDSARNS
Sbjct  988   KEEENEILHQRLRQYENRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDSARNS  1047

Query  221   DASVNASDDKESTWDIGNNRT--ALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKF  394
             DASVNAS+++E + D G N T  + E+NGVRP+ A LSVI ++AEEFEQR QVFGDDAKF
Sbjct  1048  DASVNASEEREYSGDTGGNITLRSHESNGVRPMSASLSVISRMAEEFEQRKQVFGDDAKF  1107

Query  395   LVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKK  574
             LVEVKSG  +A+LNPD ELRRLK MFE+WKKDYG RL+ETKVI +KL +EE   +K+KKK
Sbjct  1108  LVEVKSGQVDASLNPDRELRRLKQMFETWKKDYGTRLRETKVILNKLDNEEKVGEKLKKK  1167

Query  575   WW  580
             WW
Sbjct  1168  WW  1169



>ref|XP_010279450.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1327

 Score =   250 bits (638),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 161/190 (85%), Gaps = 9/190 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQM SLQSSLSIAKKSL +DD+ R S
Sbjct  1130  KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMSSLQSSLSIAKKSLVIDDAERKS  1189

Query  221   DASVNASDDKESTWDIGNNRT-ALENNGVRP--------VRAGLSVIGQLAEEFEQRSQV  373
             DASVNA+DD+E  WD+GNN +   ENNG+RP        + AGLSVI +LAEEFEQRSQV
Sbjct  1190  DASVNATDDREHNWDLGNNNSKGQENNGLRPGPQILDREMSAGLSVISRLAEEFEQRSQV  1249

Query  374   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGA  553
             FGDDAKFLVEVKSG  EA++NPD ELRRLK +FE+WKKDYG RL+ETKVI HKLG+  G+
Sbjct  1250  FGDDAKFLVEVKSGQAEASINPDRELRRLKQIFEAWKKDYGARLRETKVILHKLGNGAGS  1309

Query  554   SDKMKKKWWG  583
             ++K +KKWWG
Sbjct  1310  AEKGRKKWWG  1319



>ref|XP_010249396.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1280

 Score =   245 bits (625),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 9/190 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYELKMKSMEEVWQKQMRSLQSSLS+A+KSLA+DD+ R+S
Sbjct  1083  KEEENDILHQRLQQYESRWSEYELKMKSMEEVWQKQMRSLQSSLSVARKSLAVDDTERSS  1142

Query  221   DASVNASDDKESTWDIGNNRT-ALENNGVR--------PVRAGLSVIGQLAEEFEQRSQV  373
              +SV  + D+  +WD+G+N     EN+G+R         + AGLSVI +LAEEFEQRSQV
Sbjct  1143  GSSVTVAHDRAYSWDLGSNSNKGRENSGLRLGSRFLEREMSAGLSVISRLAEEFEQRSQV  1202

Query  374   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGA  553
             FGDDAKFLVEVKSG  EA+LNPD ELRRLK +FE+WKKDYG RL+ETKVI HKLGSEEG 
Sbjct  1203  FGDDAKFLVEVKSGQAEASLNPDQELRRLKQIFEAWKKDYGARLRETKVILHKLGSEEGN  1262

Query  554   SDKMKKKWWG  583
             ++K KKKWWG
Sbjct  1263  NEKAKKKWWG  1272



>ref|XP_002883217.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59476.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
Length=1166

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 160/188 (85%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  974   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1033

Query  221   DASVNASDDKESTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1034  DASVNASDATD--WDSSSNQFRSQTSNGGGPRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1091

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
             AKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1092  AKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1151

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1152  KVKRKWWG  1159



>ref|XP_010487954.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 159/188 (85%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  976   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1035

Query  221   DASVNASDDKESTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1036  DASVNASDATD--WDSSSNQFRSQTSNGGGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1093

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
              KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1094  VKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1153

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1154  KVKRKWWG  1161



>ref|XP_006296853.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
 gb|EOA29751.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
Length=1182

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 159/188 (85%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  990   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1049

Query  221   DASVNASDDKESTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1050  DASVNASDATD--WDSSSNQFRSQTSNGGGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1107

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
              KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1108  VKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1167

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1168  KVKRKWWG  1175



>ref|XP_010466165.1| PREDICTED: myosin-1 [Camelina sativa]
Length=1166

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 159/188 (85%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  974   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1033

Query  221   DASVNASDDKESTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1034  DASVNASDATD--WDSSSNQFRSQASNGGGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1091

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
              KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1092  VKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1151

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1152  KVKRKWWG  1159



>ref|XP_010508266.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508273.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508281.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508289.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 159/188 (85%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  976   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1035

Query  221   DASVNASDDKESTWDIGNN--RTALENNG---VRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N  R+   N G   ++P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1036  DASVNASDATD--WDSSSNQFRSQTSNGGGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1093

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
              KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1094  VKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1153

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1154  KVKRKWWG  1161



>ref|XP_006406435.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
 gb|ESQ47888.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
Length=1205

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 159/189 (84%), Gaps = 10/189 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  1012  KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1071

Query  221   DASVNASDDKESTWDIGNN--RTALENNG----VRPVRAGLSVIGQLAEEFEQRSQVFGD  382
             DASVNASD  +  WD  +N  R+   N G     +P+ AGLSVIG+LAEEFEQR+QVFGD
Sbjct  1072  DASVNASDATD--WDSSSNHFRSQTSNGGGSRQQQPMSAGLSVIGRLAEEFEQRAQVFGD  1129

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS--  556
             DAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEEG+   
Sbjct  1130  DAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEEGSGSM  1189

Query  557   DKMKKKWWG  583
             +K+K+KWWG
Sbjct  1190  EKVKRKWWG  1198



>ref|NP_188630.1| myosin 1 [Arabidopsis thaliana]
 sp|Q9LHE9.1|MYO1_ARATH RecName: Full=Myosin-1; AltName: Full=AtATM1 [Arabidopsis thaliana]
 dbj|BAB03161.1| myosin-like protein [Arabidopsis thaliana]
 gb|AAN71940.1| putative myosin [Arabidopsis thaliana]
 gb|AEE76312.1| myosin 1 [Arabidopsis thaliana]
Length=1166

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  974   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1033

Query  221   DASVNASDDKESTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1034  DASVNASDATD--WDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1091

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
             AKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1092  AKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1151

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1152  KVKRKWWG  1159



>gb|AAM14075.1| putative myosin [Arabidopsis thaliana]
Length=1166

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  974   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1033

Query  221   DASVNASDDKESTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1034  DASVNASDATD--WDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1091

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
             AKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1092  AKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1151

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1152  KVKRKWWG  1159



>emb|CAB61875.1| myosin [Arabidopsis thaliana]
Length=1166

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  974   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1033

Query  221   DASVNASDDKESTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1034  DASVNASDATD--WDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1091

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
             AKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1092  AKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1151

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1152  KVKRKWWG  1159



>ref|NP_001154628.2| myosin 1 [Arabidopsis thaliana]
 gb|AEE76313.1| myosin 1 [Arabidopsis thaliana]
Length=1176

 Score =   240 bits (613),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  984   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1043

Query  221   DASVNASDDKESTWDIGNNRT-ALENNGV----RPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVNASD  +  WD  +N+  +  +NGV    +P+ AGLSVIG+LAEEFEQR+QVFGDD
Sbjct  1044  DASVNASDATD--WDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDD  1101

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASD  559
             AKFLVEVKSG  EANL+PD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +
Sbjct  1102  AKFLVEVKSGQVEANLDPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSME  1161

Query  560   KMKKKWWG  583
             K+K+KWWG
Sbjct  1162  KVKRKWWG  1169



>ref|XP_009135657.1| PREDICTED: myosin-1-like [Brassica rapa]
Length=1136

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 157/187 (84%), Gaps = 8/187 (4%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  945   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1004

Query  221   DASVNASDDKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
             DASVNASD  +  WD  +N+       +    RP+ AGLSVIG+LAEEFEQR+QVFGDDA
Sbjct  1005  DASVNASDATD--WDSSSNQFKGGGGRQQQQQRPMSAGLSVIGRLAEEFEQRAQVFGDDA  1062

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDK  562
             KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +K
Sbjct  1063  KFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGSEESGGSMEK  1122

Query  563   MKKKWWG  583
             +K+KWWG
Sbjct  1123  VKRKWWG  1129



>emb|CDX82270.1| BnaA03g35510D [Brassica napus]
Length=1196

 Score =   238 bits (607),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 157/187 (84%), Gaps = 8/187 (4%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  1005  KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1064

Query  221   DASVNASDDKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
             DASVNASD  +  WD  +N+       +    RP+ AGLSVIG+LAEEFEQR+QVFGDDA
Sbjct  1065  DASVNASDATD--WDSSSNQFKGGGGRQQQQQRPMSAGLSVIGRLAEEFEQRAQVFGDDA  1122

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDK  562
             KFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+ +K
Sbjct  1123  KFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGSEESGGSMEK  1182

Query  563   MKKKWWG  583
             +K+KWWG
Sbjct  1183  VKRKWWG  1189



>ref|XP_010523208.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1176

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 154/185 (83%), Gaps = 6/185 (3%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla-lDDSARN  217
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAK+SL   +DS RN
Sbjct  986   KEEENDILKQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKRSLGGANDSERN  1045

Query  218   SDASVNASDDKESTWD-IGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKF  394
             SDASVNASD  +  WD  GN R+   N G RP+ AGLSVI +LAEEFEQR+QVFGDDAKF
Sbjct  1046  SDASVNASDGTD--WDSAGNFRSQTSNGGTRPMSAGLSVISRLAEEFEQRAQVFGDDAKF  1103

Query  395   LVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMK  568
             LVEVKSG  EANL PD ELRRLK MFE WKKDYG RL+ETKVI +KLG++E  G+ +++K
Sbjct  1104  LVEVKSGQVEANLYPDRELRRLKEMFEKWKKDYGTRLRETKVILNKLGNDESGGSLERVK  1163

Query  569   KKWWG  583
             +KWWG
Sbjct  1164  RKWWG  1168



>emb|CDY36068.1| BnaC03g41300D [Brassica napus]
Length=1133

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 158/193 (82%), Gaps = 17/193 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA+++SARNS
Sbjct  939   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVENSARNS  998

Query  221   DASVNASDDKESTWDIGNNRTALENN----------GVRPVRAGLSVIGQLAEEFEQRSQ  370
             DASVNASD     WD G+N+   + +            RP+ AGLSVIG+LAEEFEQR+Q
Sbjct  999   DASVNASD-----WDSGSNQLKSQTSKGGGGERQQQQQRPMSAGLSVIGRLAEEFEQRAQ  1053

Query  371   VFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE-  547
             VFGDDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE 
Sbjct  1054  VFGDDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGSEES  1113

Query  548   -GASDKMKKKWWG  583
              G+ +K+K+KWWG
Sbjct  1114  GGSMEKVKRKWWG  1126



>ref|XP_010557555.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
 ref|XP_010557556.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1171

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAK+ LA DDS RNS
Sbjct  981   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKRGLAADDSERNS  1040

Query  221   DASVNASDDKESTWDIGNNRTALENNG--VRPVRAGLSVIGQLAEEFEQRSQVFGDDAKF  394
             DASVNASD  +   D  +N  A  +NG   RP+ AGLSVIG++AEEF QRSQVF DDAKF
Sbjct  1041  DASVNASDGTD--LDSASNFRAQTSNGGGTRPMSAGLSVIGRMAEEFGQRSQVFSDDAKF  1098

Query  395   LVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS--DKMK  568
             LVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLG+EE  S  +K+K
Sbjct  1099  LVEVKSGQVEANLNPDMELRRLKQMFEAWKKDYGARLRETKLILGKLGNEESGSSVEKVK  1158

Query  569   KKWWG  583
             +KWWG
Sbjct  1159  RKWWG  1163



>emb|CDY25361.1| BnaA05g19230D [Brassica napus]
Length=1549

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 157/190 (83%), Gaps = 11/190 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  1355  KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1414

Query  221   DASVNASDDKESTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEEFEQRSQVFG  379
             DASVNASD  +  WD  +N+   + +          P+ AGLSVIG+LAEEFEQR+QVFG
Sbjct  1415  DASVNASDATD--WDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEEFEQRAQVFG  1472

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GA  553
             DDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+
Sbjct  1473  DDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGSEESSGS  1532

Query  554   SDKMKKKWWG  583
              +K+K+KWWG
Sbjct  1533  MEKVKRKWWG  1542


 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 110/132 (83%), Gaps = 9/132 (7%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  965   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1024

Query  221   DASVNASDDKESTWDIGNNRTALENNG-------VRPVRAGLSVIGQLAEEFEQRSQVFG  379
             DASVNASD  +  WD  +N+   + +         +P+ AGLSVIG+LAEEFEQR+QVFG
Sbjct  1025  DASVNASDATD--WDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEEFEQRAQVFG  1082

Query  380   DDAKFLVEVKSG  415
             DDAKFLVEVKSG
Sbjct  1083  DDAKFLVEVKSG  1094



>emb|CDY24591.1| BnaC05g32750D [Brassica napus]
Length=1159

 Score =   235 bits (599),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 157/190 (83%), Gaps = 11/190 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA++DSARNS
Sbjct  965   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNS  1024

Query  221   DASVNASDDKESTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEEFEQRSQVFG  379
             DASVNASD  +  WD  +N+   + +          P+ AGLSVIG+LAEEFEQR+QVFG
Sbjct  1025  DASVNASDATD--WDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEEFEQRAQVFG  1082

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GA  553
             DDAKFLVEVKSG  EANLNP+ ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+
Sbjct  1083  DDAKFLVEVKSGQVEANLNPERELRRLKQMFETWKKDYGGRLRETKMILSKLGSEESGGS  1142

Query  554   SDKMKKKWWG  583
              +K+K+KWWG
Sbjct  1143  MEKVKRKWWG  1152



>ref|XP_009145709.1| PREDICTED: myosin-1 isoform X2 [Brassica rapa]
Length=1146

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 155/190 (82%), Gaps = 11/190 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA +DSAR S
Sbjct  952   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAFEDSARYS  1011

Query  221   DASVNASDDKESTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEEFEQRSQVFG  379
             DASVNASD  +  WD  +N+   + +          P+ AGLSVIG+LAEEFEQR+QVFG
Sbjct  1012  DASVNASDATD--WDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEEFEQRAQVFG  1069

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GA  553
             DDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+
Sbjct  1070  DDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGSEESSGS  1129

Query  554   SDKMKKKWWG  583
              +K+K+KWWG
Sbjct  1130  MEKVKRKWWG  1139



>ref|XP_009145706.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
 ref|XP_009145708.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
Length=1180

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 155/190 (82%), Gaps = 11/190 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQYENRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSLA +DSAR S
Sbjct  986   KEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAFEDSARYS  1045

Query  221   DASVNASDDKESTWDIGNNRTALENNGVR-------PVRAGLSVIGQLAEEFEQRSQVFG  379
             DASVNASD  +  WD  +N+   + +          P+ AGLSVIG+LAEEFEQR+QVFG
Sbjct  1046  DASVNASDATD--WDSSSNQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEEFEQRAQVFG  1103

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GA  553
             DDAKFLVEVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+
Sbjct  1104  DDAKFLVEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKMILSKLGSEESSGS  1163

Query  554   SDKMKKKWWG  583
              +K+K+KWWG
Sbjct  1164  MEKVKRKWWG  1173



>ref|XP_006306608.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
 gb|EOA39506.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
Length=1192

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL ++DSARNS
Sbjct  1005  KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNS  1064

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  +   D G N   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1065  DASVNASDGTD--LDSGGNHFQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLM  1122

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+++K+K K
Sbjct  1123  EVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKVKMK  1182

Query  575   WWG  583
             WWG
Sbjct  1183  WWG  1185



>ref|XP_002891568.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67827.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
Length=1153

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQ+QM+SLQSSLSIAKKSL +DDSARNS
Sbjct  966   KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQRQMKSLQSSLSIAKKSLEVDDSARNS  1025

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  +   D G +   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1026  DASVNASDATD--LDSGGSHYQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLM  1083

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+++K+K K
Sbjct  1084  EVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKVKMK  1143

Query  575   WWG  583
             WWG
Sbjct  1144  WWG  1146



>gb|EYU39409.1| hypothetical protein MIMGU_mgv1a000419mg [Erythranthe guttata]
Length=1168

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 7/188 (4%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD-SARN  217
             K+EENDILHQRLQQY+NRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSL+ DD S RN
Sbjct  973   KEEENDILHQRLQQYDNRWSEYELKMKSMEEVWQKQMRSLQSSLSIAKKSLSFDDNSHRN  1032

Query  218   SDASVNASDDK---ESTWDIGNN-RTALENNGVRPVRA-GLSVIGQLAEEFEQRSQVFGD  382
             SDASVN ++D+    S+WD G   R    +NG R   + GL+VI +LA+EFEQRSQ+FGD
Sbjct  1033  SDASVNGNNDERDSSSSWDTGGILRIHQSSNGGRSAASPGLTVISRLAQEFEQRSQIFGD  1092

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS-D  559
             DAKFLVEVKSG TEA+L+PD ELRRLK MFE WKKDYG RL+ETK+I +KLGSE G+S  
Sbjct  1093  DAKFLVEVKSGQTEASLDPDRELRRLKQMFEGWKKDYGSRLRETKLILNKLGSENGSSAG  1152

Query  560   KMKKKWWG  583
             K + KWWG
Sbjct  1153  KPRNKWWG  1160



>gb|EYU35564.1| hypothetical protein MIMGU_mgv1a000458mg [Erythranthe guttata]
Length=1138

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 149/185 (81%), Gaps = 11/185 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakksla--lDDSAR  214
             K+EEN+IL QRLQQYENRWSEYELKM SME+VWQKQMRSLQSSLSIAKKSLA   D S R
Sbjct  953   KEEENEILSQRLQQYENRWSEYELKMNSMEQVWQKQMRSLQSSLSIAKKSLAFESDYSQR  1012

Query  215   NSDASVNASDDKEST-WDIGNNRTALENNGVRP-VRAGLSVIGQLAEEFEQRSQVFGDDA  388
             NSDASVN +DD+EST W+      A E NGVR    AG  VIG+LAEEFEQRSQVFGDDA
Sbjct  1013  NSDASVNENDDQESTIWET----KAHEINGVRSSTSAGTGVIGRLAEEFEQRSQVFGDDA  1068

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMK  568
             KFLVEVKSG  EA L+PD ELRRLK MFE WKKDYG RL+ETKVI HKLG+EE   +  +
Sbjct  1069  KFLVEVKSGQVEAGLDPDSELRRLKQMFEGWKKDYGARLRETKVILHKLGNEE---EPTR  1125

Query  569   KKWWG  583
             KKWWG
Sbjct  1126  KKWWG  1130



>ref|XP_010500596.1| PREDICTED: myosin-3 [Camelina sativa]
Length=1154

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL ++DSARNS
Sbjct  967   KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNS  1026

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  +   D G +   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1027  DASVNASDGTD--LDSGGSHFQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLM  1084

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNPD ELRRLK MF++WKKDYG RL+ETK+I  KLGSEE  G+++K+K K
Sbjct  1085  EVKSGQVEANLNPDRELRRLKQMFDTWKKDYGGRLRETKLILSKLGSEETGGSAEKVKMK  1144

Query  575   WWG  583
             WWG
Sbjct  1145  WWG  1147



>gb|EPS68761.1| hypothetical protein M569_06006, partial [Genlisea aurea]
Length=1053

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 7/186 (4%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY++RWSEYELKMKSMEE+WQKQMRSLQSSLSIAK+SLA DDS RNS
Sbjct  863   KEEENDILFQRLQQYDSRWSEYELKMKSMEEIWQKQMRSLQSSLSIAKRSLAFDDSHRNS  922

Query  221   DASVNASDDKESTWDIGNN--RTALENNGVRP---VRAGLSVIGQLAEEFEQRSQVFGDD  385
             DASVN   ++ES W+ G+N  RT  E+NG R       G+SVI +LA+EF+QRSQVFGDD
Sbjct  923   DASVNGGGNEES-WETGSNPARTQ-ESNGARTSGGGGTGISVISRLAQEFDQRSQVFGDD  980

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKM  565
             AKFLVEVKSG  EA+L+PD ELRRLKHMFE+WKKDYG RL+ETK+I  K+G+++ + ++ 
Sbjct  981   AKFLVEVKSGQVEASLDPDQELRRLKHMFEAWKKDYGSRLRETKMILSKIGNDDSSGERG  1040

Query  566   KKKWWG  583
             +KKWWG
Sbjct  1041  RKKWWG  1046



>dbj|BAD93813.1| myosin [Arabidopsis thaliana]
 dbj|BAD94158.1| myosin [Arabidopsis thaliana]
 dbj|BAD94177.1| myosin [Arabidopsis thaliana]
Length=1153

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QR+QQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL ++DSARNS
Sbjct  966   KEEENDILRQRVQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNS  1025

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  +   D G +   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1026  DASVNASDATD--LDSGGSHYQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLM  1083

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+++K+K  
Sbjct  1084  EVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKVKMN  1143

Query  575   WWG  583
             WWG
Sbjct  1144  WWG  1146



>ref|NP_175453.2| myosin VIIIA [Arabidopsis thaliana]
 sp|F4I507.1|MYO3_ARATH RecName: Full=Myosin-3; AltName: Full=Myosin VIII A; Short=AtVIIIA 
[Arabidopsis thaliana]
 gb|AEE32540.1| myosin VIIIA [Arabidopsis thaliana]
Length=1153

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QR+QQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL ++DSARNS
Sbjct  966   KEEENDILRQRVQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNS  1025

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  +   D G +   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1026  DASVNASDATD--LDSGGSHYQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLM  1083

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+++K+K  
Sbjct  1084  EVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKVKMN  1143

Query  575   WWG  583
             WWG
Sbjct  1144  WWG  1146



>gb|AAD50052.1|AC007980_17 Highly similar to myosin [Arabidopsis thaliana]
Length=1155

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QR+QQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL ++DSARNS
Sbjct  968   KEEENDILRQRVQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNS  1027

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  +   D G +   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1028  DASVNASDATD--LDSGGSHYQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLM  1085

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+++K+K  
Sbjct  1086  EVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKVKMN  1145

Query  575   WWG  583
             WWG
Sbjct  1146  WWG  1148



>ref|XP_010479488.1| PREDICTED: myosin-3-like [Camelina sativa]
Length=1153

 Score =   221 bits (563),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 148/183 (81%), Gaps = 5/183 (3%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN IL QRLQQY+NRWSEYE KMKSMEE+WQKQM+SLQSSLSIAKKSL ++DSARNS
Sbjct  967   KEEENYILRQRLQQYDNRWSEYETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNS  1026

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD    T D G +   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1027  DASVNASD---GTVDSGGSHFQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLM  1083

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+++K+K  
Sbjct  1084  EVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKVKMN  1143

Query  575   WWG  583
             WWG
Sbjct  1144  WWG  1146



>ref|XP_006393159.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
 gb|ESQ30445.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
Length=1148

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 145/183 (79%), Gaps = 4/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL ++DSARNS
Sbjct  961   KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLEVEDSARNS  1020

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNA  D       G+ RT      V  V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1021  DASVNAFSDATDLSGSGDFRTHGRTRSVGVV--GLSVISRLAEEFGQRAQVFGDDTKFLM  1078

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EANLNP+ ELRRLK MFE+WKKDYG RLKETK+I  KLGSEE  G+ +K K K
Sbjct  1079  EVKSGQVEANLNPERELRRLKQMFETWKKDYGGRLKETKLILSKLGSEETGGSVEKPKMK  1138

Query  575   WWG  583
             WWG
Sbjct  1139  WWG  1141



>emb|CDY42506.1| BnaC06g03520D [Brassica napus]
Length=1149

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQS+LSIAKKSL ++DSARNS
Sbjct  963   KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSNLSIAKKSLEVEDSARNS  1022

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  E +   G+ RT   +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1023  DASVNASDATELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQVFGDDTKFLM  1079

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKK  574
             EVKSG  EA+L+P+ ELRRLK MF++WKKDYG RL+ETK+I  KLGS E  G+++++K K
Sbjct  1080  EVKSGQVEASLDPERELRRLKQMFDTWKKDYGGRLRETKLILGKLGSGESGGSAERVKMK  1139

Query  575   WWG  583
             WWG
Sbjct  1140  WWG  1142



>gb|ACN26349.1| unknown [Zea mays]
Length=456

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL LD++ R S
Sbjct  267  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMS  326

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            D+SV+ S +      + +    + + G R + AGLSVI +LAEEFEQRSQVF DDAKFLV
Sbjct  327  DSSVDQSWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRSQVFADDAKFLV  386

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
            EVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVI +KLG+  E + + +K+KW
Sbjct  387  EVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRMRETKVILNKLGNGNESSPNSVKRKW  446

Query  578  WG  583
            WG
Sbjct  447  WG  448



>ref|XP_009147843.1| PREDICTED: myosin-3 [Brassica rapa]
Length=1152

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 145/183 (79%), Gaps = 5/183 (3%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL ++DSARNS
Sbjct  966   KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLEVEDSARNS  1025

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  E +   G+ RT   +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1026  DASVNASDATELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQVFGDDTKFLM  1082

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI--SHKLGSEEGASDKMKKK  574
             EVKSG  EANL+P+ ELRRLK MF++WKKDYG RL+ETK+I          G+++++K K
Sbjct  1083  EVKSGQVEANLDPERELRRLKQMFDTWKKDYGGRLRETKLILGKLGSEGGGGSAERVKMK  1142

Query  575   WWG  583
             WWG
Sbjct  1143  WWG  1145



>emb|CDY22791.1| BnaA06g02860D [Brassica napus]
Length=1157

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 145/183 (79%), Gaps = 5/183 (3%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQMRSLQSSLSIAKKSL ++DSARNS
Sbjct  971   KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLEVEDSARNS  1030

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  E +   G+ RT   +   R V  GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1031  DASVNASDATELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQVFGDDTKFLM  1087

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI--SHKLGSEEGASDKMKKK  574
             EVKSG  EANL+P+ ELRRLK MF++WKKDYG RL+ETK+I          G+++++K K
Sbjct  1088  EVKSGQVEANLDPERELRRLKQMFDTWKKDYGGRLRETKLILGKLGSEGGGGSAERVKMK  1147

Query  575   WWG  583
             WWG
Sbjct  1148  WWG  1150



>ref|XP_009124542.1| PREDICTED: myosin-3-like [Brassica rapa]
 ref|XP_009124543.1| PREDICTED: myosin-3-like [Brassica rapa]
Length=1148

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 146/185 (79%), Gaps = 10/185 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE+KMKSMEE+WQKQMRSLQSSLSIAK+SL ++ S R S
Sbjct  963   KEEENDILRQRLQQYDNRWSEYEMKMKSMEEIWQKQMRSLQSSLSIAKRSLDVEGSPRYS  1022

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  + +   G+ RT   +  V     GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1023  DASVNASDASDFSVS-GDFRTPGRSGSV-----GLSVISRLAEEFGQRAQVFGDDTKFLM  1076

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE-GAS---DKMK  568
             EVKSG  EANL+P+ ELRRLK MFE+WKKDYG RL+ETK I  +LG+EE G S   +++K
Sbjct  1077  EVKSGKVEANLSPERELRRLKQMFETWKKDYGGRLRETKTILSRLGNEETGGSPLVERVK  1136

Query  569   KKWWG  583
              KWWG
Sbjct  1137  TKWWG  1141



>emb|CDY29324.1| BnaA05g15910D [Brassica napus]
Length=1148

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 146/185 (79%), Gaps = 10/185 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE+KMKSMEE+WQKQMRSLQSSLSIAK+SL ++ S R S
Sbjct  963   KEEENDILRQRLQQYDNRWSEYEMKMKSMEEIWQKQMRSLQSSLSIAKRSLDVEGSPRYS  1022

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  + +   G+ RT   +  V     GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1023  DASVNASDASDFSVS-GDFRTPGRSGSV-----GLSVISRLAEEFGQRAQVFGDDTKFLM  1076

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE-GAS---DKMK  568
             EVKSG  EANL+P+ ELRRLK MFE+WKKDYG RL+ETK I  +LG+EE G S   +++K
Sbjct  1077  EVKSGKVEANLSPERELRRLKQMFETWKKDYGGRLRETKTILSRLGNEETGGSPLVERVK  1136

Query  569   KKWWG  583
              KWWG
Sbjct  1137  TKWWG  1141



>emb|CDY53932.1| BnaCnng25790D [Brassica napus]
Length=1181

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 145/185 (78%), Gaps = 10/185 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDIL QRLQQY+NRWSEYE KMKSMEE+WQKQ+RSLQSSLSIAK+SL ++ S R S
Sbjct  996   KEEENDILRQRLQQYDNRWSEYETKMKSMEEIWQKQIRSLQSSLSIAKRSLNVEGSPRYS  1055

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             DASVNASD  + +   G+ RT   +  V     GLSVI +LAEEF QR+QVFGDD KFL+
Sbjct  1056  DASVNASDASDFSVS-GDFRTPGRSGSV-----GLSVISRLAEEFGQRAQVFGDDTKFLM  1109

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE-GAS---DKMK  568
             EVKSG  EANL+P+ ELRRLK MFE+WKKDYG RL+ETK I  +LG+EE G S   +++K
Sbjct  1110  EVKSGKVEANLSPERELRRLKQMFETWKKDYGRRLRETKTILSRLGNEETGGSPLVERVK  1169

Query  569   KKWWG  583
              KWWG
Sbjct  1170  TKWWG  1174



>ref|XP_008802972.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1166

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 145/192 (76%), Gaps = 17/192 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEND+LHQRLQQYE+RWS+YE KM+SMEEVWQKQMRSLQSSLSIAKKSLALD    NS
Sbjct  973   KDEENDMLHQRLQQYESRWSDYEQKMRSMEEVWQKQMRSLQSSLSIAKKSLALDGVDGNS  1032

Query  221   DASVNASDDKESTWDIGNNRTA---LENNGV--------RPVRAGLSVIGQLAEEFEQRS  367
             D S + S      +    N T    LEN G         R + A L++I +LAEEFEQRS
Sbjct  1033  DGSTDQS------FCTNGNLTGTEGLENKGPPLGSRLTGREMSASLNIISRLAEEFEQRS  1086

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DDAKFLVEVKSG  EA+LNPD ELR+LK  FE+W+KDY +RL+ETKVI HKLG++E
Sbjct  1087  QVFLDDAKFLVEVKSGQAEASLNPDRELRKLKQTFETWRKDYNLRLRETKVIIHKLGNDE  1146

Query  548   GASDKMKKKWWG  583
               +DK+KKKWWG
Sbjct  1147  IKADKVKKKWWG  1158



>ref|XP_010933291.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1211

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 144/191 (75%), Gaps = 17/191 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYE KM SMEEVWQKQMRSLQSSLSIAKKSLA DD+AR S
Sbjct  1018  KEEENDILHQRLQQYESRWSEYEHKMISMEEVWQKQMRSLQSSLSIAKKSLATDDAARRS  1077

Query  221   DASVNASDDKESTWDIGNNRTAL---ENNGVR--------PVRAGLSVIGQLAEEFEQRS  367
             DASV+ S      WD   N       E + VR         + AGL VI +LAEEFEQRS
Sbjct  1078  DASVDQS------WDGNGNHIGTRGREESHVRLGSRVLDRDMSAGLGVISRLAEEFEQRS  1131

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD KFLVEVKSG  EANLNP+ ELRRLK  FESWKK++ +RL+E+KV+ +KLG+++
Sbjct  1132  QVFADDVKFLVEVKSGQAEANLNPEKELRRLKQNFESWKKEFSMRLRESKVMINKLGADD  1191

Query  548   GASDKMKKKWW  580
               SDK K+KWW
Sbjct  1192  ANSDKAKRKWW  1202



>ref|XP_008664832.1| PREDICTED: myosin-1 [Zea mays]
 tpg|DAA49540.1| TPA: myosin VIII ZMM3 [Zea mays]
Length=1191

 Score =   201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL LD++ R S
Sbjct  1002  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMS  1061

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             D+SV+ S +      + +    + + G R + AGLSVI +LAEEFEQRSQVF DDAKFLV
Sbjct  1062  DSSVDQSWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRSQVFADDAKFLV  1121

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
             EVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVI +KLG+  E + + +K+KW
Sbjct  1122  EVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRMRETKVILNKLGNGNESSPNSVKRKW  1181

Query  578   WG  583
             WG
Sbjct  1182  WG  1183



>ref|XP_008797209.1| PREDICTED: LOW QUALITY PROTEIN: myosin-1-like [Phoenix dactylifera]
Length=1193

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 143/193 (74%), Gaps = 18/193 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RW EYE KM+SMEEVWQKQMRSLQSSLSIAKKSLA DD+AR S
Sbjct  999   KEEENDILHQRLQQYESRWLEYEQKMRSMEEVWQKQMRSLQSSLSIAKKSLAADDAARRS  1058

Query  221   DASVNASDDKESTWDIGNNR----------TALENNGV-RPVRAGLSVIGQLAEEFEQRS  367
             DASV+ S      WD   N           T L +  + R + AGL  I +LAEEFEQRS
Sbjct  1059  DASVDQS------WDSNGNHIGTRGREGSHTRLGSRVLDRDMSAGLGAISRLAEEFEQRS  1112

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD KFLVEVKSG  EANLNP+ ELRRLK  FESWKKD+ +RL+ETK I+HKL ++ 
Sbjct  1113  QVFADDVKFLVEVKSGQAEANLNPEKELRRLKQNFESWKKDFSMRLRETKSIAHKLEADG  1172

Query  548   GA-SDKMKKKWWG  583
              A SDK K+KWW 
Sbjct  1173  AASSDKAKRKWWA  1185



>gb|AAD31926.1|AF147738_1 myosin VIII ZMM3 [Zea mays]
Length=1099

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL LD++ R S
Sbjct  910   KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMS  969

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             D+SV+ S +      + +    + + G R + AGLSVI +LAEEFEQR+QVF DDAKFLV
Sbjct  970   DSSVDQSWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRTQVFADDAKFLV  1029

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
             EVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVI +KLG+  E + + +K+KW
Sbjct  1030  EVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRMRETKVILNKLGNGNESSPNSVKRKW  1089

Query  578   WG  583
             WG
Sbjct  1090  WG  1091



>ref|XP_010935561.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1166

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 11/189 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEND+LHQRLQQY++RWS+YE KM+SMEEVWQKQMRSLQSSLSIAKKSLALD    NS
Sbjct  973   KEEENDMLHQRLQQYDSRWSDYEQKMRSMEEVWQKQMRSLQSSLSIAKKSLALDGVDVNS  1032

Query  221   DASVNASDDKESTWDIGNNRTALENNGV--------RPVRAGLSVIGQLAEEFEQRSQVF  376
             D S++ S      +        LEN G         R + A L++I +LAEEFEQRSQVF
Sbjct  1033  DGSMDQSICTNGNY---TGTEGLENKGPSVGSRLTGREMSASLNIISRLAEEFEQRSQVF  1089

Query  377   GDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGAS  556
              DDAKFLVEVKSG  EA+LNP+ ELR+LK  FE+W+KDY +RL+ETKVI HKLG++E  +
Sbjct  1090  IDDAKFLVEVKSGQAEASLNPERELRKLKQTFETWRKDYNLRLRETKVIIHKLGNDEIKA  1149

Query  557   DKMKKKWWG  583
             DK+KKKWWG
Sbjct  1150  DKVKKKWWG  1158



>ref|XP_009406771.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1222

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 146/191 (76%), Gaps = 17/191 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYE+RWSEYE KM+SMEEVWQKQM SLQSSLS+AKKSLA+DD  R+S
Sbjct  1029  KEEENDILHQRLQQYESRWSEYEQKMRSMEEVWQKQMMSLQSSLSVAKKSLAIDDVERSS  1088

Query  221   DASVNASDDKESTWDIGNN-RT-ALENNGV---------RPVRAGLSVIGQLAEEFEQRS  367
             DASV+ S      W    + RT   E NG          R + AGLSVI +LAEEF+QR+
Sbjct  1089  DASVDHS------WGSAEHVRTKGREENGTPRLVSRVLDREMSAGLSVISRLAEEFDQRT  1142

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DDAKFLVEVKSG ++A+LNPD ELRRLK  FE WKKD+  RL+ETKVI +KLG+++
Sbjct  1143  QVFADDAKFLVEVKSGQSDASLNPDKELRRLKQNFELWKKDFSSRLRETKVIINKLGTDD  1202

Query  548   GASDKMKKKWW  580
               SDK K+KWW
Sbjct  1203  AGSDKGKRKWW  1213



>ref|XP_008812673.1| PREDICTED: myosin-1-like isoform X4 [Phoenix dactylifera]
Length=1064

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 142/191 (74%), Gaps = 17/191 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSLA DD+ R S
Sbjct  871   KEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSLATDDAERRS  930

Query  221   DASVNASDDKESTWDIGNNRTAL---ENNGVRP--------VRAGLSVIGQLAEEFEQRS  367
             DASV+ S      WD   N       E +G R         + AGL+VI  LAEEFEQ+S
Sbjct  931   DASVDQS------WDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFEQQS  984

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI +KL +++
Sbjct  985   QVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLRTDD  1044

Query  548   GASDKMKKKWW  580
               SDK K+KWW
Sbjct  1045  ANSDKAKRKWW  1055



>ref|NP_001064913.1| Os10g0488800 [Oryza sativa Japonica Group]
 dbj|BAF26827.1| Os10g0488800, partial [Oryza sativa Japonica Group]
Length=950

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            KDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  762  KDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  821

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            D+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQVF DDAKFLV
Sbjct  822  DSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQVFADDAKFLV  880

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
            EVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KLGS  E + + +K+KW
Sbjct  881  EVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNESSPNSVKRKW  940

Query  578  WG  583
            WG
Sbjct  941  WG  942



>ref|XP_008812672.1| PREDICTED: myosin-1-like isoform X3 [Phoenix dactylifera]
Length=1191

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 142/191 (74%), Gaps = 17/191 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSLA DD+ R S
Sbjct  998   KEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSLATDDAERRS  1057

Query  221   DASVNASDDKESTWDIGNNRTAL---ENNGVRP--------VRAGLSVIGQLAEEFEQRS  367
             DASV+ S      WD   N       E +G R         + AGL+VI  LAEEFEQ+S
Sbjct  1058  DASVDQS------WDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFEQQS  1111

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI +KL +++
Sbjct  1112  QVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLRTDD  1171

Query  548   GASDKMKKKWW  580
               SDK K+KWW
Sbjct  1172  ANSDKAKRKWW  1182



>gb|ABB47808.1| Myosin head family protein, expressed [Oryza sativa Japonica 
Group]
Length=995

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            KDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  807  KDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  866

Query  221  DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
            D+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQVF DDAKFLV
Sbjct  867  DSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQVFADDAKFLV  925

Query  401  EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
            EVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KLGS  E + + +K+KW
Sbjct  926  EVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNESSPNSVKRKW  985

Query  578  WG  583
            WG
Sbjct  986  WG  987



>ref|XP_008812671.1| PREDICTED: myosin-1-like isoform X2 [Phoenix dactylifera]
Length=1196

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 142/191 (74%), Gaps = 17/191 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSLA DD+ R S
Sbjct  1003  KEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSLATDDAERRS  1062

Query  221   DASVNASDDKESTWDIGNNRTAL---ENNGVRP--------VRAGLSVIGQLAEEFEQRS  367
             DASV+ S      WD   N       E +G R         + AGL+VI  LAEEFEQ+S
Sbjct  1063  DASVDQS------WDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFEQQS  1116

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI +KL +++
Sbjct  1117  QVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLRTDD  1176

Query  548   GASDKMKKKWW  580
               SDK K+KWW
Sbjct  1177  ANSDKAKRKWW  1187



>ref|XP_002467046.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
 gb|EER94044.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
Length=1196

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 12/187 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1008  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1067

Query  221   DASVNASDDKESTWDIGNNRTA-----LENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             D+SV+ S      W+   N  +     +   G R + AGLSVIG+L EEFEQRSQVF DD
Sbjct  1068  DSSVDQS------WESNGNHVSSGSQLVPRTGGREMNAGLSVIGRLNEEFEQRSQVFADD  1121

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDK  562
             AKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVI +KLG+  E + + 
Sbjct  1122  AKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFSGRIRETKVILNKLGNGNESSPNS  1181

Query  563   MKKKWWG  583
             +K+KWWG
Sbjct  1182  VKRKWWG  1188



>ref|XP_008812670.1| PREDICTED: myosin-1-like isoform X1 [Phoenix dactylifera]
Length=1197

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 142/191 (74%), Gaps = 17/191 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EENDILHQRLQQYENRWSEYE KM+SMEEVWQKQMRSLQSSLS+AKKSLA DD+ R S
Sbjct  1004  KEEENDILHQRLQQYENRWSEYEQKMRSMEEVWQKQMRSLQSSLSVAKKSLATDDAERRS  1063

Query  221   DASVNASDDKESTWDIGNNRTAL---ENNGVRP--------VRAGLSVIGQLAEEFEQRS  367
             DASV+ S      WD   N       E +G R         + AGL+VI  LAEEFEQ+S
Sbjct  1064  DASVDQS------WDSNGNHIGTKWGEESGKRVGSRVLHRDMSAGLNVISCLAEEFEQQS  1117

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD  FLVEVKSG  EA+LNP+ ELRRLK  FESWKKD+ +RL+E+KVI +KL +++
Sbjct  1118  QVFADDVNFLVEVKSGHAEASLNPEKELRRLKQNFESWKKDFSLRLRESKVIINKLRTDD  1177

Query  548   GASDKMKKKWW  580
               SDK K+KWW
Sbjct  1178  ANSDKAKRKWW  1188



>ref|XP_004982778.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Setaria italica]
Length=1194

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 144/187 (77%), Gaps = 12/187 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1006  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1065

Query  221   DASVNASDDKESTWDIGNNRTALENNGV-----RPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             D+SV+ S      W+I  N     +  V     R + AGLSVI +L EEFEQRSQVF DD
Sbjct  1066  DSSVDQS------WEINGNHVGSGSQLVPRTTGREMNAGLSVINRLTEEFEQRSQVFADD  1119

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDK  562
             A F+VEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KLGS  E + + 
Sbjct  1120  ATFIVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGGRIRETKVILNKLGSGNESSPNS  1179

Query  563   MKKKWWG  583
             +K+KWWG
Sbjct  1180  VKRKWWG  1186



>ref|XP_004982777.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Setaria italica]
Length=1233

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 144/187 (77%), Gaps = 12/187 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1045  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1104

Query  221   DASVNASDDKESTWDIGNNRTALENNGV-----RPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             D+SV+ S      W+I  N     +  V     R + AGLSVI +L EEFEQRSQVF DD
Sbjct  1105  DSSVDQS------WEINGNHVGSGSQLVPRTTGREMNAGLSVINRLTEEFEQRSQVFADD  1158

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDK  562
             A F+VEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KLGS  E + + 
Sbjct  1159  ATFIVEVKSGQADASLNPDMELRRLKQNFDSWKKDFGGRIRETKVILNKLGSGNESSPNS  1218

Query  563   MKKKWWG  583
             +K+KWWG
Sbjct  1219  VKRKWWG  1225



>gb|AAL31066.1|AC090120_12 putative myosin [Oryza sativa Japonica Group]
 gb|EEE51178.1| hypothetical protein OsJ_31968 [Oryza sativa Japonica Group]
Length=1200

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1012  KDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1071

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             D+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQVF DDAKFLV
Sbjct  1072  DSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQVFADDAKFLV  1130

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
             EVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KLGS  E + + +K+KW
Sbjct  1131  EVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNESSPNSVKRKW  1190

Query  578   WG  583
             WG
Sbjct  1191  WG  1192



>gb|AFW68522.1| hypothetical protein ZEAMMB73_631881 [Zea mays]
Length=1194

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 12/187 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN+ LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLAL ++ R S
Sbjct  1006  KEEENETLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALHETPRMS  1065

Query  221   DASVNASDDKESTWDIGNNRTA-----LENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             D+SV+ S      W+   N  +     +   G R + AGLSVIG+LAEEFEQRSQVF DD
Sbjct  1066  DSSVDQS------WESNGNHVSSGSQLVPRTGGREMSAGLSVIGRLAEEFEQRSQVFADD  1119

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDK  562
             AKFLVEVKSG  +A+LNPD ELRRLKH F+SWKKD+  R++ETK+I +KLG+  E + + 
Sbjct  1120  AKFLVEVKSGQADASLNPDMELRRLKHNFDSWKKDFSGRIRETKMILNKLGNGNESSPNS  1179

Query  563   MKKKWWG  583
             +K+KWWG
Sbjct  1180  VKRKWWG  1186



>gb|EEC67214.1| hypothetical protein OsI_34110 [Oryza sativa Indica Group]
Length=1184

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  996   KDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1055

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             D+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQVF DDAKFLV
Sbjct  1056  DSSVDQSWESNGV-HIGSASQLVPRTVGREMNASISVISRLAEEFEQRSQVFADDAKFLV  1114

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
             EVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KLGS  E + + +K+KW
Sbjct  1115  EVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNESSPNSVKRKW  1174

Query  578   WG  583
             WG
Sbjct  1175  WG  1176



>ref|XP_006661886.1| PREDICTED: myosin-1-like [Oryza brachyantha]
Length=1195

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++L QRLQQYENRWSEYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1007  KDEENEMLQQRLQQYENRWSEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1066

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLV  400
             D+SV+ S +      IG+    +     R + A +SVI +LAEEFEQRSQVF DDAKFLV
Sbjct  1067  DSSVDQSWESNGN-HIGSASQLVPRTIGREMNASISVISRLAEEFEQRSQVFADDAKFLV  1125

Query  401   EVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS-EEGASDKMKKKW  577
             EVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KLGS  E + + +K+KW
Sbjct  1126  EVKSGQADASLNPDMELRRLKQNFDSWKKDFGSRIRETKVILNKLGSGNESSPNSVKRKW  1185

Query  578   WG  583
             WG
Sbjct  1186  WG  1187



>ref|XP_003574095.1| PREDICTED: myosin-1-like [Brachypodium distachyon]
Length=1190

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 142/188 (76%), Gaps = 13/188 (7%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1001  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1060

Query  221   DASVNASDDKESTWD-----IGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
             D+SV      E +W+     +G     +     R + A +SVIG+LAEEFEQRSQVF DD
Sbjct  1061  DSSV------EQSWESNGNHVGGGSQLVPRITGREMNASISVIGRLAEEFEQRSQVFADD  1114

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL--GSEEGASD  559
             AKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+  R++ETKVI +KL  G  E + +
Sbjct  1115  AKFLVEVKSGQADASLNPDMELRRLKQNFDSWKKDFSSRIRETKVILNKLASGGNESSPN  1174

Query  560   KMKKKWWG  583
               K+KWWG
Sbjct  1175  SAKRKWWG  1182



>dbj|BAK01852.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=268

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 141/199 (71%), Gaps = 24/199 (12%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  68   KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  127

Query  221  DASVNASDDKESTWDIGNNRT-----------ALENNGVRPVRAGLSVIGQLAEEFEQRS  367
            D+SV      E +W+   N             A      R + A +SVIG+LAEE EQRS
Sbjct  128  DSSV------EQSWESNGNHVGGGSHSQQLAAAAPRITGREMNASMSVIGRLAEELEQRS  181

Query  368  QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL----  535
            QVF DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KL    
Sbjct  182  QVFADDAKFLVEVKSGQADASLNPDVELRRLKQNFDSWKKDFGSRIRETKVILNKLSSGG  241

Query  536  ---GSEEGASDKMKKKWWG  583
               G  E + +  K+KWWG
Sbjct  242  GSAGGNESSPNSAKRKWWG  260



>gb|EMT12170.1| Myosin-J heavy chain [Aegilops tauschii]
Length=1293

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 141/196 (72%), Gaps = 21/196 (11%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1096  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1155

Query  221   DASVNASDDKESTWDIGNNRT---------ALENNGVRPVRAGLSVIGQLAEEFEQRSQV  373
             D+SV      E +W+   N           A      R + A +SVIG+LAEE EQRSQV
Sbjct  1156  DSSV------EQSWESNGNHVGGGSSQQLAAAPRITGREMNASMSVIGRLAEELEQRSQV  1209

Query  374   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSE---  544
             F DDAKFLVEVKSG  +A+LNPD ELRRLK  F+SWKKD+G R++ETKVI +KL S    
Sbjct  1210  FADDAKFLVEVKSGQADASLNPDVELRRLKQNFDSWKKDFGSRIRETKVILNKLASGGGG  1269

Query  545   ---EGASDKMKKKWWG  583
                E + +  K+KWWG
Sbjct  1270  GGNESSPNSAKRKWWG  1285



>ref|XP_010918414.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1195

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 139/191 (73%), Gaps = 17/191 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN+ILHQRLQQYENRWSEYE KM SMEEVWQKQMRSLQSSLS+AKKSLA DD+ R S
Sbjct  1002  KEEENEILHQRLQQYENRWSEYEQKMSSMEEVWQKQMRSLQSSLSVAKKSLATDDAERRS  1061

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRPVR-----------AGLSVIGQLAEEFEQRS  367
             DAS++ S      WD   N  A +    R  R           +GL+VI +LAEEFEQ+S
Sbjct  1062  DASMDQS------WDSNGNHIATKGQDERGKRLGSRVLDRDMSSGLNVISRLAEEFEQQS  1115

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD  FLVEVKS   EA+LNP+ EL+ LK  FESWKKD+ +RL+E+KVI +KL +++
Sbjct  1116  QVFADDVNFLVEVKSRQAEASLNPEKELKSLKQNFESWKKDFSLRLRESKVIINKLRTDD  1175

Query  548   GASDKMKKKWW  580
               SDK K+KWW
Sbjct  1176  ANSDKAKRKWW  1186



>ref|XP_009389227.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1277

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 7/185 (4%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN+ILHQRLQQYE+RWSEYE KM+SMEEVWQKQM SLQSSLS+AK S A+DD  R+S
Sbjct  1086  KEEENNILHQRLQQYESRWSEYEQKMESMEEVWQKQMASLQSSLSVAKNSFAIDDIERHS  1145

Query  221   DASVNAS-----DDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
              AS++ S       +   W+ G    +   N  R + +GLSVI +L+EEFEQR+QVF DD
Sbjct  1146  VASLDQSWSSTDPIRAKGWENGKRSVSRAIN--RDMSSGLSVISRLSEEFEQRTQVFADD  1203

Query  386   AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKM  565
             AKFL+EVKSG +EA+LNP+ ELRRLK  FE WKKD+  RL+E K++ +KLG+++  SDK 
Sbjct  1204  AKFLMEVKSGKSEASLNPERELRRLKQDFELWKKDFNSRLREAKMVINKLGTDDAGSDKG  1263

Query  566   KKKWW  580
             K+KWW
Sbjct  1264  KRKWW  1268



>ref|XP_003589382.1| Unconventional myosin [Medicago truncatula]
 gb|AES59633.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=210

 Score =   172 bits (436),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 132/182 (73%), Gaps = 28/182 (15%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            KDEENDIL+QR+QQYENRWSEYELKMKSME++W KQMRSLQSSLSIAKKSLA+DDS RNS
Sbjct  56   KDEENDILNQRIQQYENRWSEYELKMKSMEDLWLKQMRSLQSSLSIAKKSLAIDDSDRNS  115

Query  221  DASV-NASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFL  397
            DASV NASD+++ +W++G+N  + E+NG R   A LSVI +LAE F + S ++       
Sbjct  116  DASVNNASDERDYSWEVGSNHRSQESNGTRSTTASLSVISRLAEAFAKESSIW-------  168

Query  398  VEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKW  577
                                LK MFE+WK+DY  RL+ETK+I +KLG+E+ A +KMKKKW
Sbjct  169  --------------------LKQMFEAWKRDYRARLRETKLIINKLGTEDSALEKMKKKW  208

Query  578  WG  583
            WG
Sbjct  209  WG  210



>ref|XP_010463346.1| PREDICTED: myosin-3-like [Camelina sativa]
Length=1075

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 129/171 (75%), Gaps = 4/171 (2%)
 Frame = +2

Query  77    QQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNSDASVNASDDKES  256
             +QY+       +   +MEE+WQKQM+SLQSSLSIAKKSL ++DSARNSDASVNAS+  + 
Sbjct  900   RQYKATVDASVVIQSAMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASNGTD-  958

Query  257   TWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLN  436
               D G +   + +   R V  GLSVI +LAEEF QR+QVFGDD KFL+EVKSG  EANLN
Sbjct  959   -LDSGGSHFQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFGDDRKFLMEVKSGQVEANLN  1017

Query  437   PDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GASDKMKKKWWG  583
             PD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+++K K KWWG
Sbjct  1018  PDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGSAEKAKMKWWG  1068



>ref|XP_006847798.1| hypothetical protein AMTR_s00029p00027850 [Amborella trichopoda]
 gb|ERN09379.1| hypothetical protein AMTR_s00029p00027850 [Amborella trichopoda]
Length=1164

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 121/186 (65%), Gaps = 23/186 (12%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQ+L QYE+RWSEYE KMKSMEEVWQ QM                  S + +
Sbjct  987   KDEENELLHQKLHQYESRWSEYESKMKSMEEVWQNQM-----------------GSLQTT  1029

Query  221   DASVNASDDKESTWDIG------NNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGD  382
              AS   S + +  W+ G          A   +  R + AGLSVI +LAEEFE R +VFGD
Sbjct  1030  LASAKRSLEGDEGWNFGISPGQKKEEAAGSRHLEREMSAGLSVIERLAEEFEGRRRVFGD  1089

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDK  562
             DA FLVEVKSG  EA L+PD ELR+LK +F++WKKDY  RL+ETK + HKLG+EE  ++K
Sbjct  1090  DADFLVEVKSGRAEAGLDPDIELRKLKRLFDAWKKDYNSRLRETKSVLHKLGNEEAQAEK  1149

Query  563   MKKKWW  580
              +++WW
Sbjct  1150  ARRRWW  1155



>dbj|BAD94297.1| myosin [Arabidopsis thaliana]
Length=147

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +2

Query  200  DDSARNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
            +DSARNSDASVNASD   +  D G +   + +   R V  GLSVI +LAEEF QR+QVFG
Sbjct  13   EDSARNSDASVNASD--ATDLDSGGSHYQMGHGRSRSVGVGLSVISRLAEEFGQRAQVFG  70

Query  380  DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GA  553
            DD KFL+EVKSG  EANLNPD ELRRLK MFE+WKKDYG RL+ETK+I  KLGSEE  G+
Sbjct  71   DDRKFLMEVKSGQVEANLNPDRELRRLKQMFETWKKDYGGRLRETKLILSKLGSEETGGS  130

Query  554  SDKMKKKWWG  583
            ++K+K  WWG
Sbjct  131  AEKVKMNWWG  140



>ref|XP_006841789.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda]
 gb|ERN03464.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda]
Length=1232

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 132/188 (70%), Gaps = 11/188 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+E+N +L+Q+LQQYE RWSEYE +M+SMEE WQKQM SLQ SL+ AK+SLA DD+ R  
Sbjct  1042  KEEDNLVLNQQLQQYEKRWSEYETRMRSMEETWQKQMTSLQMSLAAAKRSLAADDAVRLD  1101

Query  221   DASVNASDDKESTWDIGNNRTALENNGV-------RPVRAGLSVIGQLAEEFEQRSQVFG  379
              + +  S D E +  IG  RT     G        RP  A + V+G++A+EF+QR+QVF 
Sbjct  1102  ASPLAHSYDSEESTSIGT-RTPDYIGGTPSKPTVGRPSEATV-VVGRMAKEFDQRAQVFN  1159

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
             DDA F+VEVKSG +EA+LNP+ ELR+LK  FE WKKDY VRL+ETK   HKLG  +   +
Sbjct  1160  DDAGFIVEVKSGHSEASLNPEDELRKLKLRFEGWKKDYKVRLRETKATLHKLG--DSNVE  1217

Query  560   KMKKKWWG  583
             K KKKWWG
Sbjct  1218  KSKKKWWG  1225



>emb|CDY71633.1| BnaCnng73730D [Brassica napus]
Length=151

 Score =   152 bits (383),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 5/130 (4%)
 Frame = +2

Query  200  DDSARNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
            +DSARNSDASVNASD  E +   G+ RT   +   R V  GLSVI +LAEEF QR+QVFG
Sbjct  18   EDSARNSDASVNASDAAELSGSGGDFRT---HGRTRSVGVGLSVISRLAEEFGQRAQVFG  74

Query  380  DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE--GA  553
            DD KFL+EVKSG  EANL+P+ ELRRLK MF++WKKDYG R +ETK+I  K+GS E  G+
Sbjct  75   DDTKFLMEVKSGQVEANLDPERELRRLKQMFDTWKKDYGGRSRETKLILGKIGSGESGGS  134

Query  554  SDKMKKKWWG  583
            ++++K KWWG
Sbjct  135  AERVKMKWWG  144



>gb|ACL52804.1| unknown [Zea mays]
Length=148

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +2

Query  59   ILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNSDASVNA  238
            +LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSL LD++ R SD+SV+ 
Sbjct  1    MLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMSDSSVDQ  60

Query  239  SDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGL  418
            S +      + +    + + G R + AGLSVI +LAEEFEQRSQVF DDAKFLVEVKSG 
Sbjct  61   SWESNGNHHVSSGSQLVPHTGGREMNAGLSVISRLAEEFEQRSQVFADDAKFLVEVKSGQ  120

Query  419  TEANLNPDHELRRL  460
             +A+LNPD ELRRL
Sbjct  121  ADASLNPDMELRRL  134



>ref|XP_002975651.1| hypothetical protein SELMODRAFT_103418 [Selaginella moellendorffii]
 gb|EFJ23280.1| hypothetical protein SELMODRAFT_103418 [Selaginella moellendorffii]
Length=1045

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 120/183 (66%), Gaps = 3/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KD EN  +  +LQQYE RWSEYE +M +MEEVWQKQM SLQ SL+ AK+SL  +D    S
Sbjct  856   KDVENAAMAHKLQQYEQRWSEYEARMNAMEEVWQKQMTSLQQSLAAAKRSLTSEDPVPES  915

Query  221   DASVNASDD-KESTWDIGNNRTALEN--NGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAK  391
               SV        ++    +N+T+ +N  N  R   AG SV+GQL +E+E R+QVF DDA 
Sbjct  916   ATSVTPEPGFITASTTATSNQTSSDNHSNFPRDFDAGKSVVGQLVKEYEHRTQVFNDDAD  975

Query  392   FLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKK  571
             FLVEVKSG  EANL+P+ EL++LKH F+ WKKD+  RL+ETKVI  KL   +    +  K
Sbjct  976   FLVEVKSGQVEANLSPEDELKKLKHRFDVWKKDFKGRLRETKVILQKLSHVDEERSRKHK  1035

Query  572   KWW  580
              WW
Sbjct  1036  SWW  1038



>gb|KHM98905.1| hypothetical protein glysoja_039075 [Glycine soja]
Length=123

 Score =   141 bits (355),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  116  MKSMEEVWQKQMRslqsslsiakkslalDDSARNSDASVNASDDKESTWDIGNNRTALEN  295
            MKSMEEVWQKQMR +QSSLSIAKKSLA+DDS RNS+AS+NASDD++ +WD+G N    E+
Sbjct  1    MKSMEEVWQKQMRYVQSSLSIAKKSLAMDDSERNSNASINASDDRDFSWDVGTNHQRQES  60

Query  296  NGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELR  454
            NG R + A LSVI +LAEEFEQRSQVFGDDAKFLVEVKSG  EA+LNP+ E++
Sbjct  61   NGARLMSATLSVISRLAEEFEQRSQVFGDDAKFLVEVKSGQVEASLNPNREVK  113



>ref|XP_002978834.1| hypothetical protein SELMODRAFT_109322 [Selaginella moellendorffii]
 gb|EFJ20281.1| hypothetical protein SELMODRAFT_109322 [Selaginella moellendorffii]
Length=1052

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 120/183 (66%), Gaps = 3/183 (2%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KD EN  +  +LQQYE RWSEYE +M +MEEVWQKQM SLQ SL+ AK+SL  +D    S
Sbjct  863   KDVENAAMVHKLQQYEQRWSEYEARMNAMEEVWQKQMTSLQQSLAAAKRSLTSEDPVPES  922

Query  221   DASVNASDD-KESTWDIGNNRTALEN--NGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAK  391
               SV        ++    +N+T+ +N  N  R   AG SV+GQL +E+E R+QVF DDA 
Sbjct  923   ATSVTPEPGFITASTTATSNQTSSDNHSNFPRDFDAGKSVVGQLVKEYEHRTQVFNDDAD  982

Query  392   FLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKK  571
             FLVEVKSG  EANL+P+ EL++LKH F+ WKKD+  RL+ETKVI  KL   +    +  K
Sbjct  983   FLVEVKSGQVEANLSPEDELKKLKHRFDVWKKDFKGRLRETKVILQKLSHVDEERSRKHK  1042

Query  572   KWW  580
              WW
Sbjct  1043  SWW  1045



>ref|XP_003562871.1| PREDICTED: myosin-3 [Brachypodium distachyon]
Length=1251

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 122/201 (61%), Gaps = 28/201 (14%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN +L Q+L+QYEN+WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL  DD    +
Sbjct  1054  KEEENAMLKQQLEQYENKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSLTSDDMATRA  1113

Query  209   ARNSDASVNASDDKESTWDIGNN----------------RTALENNGVRPVRAGLSVIGQ  340
             AR      +A  D E T   G +                R A  N+  R     ++V+  
Sbjct  1114  ARTDTIPTHAQYDSEDTMSTGTHTPEAAELKYQNHNPEARVATGNSDRR-----INVVNH  1168

Query  341   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  520
             LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV
Sbjct  1169  LAKEFEDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDYKSRLKETKV  1228

Query  521   ISHKLGSEEGASDKMKKKWWG  583
                K+G   G  +K +K+WWG
Sbjct  1229  NLQKVG---GHDEKSRKRWWG  1246



>ref|XP_008800396.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1247

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 130/215 (60%), Gaps = 37/215 (17%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN IL Q+LQQYE RWSEYE KMKSMEE WQKQ+ SLQ SL+ AKKSLA DD A + 
Sbjct  1031  KEEENAILKQQLQQYETRWSEYEAKMKSMEETWQKQLTSLQVSLAAAKKSLAADDMASHH  1090

Query  221   ---DAS-VNASDDKESTWDIGNNRT---------------ALENNGVR-PVR------AG  322
                DAS V  S D E T   G                      +NG R  VR       G
Sbjct  1091  GRLDASPVQHSYDSEDTLSAGTRTPEGTPAKKFHACDAGLGRNSNGTRSAVRHLDASDGG  1150

Query  323   L--------SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFES  478
             L        S +  L +EFEQ++QVF DDA FLVEVKS  + +++NPD EL++LK  F +
Sbjct  1151  LVRYSNGAHSAVSNLVKEFEQQTQVFEDDAAFLVEVKSRQSGSSINPDEELQKLKGRFGT  1210

Query  479   WKKDYGVRLKETKVISHKLGSEEGASDKMKKKWWG  583
             WKKDY VRL+ETK+   KLGS E   +KM+K+WWG
Sbjct  1211  WKKDYKVRLRETKIALQKLGSPE---EKMRKRWWG  1242



>ref|XP_006370337.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
 gb|ERP66906.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
Length=1192

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 128/195 (66%), Gaps = 17/195 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQYE RWS+YE KMK+MEE+WQ QM SLQ+SL+ A+KSLA D++A   
Sbjct  998   KEEENAALQEQLQQYEKRWSDYEAKMKAMEEMWQMQMLSLQTSLAAARKSLAADNTAAQP  1057

Query  221   ---DASVNASD-DKESTWDI-----GNNRTALENNGVRPVRAG------LSVIGQLAEEF  355
                D+S +  D D E    +     G N   +  N    +RAG      ++V+  LA+EF
Sbjct  1058  GKLDSSTSPRDYDSEDNVSMESRTPGGNTPNIFANAFPDLRAGRENNGSVNVVNTLAKEF  1117

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E + Q F DDAK LVEV++G + +N+NPD ELRRLK  FE+WKKDY VRL+ETK   HKL
Sbjct  1118  ELQKQNFDDDAKALVEVRAGQSASNMNPDEELRRLKLKFETWKKDYKVRLRETKARLHKL  1177

Query  536   GSEEGASDKMKKKWW  580
             G   G  D+ ++KWW
Sbjct  1178  G--HGEVDRNRRKWW  1190



>gb|EMT14738.1| Myosin-2 heavy chain [Aegilops tauschii]
Length=1237

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 122/196 (62%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN +L Q+L+QYEN+WSEYE KMK MEE W+KQ+ SLQ SL  AKKSLA DD    +
Sbjct  1040  KEEENAMLKQQLEQYENKWSEYETKMKVMEEAWKKQLSSLQLSLVAAKKSLAADDMVTRA  1099

Query  209   ARNSDASVNASDDKESTWDIGNNRT-----ALENNGVRPVRAG------LSVIGQLAEEF  355
             AR      +A  D E T   G +         +N+   P  A       ++ +  LA+EF
Sbjct  1100  ARTDTTPTHAQYDSEDTMSTGTHTPEGTELKYQNHNPEPRLATGNSDRRINAVNHLAKEF  1159

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV   K+
Sbjct  1160  EDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDYKSRLKETKVNLQKV  1219

Query  536   GSEEGASDKMKKKWWG  583
             GS +   +K +K+WWG
Sbjct  1220  GSHD---EKSRKRWWG  1232



>dbj|BAJ99526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1257

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 123/196 (63%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN +L Q+L+QYEN+WSEYE KMK MEE W+KQ+ SLQ SL  AKKSLA DD    +
Sbjct  1060  KEEENAMLKQQLEQYENKWSEYEAKMKVMEEAWKKQLSSLQLSLVAAKKSLASDDMVIRA  1119

Query  209   ARNSDASVNASDDKESTWDIGNNRT-----ALENNGVRP-VRAG-----LSVIGQLAEEF  355
             AR      +A  D E T   G +         +N+   P V  G     ++V+  LA+EF
Sbjct  1120  ARTDTTPTHAQYDSEDTMSTGTHTPEGTELKFQNHNPEPRVVTGNSDRRINVVNHLAKEF  1179

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV   K+
Sbjct  1180  EDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDYKSRLKETKVNLQKV  1239

Query  536   GSEEGASDKMKKKWWG  583
              S +   +K +K+WWG
Sbjct  1240  SSHD---EKSRKRWWG  1252



>ref|XP_008345270.1| PREDICTED: myosin-2-like isoform X2 [Malus domestica]
Length=1143

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 125/186 (67%), Gaps = 15/186 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSLA D++A   
Sbjct  961   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMASLQTSLAAARKSLASDNTAGQP  1020

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
              R    S    D +E+T  +G N   LE NG     +GL       +EFEQR Q F DDA
Sbjct  1021  GRLGSVSSPRYDSEEAT-SMGFNGAGLEANGSSNAVSGL------VKEFEQRRQTFDDDA  1073

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASDKM  565
             K LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   +K 
Sbjct  1074  KALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---EKR  1130

Query  566   KKKWWG  583
             ++KWW 
Sbjct  1131  QRKWWA  1136



>ref|XP_008345271.1| PREDICTED: myosin-2-like isoform X3 [Malus domestica]
Length=1143

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 125/186 (67%), Gaps = 15/186 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSLA D++A   
Sbjct  961   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMASLQTSLAAARKSLASDNTAGQP  1020

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
              R    S    D +E+T  +G N   LE NG     +GL       +EFEQR Q F DDA
Sbjct  1021  GRLGSVSSPRYDSEEAT-SMGFNGAGLEANGSSNAVSGL------VKEFEQRRQTFDDDA  1073

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASDKM  565
             K LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   +K 
Sbjct  1074  KALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---EKR  1130

Query  566   KKKWWG  583
             ++KWW 
Sbjct  1131  QRKWWA  1136



>ref|XP_008345269.1| PREDICTED: myosin-2-like isoform X1 [Malus domestica]
Length=1145

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 125/186 (67%), Gaps = 15/186 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSLA D++A   
Sbjct  963   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMASLQTSLAAARKSLASDNTAGQP  1022

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
              R    S    D +E+T  +G N   LE NG     +GL       +EFEQR Q F DDA
Sbjct  1023  GRLGSVSSPRYDSEEAT-SMGFNGAGLEANGSSNAVSGL------VKEFEQRRQTFDDDA  1075

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASDKM  565
             K LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   +K 
Sbjct  1076  KALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---EKR  1132

Query  566   KKKWWG  583
             ++KWW 
Sbjct  1133  QRKWWA  1138



>gb|EMS56234.1| Myosin-2 heavy chain [Triticum urartu]
Length=1124

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 122/196 (62%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN +L Q+L+QYEN+WSEYE KMK MEE W+KQ+ SLQ SL  AKKSLA DD    +
Sbjct  927   KEEENAMLKQQLEQYENKWSEYETKMKVMEEAWKKQLSSLQLSLVAAKKSLAADDMVTRA  986

Query  209   ARNSDASVNASDDKESTWDIGNNRT-----ALENNGVRP-VRAG-----LSVIGQLAEEF  355
             AR      +A  D E T   G +         +N+   P V  G     ++ +  LA+EF
Sbjct  987   ARTDTTPTHAQYDSEDTMSTGTHTPEGTELKYQNHNPEPRVVTGNSDRRINAVNHLAKEF  1046

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV   K+
Sbjct  1047  EDRRQVFDDDAGFLVAVKSGQIGSNMNPDDELRKLKDRFATWKKDYKSRLKETKVNLQKV  1106

Query  536   GSEEGASDKMKKKWWG  583
              S +   +K +K+WWG
Sbjct  1107  SSHD---EKSRKRWWG  1119



>ref|XP_001755337.1| predicted protein [Physcomitrella patens]
 gb|EDQ79817.1| predicted protein [Physcomitrella patens]
Length=1060

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 122/196 (62%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+E+N +L QRL  YE RW EYE KM SMEE+WQKQM SLQ S++ AK+SLA D+    +
Sbjct  863   KEEDNAVLRQRLLHYEARWMEYEAKMSSMEEMWQKQMSSLQLSIAAAKQSLATDEHPLQT  922

Query  221   ---------DASVNASDDKESTWDIGNNRTALENNGVRP---VRAGLSVIGQLAEEFEQR  364
                      DA+ N +    S     N      +    P   V A  SV+  L  E++ R
Sbjct  923   PVKDDNDWDDAATNGT---RSPDQFTNKYLVTGSEYSTPRGDVDAARSVVNHLMREYDHR  979

Query  365   SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSE  544
             +QVF DD  FLVEVKSGLTEA+LNP+ ELR+LK  F++WKKD+ VRL+ETK++ +KL + 
Sbjct  980   TQVFNDDVDFLVEVKSGLTEAHLNPEDELRKLKVRFDTWKKDFKVRLRETKLVLNKLCAM  1039

Query  545   EGA---SDKMKKKWWG  583
             + A    D+ ++ WWG
Sbjct  1040  DSAEKEKDRTRRNWWG  1055



>ref|XP_001768683.1| predicted protein [Physcomitrella patens]
 gb|EDQ66621.1| predicted protein [Physcomitrella patens]
Length=1028

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 124/186 (67%), Gaps = 8/186 (4%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+E+N +L QR+Q YEN+W EYE KM SMEE+WQKQM +LQ SL+ AKKS+A ++SA   
Sbjct  833   KEEDNALLRQRIQHYENQWVEYEAKMSSMEEMWQKQMSTLQLSLAAAKKSIATEESATLQ  892

Query  221   DASVNASDDKESTWDIGNNRTALENNGVR------PVRAGLSVIGQLAEEFEQRSQVFGD  382
              +S + S+D+++  ++ NN     + G         V AG S + QL  EF+ R QVF D
Sbjct  893   TSSKDGSEDQKT--NVENNSNKFLHAGSELGSSQGEVAAGHSYVTQLDREFDHRKQVFTD  950

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDK  562
             D  FLVEVKSG T A+L+P+ ELR+LK  F++WKKD+ VRL+ETK +  KLG  + +   
Sbjct  951   DIDFLVEVKSGQTTAHLSPEDELRKLKTRFDAWKKDFKVRLRETKAVLSKLGHTDSSDKW  1010

Query  563   MKKKWW  580
             ++ K W
Sbjct  1011  IRGKKW  1016



>ref|XP_002281748.1| PREDICTED: myosin-2 [Vitis vinifera]
Length=1229

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q E +WSEYE KMK+MEE WQKQM SLQ SL+ AKK+ A     R  
Sbjct  1038  KEEENAALREQLKQSEAKWSEYEAKMKAMEETWQKQMASLQMSLAAAKKNHAAGQDGRLD  1097

Query  221   DASVNASDDKESTWDI------GNNRTALENNGV-RPVRAGLSVIGQLAEEFEQRSQVFG  379
               S     D E T  +       N    L N G  R     L+ +  LA+EFEQR Q F 
Sbjct  1098  TPSSPGYYDSEGTPSMETRTPGANTPVKLSNVGAGRESNGNLNTVSHLAKEFEQRKQSFD  1157

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
             DDAK LVEVKSG   +N+N D EL++LK  FE+WKKDY VRL+ETK   HKLG  EG  +
Sbjct  1158  DDAKTLVEVKSGQPSSNMNHD-ELKKLKQRFEAWKKDYKVRLRETKARLHKLGHSEG--E  1214

Query  560   KMKKKWWG  583
             ++++KWWG
Sbjct  1215  RIRRKWWG  1222



>emb|CBI20376.3| unnamed protein product [Vitis vinifera]
Length=1197

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q E +WSEYE KMK+MEE WQKQM SLQ SL+ AKK+ A     R  
Sbjct  1006  KEEENAALREQLKQSEAKWSEYEAKMKAMEETWQKQMASLQMSLAAAKKNHAAGQDGRLD  1065

Query  221   DASVNASDDKESTWDI------GNNRTALENNGV-RPVRAGLSVIGQLAEEFEQRSQVFG  379
               S     D E T  +       N    L N G  R     L+ +  LA+EFEQR Q F 
Sbjct  1066  TPSSPGYYDSEGTPSMETRTPGANTPVKLSNVGAGRESNGNLNTVSHLAKEFEQRKQSFD  1125

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
             DDAK LVEVKSG   +N+N D EL++LK  FE+WKKDY VRL+ETK   HKLG  EG  +
Sbjct  1126  DDAKTLVEVKSGQPSSNMNHD-ELKKLKQRFEAWKKDYKVRLRETKARLHKLGHSEG--E  1182

Query  560   KMKKKWWG  583
             ++++KWWG
Sbjct  1183  RIRRKWWG  1190



>ref|XP_006584303.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Glycine max]
Length=276

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  125  MEEVWQKQMRslqsslsiakkslalDDSARNSDASVNASDDKESTWDIGNNRTALENNGV  304
            MEEVWQKQMR +QSSLSIAKKSLA+DDS RNS+AS+NASDD++ +WD+G N    E+NG 
Sbjct  1    MEEVWQKQMRYVQSSLSIAKKSLAMDDSERNSNASINASDDRDFSWDVGTNHQRQESNGA  60

Query  305  RPVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELR  454
            R + A LSVI +LAEEFEQRSQVFGDDAKFLVEVKSG  EA+LNP+ E++
Sbjct  61   RLMSATLSVISRLAEEFEQRSQVFGDDAKFLVEVKSGQVEASLNPNREVK  110



>ref|XP_011044539.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044540.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044541.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044543.1| PREDICTED: myosin-2 [Populus euphratica]
Length=1197

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 128/195 (66%), Gaps = 17/195 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQYE RWS+YE KMK+MEE+WQ QM SLQ+SL+ A+KSLA D++A   
Sbjct  1003  KEEENAALQEQLQQYEKRWSDYEAKMKAMEEMWQMQMLSLQTSLAAARKSLAADNTAAQP  1062

Query  221   ---DASVNASD-DKESTWDI-----GNNRTALENNGVRPVRAG------LSVIGQLAEEF  355
                D+S +  D D E    +     G N   +  N    +RAG      ++V+  LA+EF
Sbjct  1063  GKLDSSTSPRDYDSEDNVSMESRTPGGNTPNIFANAFPDLRAGRENNGPVNVVNNLAKEF  1122

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E + Q F DDAK LVEV++G + +N+NPD ELRRLK  FE+WKKDY VRL+ETK   HKL
Sbjct  1123  ELQKQNFDDDAKALVEVRAGQSASNMNPDEELRRLKLKFETWKKDYKVRLRETKTRLHKL  1182

Query  536   GSEEGASDKMKKKWW  580
             G   G  D+ ++KWW
Sbjct  1183  G--HGEVDRNRRKWW  1195



>ref|XP_009342449.1| PREDICTED: myosin-2 isoform X1 [Pyrus x bretschneideri]
Length=1090

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+ A+ SLA D++A   
Sbjct  908   KEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLAAARNSLASDNTAGQP  967

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
              R    S    D +E+T  +G N    E NG        + +  L +EFEQR Q F DDA
Sbjct  968   GRLGSVSSPRYDSEEAT-SMGFNGAGREANGSS------NAVSSLVKEFEQRRQTFNDDA  1020

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASDKM  565
             K LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   +K 
Sbjct  1021  KALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---EKR  1077

Query  566   KKKWWG  583
             ++KWW 
Sbjct  1078  QRKWWA  1083



>ref|XP_008226710.1| PREDICTED: myosin-2 isoform X1 [Prunus mume]
Length=1144

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L  +L+Q+E RWSEY+ KMKSM++VWQKQM SLQ+SL+ A+KSLA D++A   
Sbjct  952   KEEENAELQGQLRQFETRWSEYDAKMKSMQDVWQKQMASLQTSLAAARKSLASDNTAGQP  1011

Query  221   DASVNASD---DKESTWDIGNNRTALE---NNGVRPVRAGLSVIGQLAEEFEQRSQVFGD  382
                V AS    D E    +G+         N G R     L  +  L +EFEQR Q F D
Sbjct  1012  GRLVVASSPRYDSEEALSMGSRTPGASTPINGGGRETNGTLHAVSNLMKEFEQRKQHFDD  1071

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASD  559
             DAK LVEVK G +  N+NP+ ELR+LKH FESWKK+Y  RL+ETK   HKL  SEE    
Sbjct  1072  DAKALVEVKPGHSGVNMNPEEELRKLKHRFESWKKEYKARLRETKTKVHKLWHSEE--EK  1129

Query  560   KMKKKWWG  583
             +  +KWWG
Sbjct  1130  RRSRKWWG  1137



>ref|XP_009342451.1| PREDICTED: myosin-2 isoform X3 [Pyrus x bretschneideri]
Length=1089

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+ A+ SLA D++A   
Sbjct  907   KEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLAAARNSLASDNTAGQP  966

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
              R    S    D +E+T  +G N    E NG        + +  L +EFEQR Q F DDA
Sbjct  967   GRLGSVSSPRYDSEEAT-SMGFNGAGREANGSS------NAVSSLVKEFEQRRQTFNDDA  1019

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASDKM  565
             K LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   +K 
Sbjct  1020  KALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---EKR  1076

Query  566   KKKWWG  583
             ++KWW 
Sbjct  1077  QRKWWA  1082



>ref|XP_009342450.1| PREDICTED: myosin-2 isoform X2 [Pyrus x bretschneideri]
Length=1089

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+ A+ SLA D++A   
Sbjct  907   KEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLAAARNSLASDNTAGQP  966

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
              R    S    D +E+T  +G N    E NG        + +  L +EFEQR Q F DDA
Sbjct  967   GRLGSVSSPRYDSEEAT-SMGFNGAGREANGSS------NAVSSLVKEFEQRRQTFNDDA  1019

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASDKM  565
             K LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   +K 
Sbjct  1020  KALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---EKR  1076

Query  566   KKKWWG  583
             ++KWW 
Sbjct  1077  QRKWWA  1082



>ref|XP_009342454.1| PREDICTED: myosin-2 isoform X5 [Pyrus x bretschneideri]
Length=1145

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWSE+E KMKSM++VWQKQM SLQ+SL+ A+ SLA D++A   
Sbjct  963   KEEENAELQEQLQQFETRWSEHESKMKSMQDVWQKQMASLQTSLAAARNSLASDNTAGQP  1022

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDA  388
              R    S    D +E+T  +G N    E NG        + +  L +EFEQR Q F DDA
Sbjct  1023  GRLGSVSSPRYDSEEAT-SMGFNGAGREANGSS------NAVSSLVKEFEQRRQTFNDDA  1075

Query  389   KFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASDKM  565
             K LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   +K 
Sbjct  1076  KALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---EKR  1132

Query  566   KKKWWG  583
             ++KWW 
Sbjct  1133  QRKWWA  1138



>gb|EEC82270.1| hypothetical protein OsI_26483 [Oryza sativa Indica Group]
Length=1245

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 122/200 (61%), Gaps = 29/200 (15%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN+IL Q+L QYE +WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL  +D    +
Sbjct  1051  KEEENEILKQQLDQYEKKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSLTAEDVASRA  1110

Query  209   ARNSDASVNASDDKEST-----------WDIGNN----RTALENNGVRPVRAGLSVIGQL  343
             AR   A ++A  D E T           +   N+    R A  N+  R     ++ +  L
Sbjct  1111  ARTDAAPMHAHYDSEDTSTGTHTPEGTEFKYQNHNSEARVAAPNSDRR-----INAVNHL  1165

Query  344   AEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI  523
             A+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV 
Sbjct  1166  AKEFEDRRQVFEDDAGFLVAVKSGQVGSNMNPDDELRKLKDRFATWKKDYKSRLKETKVN  1225

Query  524   SHKLGSEEGASDKMKKKWWG  583
               K+G E     K +K+WWG
Sbjct  1226  LQKVGEE-----KSRKRWWG  1240



>ref|XP_007212835.1| hypothetical protein PRUPE_ppa020758mg [Prunus persica]
 gb|EMJ14034.1| hypothetical protein PRUPE_ppa020758mg [Prunus persica]
Length=1127

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L  +L+Q+E RWSEY+ KMKSM++VWQKQM SLQ+SL+ A+KSLA D++A   
Sbjct  935   KEEENAELQGQLRQFETRWSEYDAKMKSMQDVWQKQMASLQTSLAAARKSLASDNTAGQP  994

Query  221   DASVNASD---DKESTWDIGN---NRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGD  382
                V  S    D E    +G+     +   N G R     L  +  L +EFEQR Q F D
Sbjct  995   GRLVVPSSPRCDSEEALSMGSRTPGASTPNNGGGRETNGTLHAVSNLMKEFEQRKQHFDD  1054

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGASD  559
             DAK LVEVK G +  N+NP+ ELR+LKH FESWKK+Y  RL+ETK   HKL  SEE    
Sbjct  1055  DAKALVEVKPGHSGVNMNPEEELRKLKHRFESWKKEYKARLRETKTKVHKLWHSEE--EK  1112

Query  560   KMKKKWWG  583
             +  +KWWG
Sbjct  1113  RRSRKWWG  1120



>ref|XP_001774306.1| predicted protein [Physcomitrella patens]
 gb|EDQ60942.1| predicted protein [Physcomitrella patens]
Length=1019

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 119/185 (64%), Gaps = 12/185 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  + Q++  YE RW EYE KM SMEE+WQKQM SLQ SLS AK+SLA DD +   
Sbjct  838   KEEENASMRQKILHYEARWMEYEAKMTSMEEMWQKQMSSLQLSLSAAKRSLATDDYSMLQ  897

Query  221   DASVNASDDKESTWDIGNNRTALENNGVRP---VRAGLSVIGQLAEEFEQRSQVFGDDAK  391
                   + D +S     N+R +       P   V A  SV+  L  EF+ R+QVF DDA 
Sbjct  898   ----TPTKDHDSI----NDRFSAGRECSTPRGDVDAARSVVNHLVREFDHRTQVFNDDAD  949

Query  392   FLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGA-SDKMK  568
             FL+EVKSGLTEA L+P+ ELR+L+  F++WKKD+  RL+ETK++  +L + + A  +K +
Sbjct  950   FLIEVKSGLTEAPLDPEEELRKLRMRFDTWKKDFKTRLRETKLVLQRLCNVDSAEKEKTR  1009

Query  569   KKWWG  583
             KKWW 
Sbjct  1010  KKWWS  1014



>gb|KJB13459.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=781

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA--R  214
            K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSLA D +A  R
Sbjct  594  KEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSLAADSNAGQR  653

Query  215  NSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEEFEQRSQVFG  379
              D       D E    +G+ RT + N  +  V  G     L+ +G L +EFEQR Q F 
Sbjct  654  RGDVVSPRYYDSEDNVSMGS-RTPVGN--MPDVVGGRENGSLNAVGNLLKEFEQRRQTFD  710

Query  380  DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
            DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK   HK G E   SD
Sbjct  711  DDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETKARLHKRGYE---SD  767

Query  560  KMKKKWW  580
            K ++KWW
Sbjct  768  KTRRKWW  774



>gb|KJB13460.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=797

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA--R  214
            K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSLA D +A  R
Sbjct  610  KEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSLAADSNAGQR  669

Query  215  NSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEEFEQRSQVFG  379
              D       D E    +G+ RT + N  +  V  G     L+ +G L +EFEQR Q F 
Sbjct  670  RGDVVSPRYYDSEDNVSMGS-RTPVGN--MPDVVGGRENGSLNAVGNLLKEFEQRRQTFD  726

Query  380  DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
            DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK   HK G E   SD
Sbjct  727  DDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETKARLHKRGYE---SD  783

Query  560  KMKKKWW  580
            K ++KWW
Sbjct  784  KTRRKWW  790



>gb|KJB13461.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=790

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA--R  214
            K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSLA D +A  R
Sbjct  603  KEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSLAADSNAGQR  662

Query  215  NSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEEFEQRSQVFG  379
              D       D E    +G+ RT + N  +  V  G     L+ +G L +EFEQR Q F 
Sbjct  663  RGDVVSPRYYDSEDNVSMGS-RTPVGN--MPDVVGGRENGSLNAVGNLLKEFEQRRQTFD  719

Query  380  DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
            DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK   HK G E   SD
Sbjct  720  DDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETKARLHKRGYE---SD  776

Query  560  KMKKKWW  580
            K ++KWW
Sbjct  777  KTRRKWW  783



>ref|XP_008366419.1| PREDICTED: myosin-2 isoform X2 [Malus domestica]
Length=1153

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 126/189 (67%), Gaps = 12/189 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL   ++A   
Sbjct  962   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLAAARKSLGSANTAGQP  1021

Query  218   -SDASVNASD-DKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
              +  SV+++  D E    +G+      T L   G R      + +  L +EFEQR Q+F 
Sbjct  1022  VTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGSSNAVSNLLKEFEQRRQIFD  1080

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGAS  556
             DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   
Sbjct  1081  DDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---  1137

Query  557   DKMKKKWWG  583
             +K ++KWWG
Sbjct  1138  EKRRRKWWG  1146



>ref|XP_008366425.1| PREDICTED: myosin-2 isoform X3 [Malus domestica]
Length=1153

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 126/189 (67%), Gaps = 12/189 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL   ++A   
Sbjct  962   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLAAARKSLGSANTAGQP  1021

Query  218   -SDASVNASD-DKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
              +  SV+++  D E    +G+      T L   G R      + +  L +EFEQR Q+F 
Sbjct  1022  VTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGSSNAVSNLLKEFEQRRQIFD  1080

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGAS  556
             DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   
Sbjct  1081  DDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---  1137

Query  557   DKMKKKWWG  583
             +K ++KWWG
Sbjct  1138  EKRRRKWWG  1146



>ref|XP_008366413.1| PREDICTED: myosin-2 isoform X1 [Malus domestica]
Length=1155

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 126/189 (67%), Gaps = 12/189 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL   ++A   
Sbjct  964   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLAAARKSLGSANTAGQP  1023

Query  218   -SDASVNASD-DKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
              +  SV+++  D E    +G+      T L   G R      + +  L +EFEQR Q+F 
Sbjct  1024  VTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGSSNAVSNLLKEFEQRRQIFD  1082

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGAS  556
             DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   
Sbjct  1083  DDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---  1139

Query  557   DKMKKKWWG  583
             +K ++KWWG
Sbjct  1140  EKRRRKWWG  1148



>gb|EEE67412.1| hypothetical protein OsJ_24744 [Oryza sativa Japonica Group]
Length=1256

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 121/201 (60%), Gaps = 31/201 (15%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN++L Q+L QYE +WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL  +D    +
Sbjct  1062  KEEENEMLKQQLDQYEKKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSLTAEDVASRA  1121

Query  209   ARNSDASVNASDDKESTWDIGNN----------------RTALENNGVRPVRAGLSVIGQ  340
             AR   A ++A  D E T   G +                R A  N+  R     ++ +  
Sbjct  1122  ARTDAAPMHAHYDSEDT-STGTHTPEGTEFKYQNHNSEARVAAPNSDRR-----INAVNH  1175

Query  341   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  520
             LA+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV
Sbjct  1176  LAKEFEDRRQVFEDDAGFLVAVKSGQVGSNMNPDDELRKLKDRFATWKKDYKSRLKETKV  1235

Query  521   ISHKLGSEEGASDKMKKKWWG  583
                K+G E     K +K+WWG
Sbjct  1236  NLQKVGEE-----KSRKRWWG  1251



>ref|XP_009334585.1| PREDICTED: myosin-2 isoform X2 [Pyrus x bretschneideri]
Length=1153

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 126/189 (67%), Gaps = 12/189 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL   ++A   
Sbjct  962   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLAAARKSLGSANTAGQP  1021

Query  218   -SDASVNASD-DKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
              +  SV+++  D E    +G+      T L   G R      + +  L +EFEQR Q+F 
Sbjct  1022  VTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGSSNAVSTLLKEFEQRRQIFD  1080

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGAS  556
             DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   
Sbjct  1081  DDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---  1137

Query  557   DKMKKKWWG  583
             +K ++KWWG
Sbjct  1138  EKRRRKWWG  1146



>ref|XP_009334584.1| PREDICTED: myosin-2 isoform X1 [Pyrus x bretschneideri]
Length=1155

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 126/189 (67%), Gaps = 12/189 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL   ++A   
Sbjct  964   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLAAARKSLGSANTAGQP  1023

Query  218   -SDASVNASD-DKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
              +  SV+++  D E    +G+      T L   G R      + +  L +EFEQR Q+F 
Sbjct  1024  VTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGSSNAVSTLLKEFEQRRQIFD  1082

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGAS  556
             DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   
Sbjct  1083  DDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---  1139

Query  557   DKMKKKWWG  583
             +K ++KWWG
Sbjct  1140  EKRRRKWWG  1148



>ref|XP_009334586.1| PREDICTED: myosin-2 isoform X3 [Pyrus x bretschneideri]
Length=1153

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 126/189 (67%), Gaps = 12/189 (6%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K+EEN  L ++LQQ+E RWSEYE KMKSM++VWQKQM SLQ+SL+ A+KSL   ++A   
Sbjct  962   KEEENAELQEQLQQFETRWSEYESKMKSMQDVWQKQMVSLQTSLAAARKSLGSANTAGQP  1021

Query  218   -SDASVNASD-DKESTWDIGNNR----TALENNGVRPVRAGLSVIGQLAEEFEQRSQVFG  379
              +  SV+++  D E    +G+      T L   G R      + +  L +EFEQR Q+F 
Sbjct  1022  VTLGSVSSARYDSEEATSMGSRTPGASTPLNGAG-REANGSSNAVSTLLKEFEQRRQIFD  1080

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL-GSEEGAS  556
             DDAK LVEVK G + AN+NP+ +LR+LKH FESWKK+Y  RL+ETK   HK+  SEE   
Sbjct  1081  DDAKALVEVKPGQSAANMNPEEDLRKLKHRFESWKKEYKARLRETKTKLHKIWHSEE---  1137

Query  557   DKMKKKWWG  583
             +K ++KWWG
Sbjct  1138  EKRRRKWWG  1146



>gb|KJB13457.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1188

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA--R  214
             K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSLA D +A  R
Sbjct  1001  KEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSLAADSNAGQR  1060

Query  215   NSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEEFEQRSQVFG  379
               D       D E    +G+ RT + N  +  V  G     L+ +G L +EFEQR Q F 
Sbjct  1061  RGDVVSPRYYDSEDNVSMGS-RTPVGN--MPDVVGGRENGSLNAVGNLLKEFEQRRQTFD  1117

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
             DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK   HK G E   SD
Sbjct  1118  DDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETKARLHKRGYE---SD  1174

Query  560   KMKKKWW  580
             K ++KWW
Sbjct  1175  KTRRKWW  1181



>gb|KJB13454.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1179

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA--R  214
             K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSLA D +A  R
Sbjct  992   KEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSLAADSNAGQR  1051

Query  215   NSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEEFEQRSQVFG  379
               D       D E    +G+ RT + N  +  V  G     L+ +G L +EFEQR Q F 
Sbjct  1052  RGDVVSPRYYDSEDNVSMGS-RTPVGN--MPDVVGGRENGSLNAVGNLLKEFEQRRQTFD  1108

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
             DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK   HK G E   SD
Sbjct  1109  DDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETKARLHKRGYE---SD  1165

Query  560   KMKKKWW  580
             K ++KWW
Sbjct  1166  KTRRKWW  1172



>gb|KJB13453.1| hypothetical protein B456_002G076300 [Gossypium raimondii]
Length=1195

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA--R  214
             K++EN  L ++LQQYE RW EYE KMKSME++WQKQM SLQ+SL+ A+KSLA D +A  R
Sbjct  1008  KEQENATLREQLQQYEARWLEYEAKMKSMEDMWQKQMASLQTSLAAARKSLAADSNAGQR  1067

Query  215   NSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEEFEQRSQVFG  379
               D       D E    +G+ RT + N  +  V  G     L+ +G L +EFEQR Q F 
Sbjct  1068  RGDVVSPRYYDSEDNVSMGS-RTPVGN--MPDVVGGRENGSLNAVGNLLKEFEQRRQTFD  1124

Query  380   DDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASD  559
             DDAK L E++     +N+NPD E RRLK  FE+WKK+Y +RLKETK   HK G E   SD
Sbjct  1125  DDAKSLAEIRMAQPTSNVNPDDEFRRLKRRFETWKKEYKLRLKETKARLHKRGYE---SD  1181

Query  560   KMKKKWW  580
             K ++KWW
Sbjct  1182  KTRRKWW  1188



>ref|XP_001777862.1| predicted protein [Physcomitrella patens]
 gb|EDQ57290.1| predicted protein [Physcomitrella patens]
Length=1057

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 124/209 (59%), Gaps = 28/209 (13%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+E+N +L QRL  YE RW EYE KM SME++WQKQM SLQ SL+ AKKSLA D+    +
Sbjct  838   KEEDNAMLRQRLLHYEARWMEYEAKMSSMEDMWQKQMSSLQLSLAAAKKSLATDEFLPQT  897

Query  221   DASVN--------ASDDKESTWDIGNNR--TALENNGVRP-VRAGLSVIGQLAEEFEQRS  367
                 +        A++  +S  D  N    T   N   R  V A  SV+  L  E++ R+
Sbjct  898   PGKHDNEFDWDDVATNGMKSPDDFTNKYLVTGSGNGASRGDVEAARSVVSHLTREYDHRT  957

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DD  FL+EVKSGLTEANLNP+ ELR+LK  F++W++D+  RL+ET+++ +KL S +
Sbjct  958   QVFNDDVDFLIEVKSGLTEANLNPEEELRKLKVRFDTWRRDFKARLRETRLVLNKLCSLD  1017

Query  548   GA-----------------SDKMKKKWWG  583
              A                  D+ +KKWWG
Sbjct  1018  SAEKDGDRMLCALDSLEKEGDRTRKKWWG  1046



>ref|XP_010268832.1| PREDICTED: myosin-2 [Nelumbo nucifera]
Length=1223

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 125/196 (64%), Gaps = 17/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L ++LQQ+E RWS+YE KMKSMEE+WQK+M SLQ SL+I K+SLA DD+A   
Sbjct  1023  KEEENAALQEQLQQFEKRWSDYEAKMKSMEEMWQKEMTSLQRSLAIVKRSLAADDNAGEP  1082

Query  212   -RNSDASVNASDDKESTWDIGNNRTAL----------ENNGV-RPVRAGLSVIGQLAEEF  355
              R     V    D E     G +   +           +NG  +   AGL+ +  L +EF
Sbjct  1083  GRPDALPVLHCYDSEDITSPGAHTPDVTTPEKLSNLTPDNGFGQASDAGLNAVSHLVKEF  1142

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E+R QVF +DA FLVEVKSG + ++ NP  ELR+LK  FE+WKK+Y ++L+ETK   H+L
Sbjct  1143  EKRKQVFEEDAGFLVEVKSGHSASSANPRDELRKLKLRFETWKKEYKLKLRETKSTLHRL  1202

Query  536   GSEEGASDKMKKKWWG  583
             G+ E   +K +++WWG
Sbjct  1203  GNSE--VEKTRRRWWG  1216



>gb|AEM05968.1| myosin VIII D [Physcomitrella patens]
Length=1365

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 123/217 (57%), Gaps = 36/217 (17%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+E+N +L QRL  YE RW EYE KM SMEE+WQKQM SLQ S++ AK+SLA D+     
Sbjct  1144  KEEDNAVLRQRLLHYEARWMEYEAKMSSMEEMWQKQMSSLQLSIAAAKQSLATDEHPLQT  1203

Query  212   ---------------RNSDASVNASDDKESTWD------------IGNNRTALENNGVRP  310
                            R +   +    D++  WD              N      +    P
Sbjct  1204  PVKDDNGCISIEKQQRITKRQLLPPGDEQLDWDDAATNGTRSPDQFTNKYLVTGSEYSTP  1263

Query  311   ---VRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESW  481
                V A  SV+  L  E++ R+QVF DD  FLVEVKSGLTEA+LNP+ ELR+LK  F++W
Sbjct  1264  RGDVDAARSVVNHLMREYDHRTQVFNDDVDFLVEVKSGLTEAHLNPEDELRKLKVRFDTW  1323

Query  482   KKDYGVRLKETKVISHKLGSEEGA---SDKMKKKWWG  583
             KKD+ VRL+ETK++ +KL + + A    D+ ++ WWG
Sbjct  1324  KKDFKVRLRETKLVLNKLCAMDSAEKEKDRTRRNWWG  1360



>ref|XP_010905050.1| PREDICTED: myosin-1 [Elaeis guineensis]
Length=1266

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 125/217 (58%), Gaps = 41/217 (19%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN IL Q++Q YE RWSEY+ KMKSMEE WQKQ+ SLQ SL+ AKKSLA DD A   
Sbjct  1050  KEEENAILKQQVQHYEMRWSEYDAKMKSMEEKWQKQLTSLQVSLAAAKKSLAADDLASQQ  1109

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRA---GL------------------  325
              R   + +  S D E T   G +    E    +P  A   GL                  
Sbjct  1110  GRLDISPLQYSYDSEDTMSAGTHTP--EGTPAKPSHASDAGLVRNSNGTQSAVSHLVASD  1167

Query  326   -----------SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMF  472
                          +  L +EFEQ+ QVF DDA+FL++VKSG + +++NP  EL +LK  F
Sbjct  1168  AGFVRNSDGTHGAVSHLVKEFEQQRQVFEDDARFLLKVKSGHSGSSINPAEELHKLKARF  1227

Query  473   ESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWWG  583
              +WKKDY VRL+ETK++ HKLGS E   ++ +K+WWG
Sbjct  1228  VTWKKDYKVRLRETKIVLHKLGSPE---ERTRKRWWG  1261



>ref|XP_009412435.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1225

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 120/191 (63%), Gaps = 15/191 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN IL QRL+ Y+ RWSEYELKMKSME+ WQKQ+ SLQS+L+ A+KSL  D + R  
Sbjct  1036  KEEENAILQQRLKHYDTRWSEYELKMKSMEQTWQKQLTSLQSTLAAARKSLTSDMANRPG  1095

Query  221   D---ASVNASDDKESTWDIGN----NRTALENNGVRPVRAG----LSVIGQLAEEFEQRS  367
                 ++VN   D E T    N    +  A ++ G   VR+     ++VI  L  EFEQ+ 
Sbjct  1096  QLNMSAVNNCYDSEDTISTVNQTPEDTPAKQSIGAEEVRSNDSKEIAVI-HLVNEFEQQR  1154

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             QVF DDA F+VE KSG + + +NPD EL+ LK  F +WKK Y +RL+ETK    K G+ E
Sbjct  1155  QVFEDDAGFIVEAKSGQSSSKINPDEELQNLKARFSTWKKVYKLRLRETKASLQKFGNPE  1214

Query  548   GASDKMKKKWW  580
                +K  KKWW
Sbjct  1215  ---EKASKKWW  1222



>gb|AEM05969.1| myosin VIII E [Physcomitrella patens]
Length=1369

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 121/219 (55%), Gaps = 38/219 (17%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  + Q++  YE RW EYE KM SMEE+WQKQM SLQ SLS AK+SLA DD +   
Sbjct  1146  KEEENASMRQKILHYEARWMEYEAKMTSMEEMWQKQMSSLQLSLSAAKRSLATDDYSMLQ  1205

Query  212   -------------------RNSDASVNASDDKESTWDIGN-----------NRTALENNG  301
                                R     +   DD+E  WD              NR  L    
Sbjct  1206  TPTKDHDSINDRFSAGKHQRTKRQLLPPPDDEEFDWDDATTNGTRSPDQFYNRYLLPGRE  1265

Query  302   VRPVR----AGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHM  469
                 R    A  SV+  L  EF+ R+QVF DDA FL+EVKSGLTEA L+P+ ELR+L+  
Sbjct  1266  CSTPRGDVDAARSVVNHLVREFDHRTQVFNDDADFLIEVKSGLTEAPLDPEEELRKLRMR  1325

Query  470   FESWKKDYGVRLKETKVISHKLGSEEGA-SDKMKKKWWG  583
             F++WKKD+  RL+ETK++  +L + + A  +K +KKWW 
Sbjct  1326  FDTWKKDFKTRLRETKLVLQRLCNVDSAEKEKTRKKWWS  1364



>ref|XP_010905572.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1243

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 129/217 (59%), Gaps = 42/217 (19%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN IL Q+LQQYE RWSEYE KMK MEE WQKQ+ SLQ SL+ A+KSLA DD A + 
Sbjct  1028  KEEENAILKQQLQQYEMRWSEYEAKMKFMEETWQKQLSSLQVSLAAARKSLADDDMASHQ  1087

Query  221   ---DAS-VNASDDKESTWDIGN--------NRTALENNGVRPVR----------------  316
                DAS V  S D E     G          R+   + GV  VR                
Sbjct  1088  GKLDASPVQHSYDSEDAISAGTRTPEGTPAKRSHACDAGV--VRNSNGTWSAVKHLDASD  1145

Query  317   AGL--------SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMF  472
             AGL        S +  L +EFEQ++QVF DDA FLVEVKS   ++++NPD EL++LK  F
Sbjct  1146  AGLIRYSNGTQSAVSHLVKEFEQQTQVFEDDAVFLVEVKSR-QDSSINPDEELQKLKARF  1204

Query  473   ESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWWG  583
              +WKKDY VRLKETK+   KLG+ E   ++ +K+WWG
Sbjct  1205  VTWKKDYKVRLKETKIALQKLGNPE---ERTRKRWWG  1238



>ref|XP_006657835.1| PREDICTED: myosin-2-like [Oryza brachyantha]
Length=1235

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 118/200 (59%), Gaps = 27/200 (14%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDS----  208
             K+EEN +L Q+L QYE +WSEYE KMKSMEE W+KQ+ SLQ SL  AKKSL  DD     
Sbjct  1039  KEEENAMLKQQLDQYEKKWSEYEAKMKSMEEAWKKQLSSLQLSLVAAKKSLTSDDVATRA  1098

Query  209   -------------ARNSDASVNASDDKESTWDIGNN--RTALENNGVRPVRAGLSVIGQL  343
                          + ++    +  +  E  +   N   R A  N+  R     L+ +  L
Sbjct  1099  ARTDAAPTHAHYDSEDTSTGTHTPEGTEFKYQTHNPEARVAAPNSDRR-----LNAVNHL  1153

Query  344   AEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVI  523
             A+EFE R QVF DDA FLV VKSG   +N+NPD ELR+LK  F +WKKDY  RLKETKV 
Sbjct  1154  AKEFEDRRQVFEDDAGFLVAVKSGQVGSNMNPDDELRKLKDRFATWKKDYKSRLKETKVN  1213

Query  524   SHKLGSEEGASDKMKKKWWG  583
               K+G+ E   +K +K+WWG
Sbjct  1214  LQKVGNHE---EKSRKRWWG  1230



>ref|XP_007021262.1| Myosin 2 isoform 2 [Theobroma cacao]
 gb|EOY12787.1| Myosin 2 isoform 2 [Theobroma cacao]
Length=1220

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 119/194 (61%), Gaps = 16/194 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K++EN  L ++LQQYE RW EYE KMKSMEE+WQKQM SLQSSL+ A+KSLA D +    
Sbjct  1024  KEQENATLREQLQQYEARWLEYESKMKSMEEMWQKQMASLQSSLAAARKSLAADSTTGQL  1083

Query  212   -RNSDASVNASDDKESTW---DIGNNRTALENNGVRPVRAG------LSVIGQLAEEFEQ  361
              R   AS    D ++ +      G N T +  +G  P   G      L+ +  L +E EQ
Sbjct  1084  GRVDVASPRCYDSEDMSMGSRTPGGN-TPVLYSGAMPDFVGGRENGSLNAVSNLVKELEQ  1142

Query  362   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS  541
             R Q F DDAK L+EV++    +  NPD ELRRLK  FE+WKKDY  RL+ETK   HK G 
Sbjct  1143  RKQTFDDDAKSLIEVRTANPGSVTNPDDELRRLKLRFETWKKDYKTRLRETKARLHKRGH  1202

Query  542   EEGASDKMKKKWWG  583
              E  SDK ++KWWG
Sbjct  1203  PE--SDKARRKWWG  1214



>ref|XP_007021261.1| Myosin 2 isoform 1 [Theobroma cacao]
 gb|EOY12786.1| Myosin 2 isoform 1 [Theobroma cacao]
Length=1221

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 119/194 (61%), Gaps = 16/194 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K++EN  L ++LQQYE RW EYE KMKSMEE+WQKQM SLQSSL+ A+KSLA D +    
Sbjct  1025  KEQENATLREQLQQYEARWLEYESKMKSMEEMWQKQMASLQSSLAAARKSLAADSTTGQL  1084

Query  212   -RNSDASVNASDDKESTW---DIGNNRTALENNGVRPVRAG------LSVIGQLAEEFEQ  361
              R   AS    D ++ +      G N T +  +G  P   G      L+ +  L +E EQ
Sbjct  1085  GRVDVASPRCYDSEDMSMGSRTPGGN-TPVLYSGAMPDFVGGRENGSLNAVSNLVKELEQ  1143

Query  362   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS  541
             R Q F DDAK L+EV++    +  NPD ELRRLK  FE+WKKDY  RL+ETK   HK G 
Sbjct  1144  RKQTFDDDAKSLIEVRTANPGSVTNPDDELRRLKLRFETWKKDYKTRLRETKARLHKRGH  1203

Query  542   EEGASDKMKKKWWG  583
              E  SDK ++KWWG
Sbjct  1204  PE--SDKARRKWWG  1215



>ref|XP_008806763.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1252

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 122/217 (56%), Gaps = 41/217 (19%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN IL Q+LQ YE RWSEYE KMKSMEE W+KQ+ SLQ SL+ AKKSL  DD A   
Sbjct  1036  KEEENAILKQQLQHYEMRWSEYEAKMKSMEETWKKQLTSLQVSLAAAKKSLTADDIASPQ  1095

Query  212   -RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRA---GL------------------  325
              R   + +  S D E T   G +    E    +P  A   GL                  
Sbjct  1096  GRLDISPLQYSFDSEDTMFAGTHTP--EGTPAKPFHASDAGLVRNSDGTQSAASHLDASD  1153

Query  326   -----------SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMF  472
                        S +  L +EFEQ+ QVF DDA FL+EVKSG + ++ NPD EL +LK  F
Sbjct  1154  AGFARNSNGTQSAVSHLVKEFEQQRQVFEDDAGFLLEVKSGQSGSSRNPDEELHKLKARF  1213

Query  473   ESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWWG  583
              +WKKD+ VRL+ETK+   KLG+ E   ++ +K+WWG
Sbjct  1214  VTWKKDFKVRLRETKIALRKLGNPE---ERTRKRWWG  1247



>ref|XP_010062907.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 ref|XP_010062908.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 gb|KCW70053.1| hypothetical protein EUGRSUZ_F03356 [Eucalyptus grandis]
Length=1222

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 123/196 (63%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L + LQQ+E +WSEYE +MKSMEE WQKQM SLQ SL+ A+KSL  DD+    
Sbjct  1029  KEEENAALREELQQFETKWSEYESRMKSMEETWQKQMASLQMSLAAARKSLMTDDNGGQP  1088

Query  212   RNSDASVNASD-DKESTWDIGNNRTALE-----NNGVRPVRAG------LSVIGQLAEEF  355
             +  D +++  D D E T  +G+           +N V   RAG      L+ +  L +EF
Sbjct  1089  KRPDVALSPRDYDSEDTTSMGSRTPGGSMPVKFSNAVTDGRAGRDTNGTLNAVSDLMKEF  1148

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R Q F DDA+ LVEV+S L  +N +PD ELR+LK  FESWKK+Y VRL+ETKV   K 
Sbjct  1149  EIRKQTFDDDARSLVEVRSELA-SNASPDEELRKLKVRFESWKKEYKVRLRETKVRLRKR  1207

Query  536   GSEEGASDKMKKKWWG  583
             G  +  +DK ++KWWG
Sbjct  1208  GHLD--ADKGRRKWWG  1221



>ref|XP_011029402.1| PREDICTED: myosin-2-like [Populus euphratica]
Length=1199

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 119/195 (61%), Gaps = 17/195 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L  +LQQ E RW +YE KMK+MEE+WQ QM SLQ+SL+ A+KSLA D++A   
Sbjct  1005  KEEENAALKDQLQQNEKRWLDYEAKMKAMEEMWQVQMASLQTSLAAARKSLAADNTAGQP  1064

Query  212   --RNSDASVNASDDK-----ESTWDIGNNRTALENN-----GVRPVRAGLSVIGQLAEEF  355
                +S  S +  D +     ES    GN  +   N       VR     L  +  L  EF
Sbjct  1065  GKLDSSTSPHYYDSEDYVSTESRTPGGNTPSIFANTFPDLRAVRENNGPLHAVSNLTREF  1124

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             EQ+ Q F D+ K LVE ++G + +N+NPD ELRRLK  FE+WKKDY VRL+ETKV  HKL
Sbjct  1125  EQQKQNFDDNVKALVEARAGQSASNMNPDEELRRLKLRFETWKKDYKVRLRETKVRLHKL  1184

Query  536   GSEEGASDKMKKKWW  580
             G   G  D+ ++KWW
Sbjct  1185  G--HGEVDRNRRKWW  1197



>ref|XP_002316933.2| hypothetical protein POPTR_0011s12670g [Populus trichocarpa]
 gb|EEE97545.2| hypothetical protein POPTR_0011s12670g [Populus trichocarpa]
Length=1191

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 123/201 (61%), Gaps = 29/201 (14%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L  +LQQ E RW +YE KMK+MEE+WQ QM SLQ+SL+ A+KSLA D++A   
Sbjct  997   KEEENAALKDQLQQNEKRWLDYEAKMKAMEEMWQVQMASLQTSLAAARKSLAADNTAGQP  1056

Query  212   --RNSDASVNASDDK-----ESTWDIGNN-----------RTALENNGVRPVRAGLSVIG  337
                +S  S +  D +     ES    GN            R   ENNG  PV A    + 
Sbjct  1057  GKLDSSTSPHYYDSEDYVSTESRTPGGNTPNIFANTFPDLRAVRENNG--PVHA----VS  1110

Query  338   QLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK  517
              L +EFEQ+ Q F D+ K LVEV++G + +N+NPD ELRRLK  FE+WKKDY VRL+ETK
Sbjct  1111  NLTKEFEQQKQNFDDNVKALVEVRAGQSASNMNPDEELRRLKLGFETWKKDYKVRLRETK  1170

Query  518   VISHKLGSEEGASDKMKKKWW  580
                HKLG   G  D+ ++KWW
Sbjct  1171  ARLHKLG--HGEVDRNRRKWW  1189



>gb|AEM05967.1| myosin VIII B [Physcomitrella patens]
Length=1418

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 125/220 (57%), Gaps = 40/220 (18%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+E+N +L QR+Q YEN+W EYE KM SMEE+WQKQM +LQ SL+ AKKS+A ++SA   
Sbjct  1187  KEEDNALLRQRIQHYENQWVEYEAKMSSMEEMWQKQMSTLQLSLAAAKKSIATEESATLQ  1246

Query  221   DASVNASDDKESTWDIGNNRTA---------------------------LENNGVR----  307
              +S + S+D+++     N  T                            +ENN  +    
Sbjct  1247  TSSKDGSEDQKTVAGKHNRNTRPLLPTEEEKFHKVIQDLDDEAAKVPENVENNSNKFLHA  1306

Query  308   ---------PVRAGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRL  460
                       V AG S + QL  EF+ R QVF DD  FLVEVKSG T A+L+P+ ELR+L
Sbjct  1307  GSELGSSQGEVAAGHSYVTQLDREFDHRKQVFTDDIDFLVEVKSGQTTAHLSPEDELRKL  1366

Query  461   KHMFESWKKDYGVRLKETKVISHKLGSEEGASDKMKKKWW  580
             K  F++WKKD+ VRL+ETK +  KLG  + +   ++ K W
Sbjct  1367  KTRFDAWKKDFKVRLRETKAVLSKLGHTDSSDKWIRGKKW  1406



>ref|XP_010278387.1| PREDICTED: myosin-1 isoform X3 [Nelumbo nucifera]
Length=1053

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 123/198 (62%), Gaps = 19/198 (10%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L  +LQQYE RW  YE KMKSMEE+WQKQ+ SLQ SL+ AKKSL  D+ A   
Sbjct  851   KEEENAKLQLQLQQYEQRWLHYEAKMKSMEEMWQKQITSLQMSLAAAKKSLVADEIAGQL  910

Query  212   -RNSDASVNASDDKESTWDIGNN------RTALEN----NGVRPVRA---GLSVIGQLAE  349
              R   + V  ++  E +  +G        R  L N    +G  P R    GL  + QL +
Sbjct  911   GRPVASPVPHNNGYEESMSVGTQNPDDTMRIILPNPLSGSGNVPGRVSDTGLIAVNQLRK  970

Query  350   EFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISH  529
             EFE+R QVF DD + ++EVKSG + +N NPD ELR+LK  F +WKKDY +RL ETK +SH
Sbjct  971   EFEKRKQVFDDDLECILEVKSGQSTSNRNPDDELRKLKLRFMAWKKDYKIRLWETKAMSH  1030

Query  530   KLGSEEGASDKMKKKWWG  583
             KLG+ +   DK  KKWWG
Sbjct  1031  KLGNSD--MDKNHKKWWG  1046



>ref|XP_010278386.1| PREDICTED: myosin-2 isoform X2 [Nelumbo nucifera]
Length=1084

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 123/198 (62%), Gaps = 19/198 (10%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L  +LQQYE RW  YE KMKSMEE+WQKQ+ SLQ SL+ AKKSL  D+ A   
Sbjct  882   KEEENAKLQLQLQQYEQRWLHYEAKMKSMEEMWQKQITSLQMSLAAAKKSLVADEIAGQL  941

Query  212   -RNSDASVNASDDKESTWDIGNN------RTALEN----NGVRPVRA---GLSVIGQLAE  349
              R   + V  ++  E +  +G        R  L N    +G  P R    GL  + QL +
Sbjct  942   GRPVASPVPHNNGYEESMSVGTQNPDDTMRIILPNPLSGSGNVPGRVSDTGLIAVNQLRK  1001

Query  350   EFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISH  529
             EFE+R QVF DD + ++EVKSG + +N NPD ELR+LK  F +WKKDY +RL ETK +SH
Sbjct  1002  EFEKRKQVFDDDLECILEVKSGQSTSNRNPDDELRKLKLRFMAWKKDYKIRLWETKAMSH  1061

Query  530   KLGSEEGASDKMKKKWWG  583
             KLG+ +   DK  KKWWG
Sbjct  1062  KLGNSD--MDKNHKKWWG  1077



>ref|XP_010278385.1| PREDICTED: myosin-2 isoform X1 [Nelumbo nucifera]
Length=1248

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 123/198 (62%), Gaps = 19/198 (10%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+EEN  L  +LQQYE RW  YE KMKSMEE+WQKQ+ SLQ SL+ AKKSL  D+ A   
Sbjct  1046  KEEENAKLQLQLQQYEQRWLHYEAKMKSMEEMWQKQITSLQMSLAAAKKSLVADEIAGQL  1105

Query  212   -RNSDASVNASDDKESTWDIGNN------RTALEN----NGVRPVRA---GLSVIGQLAE  349
              R   + V  ++  E +  +G        R  L N    +G  P R    GL  + QL +
Sbjct  1106  GRPVASPVPHNNGYEESMSVGTQNPDDTMRIILPNPLSGSGNVPGRVSDTGLIAVNQLRK  1165

Query  350   EFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISH  529
             EFE+R QVF DD + ++EVKSG + +N NPD ELR+LK  F +WKKDY +RL ETK +SH
Sbjct  1166  EFEKRKQVFDDDLECILEVKSGQSTSNRNPDDELRKLKLRFMAWKKDYKIRLWETKAMSH  1225

Query  530   KLGSEEGASDKMKKKWWG  583
             KLG+ +   DK  KKWWG
Sbjct  1226  KLGNSD--MDKNHKKWWG  1241



>tpg|DAA63129.1| TPA: hypothetical protein ZEAMMB73_109792 [Zea mays]
Length=1238

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 122/196 (62%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN +L Q+L+QYE +WSEYE KMK MEE W++Q+ SLQ SL +AKKSLA DD+A  +
Sbjct  1041  KEEENVMLKQQLEQYERKWSEYEAKMKCMEEAWKRQLSSLQLSLVVAKKSLAADDAATRA  1100

Query  221   D----ASVNASDDKESTWDIGNNRTAL------ENNGVRPVRAG-----LSVIGQLAEEF  355
                     +A  D E T   G     +       +N    V AG     ++ +  LA+EF
Sbjct  1101  ARTDCTPTHAQYDSEDTLSTGTRTPEVIESKHDNHNPEAKVSAGNSDRRVNAVNHLAKEF  1160

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R QVF DDA FLV V+SG   +N+NPD ELR+LK  F +WKKDY  RLKETKV   K+
Sbjct  1161  EDRRQVFEDDAGFLVAVRSGQIGSNMNPDEELRKLKDRFATWKKDYKSRLKETKVNLSKV  1220

Query  536   GSEEGASDKMKKKWWG  583
             G+ +   +K +K+WWG
Sbjct  1221  GTHD---EKSRKRWWG  1233



>ref|XP_008654108.1| PREDICTED: myosin-1-like [Zea mays]
Length=1261

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 122/196 (62%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN +L Q+L+QYE +WSEYE KMK MEE W++Q+ SLQ SL +AKKSLA DD+A  +
Sbjct  1064  KEEENVMLKQQLEQYERKWSEYEAKMKCMEEAWKRQLSSLQLSLVVAKKSLAADDAATRA  1123

Query  221   D----ASVNASDDKESTWDIGNNRTAL------ENNGVRPVRAG-----LSVIGQLAEEF  355
                     +A  D E T   G     +       +N    V AG     ++ +  LA+EF
Sbjct  1124  ARTDCTPTHAQYDSEDTLSTGTRTPEVIESKHDNHNPEAKVSAGNSDRRVNAVNHLAKEF  1183

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R QVF DDA FLV V+SG   +N+NPD ELR+LK  F +WKKDY  RLKETKV   K+
Sbjct  1184  EDRRQVFEDDAGFLVAVRSGQIGSNMNPDEELRKLKDRFATWKKDYKSRLKETKVNLSKV  1243

Query  536   GSEEGASDKMKKKWWG  583
             G+ +   +K +K+WWG
Sbjct  1244  GTHD---EKSRKRWWG  1256



>gb|KDO74222.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1193

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 111/186 (60%), Gaps = 27/186 (15%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+          +AR S
Sbjct  1021  KEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLA----------AARKS  1070

Query  221   DASVNASDDKES------TWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGD  382
              AS N               D G+ R   E+NG       L+ +  L +EFEQR Q F D
Sbjct  1071  LASDNTPGGSTPMKFLNIVPDAGSGR---ESNG------SLTAVNHLTKEFEQRRQNFDD  1121

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDK  562
             DAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV  +KLG  E   +K
Sbjct  1122  DAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSE--VEK  1179

Query  563   MKKKWW  580
              ++KWW
Sbjct  1180  TRRKWW  1185



>ref|XP_006464677.1| PREDICTED: myosin-2-like isoform X6 [Citrus sinensis]
Length=1193

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 111/186 (60%), Gaps = 27/186 (15%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+          +AR S
Sbjct  1021  KEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLA----------AARKS  1070

Query  221   DASVNASDDKES------TWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGD  382
              AS N               D G+ R   E+NG       L+ +  L +EFEQR Q F D
Sbjct  1071  LASDNTPGGSTPMKFLNIVPDAGSGR---ESNG------SLTAVNHLTKEFEQRRQNFDD  1121

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDK  562
             DAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV  +KLG  E   +K
Sbjct  1122  DAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSE--VEK  1179

Query  563   MKKKWW  580
              ++KWW
Sbjct  1180  TRRKWW  1185



>ref|XP_006451994.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451995.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65234.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65235.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1193

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 111/186 (60%), Gaps = 27/186 (15%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+          +AR S
Sbjct  1021  KEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLA----------AARKS  1070

Query  221   DASVNASDDKES------TWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGD  382
              AS N               D G+ R   E+NG       L+ +  L +EFEQR Q F D
Sbjct  1071  LASDNTPGGSTPMKFLNIVPDAGSGR---ESNG------SLTAVNHLTKEFEQRRQNFDD  1121

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDK  562
             DAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV  +KLG  E   +K
Sbjct  1122  DAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSE--VEK  1179

Query  563   MKKKWW  580
              ++KWW
Sbjct  1180  TRRKWW  1185



>dbj|BAL60532.2| myosin VIII [Marchantia polymorpha]
Length=1365

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = +2

Query  317   AGLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYG  496
             AG S++G L +EF+QR+QVF DDA FLVEVKSG TEANLNPD ELR+LKH F+ WKKD+ 
Sbjct  1273  AGRSLVGHLVKEFDQRTQVFNDDADFLVEVKSGQTEANLNPDEELRKLKHRFDVWKKDFK  1332

Query  497   VRLKETKVISHKLGSEEGASDKMKKKWWG  583
             VRL+ETK + HKLGS + A +K KKKWWG
Sbjct  1333  VRLRETKTVLHKLGSMD-AVEKTKKKWWG  1360


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQM  151
             K+E+N +L  RLQQ+E RW E++ KM+SMEE+WQKQM
Sbjct  1145  KEEDNALLKHRLQQFEARWLEHQAKMESMEEMWQKQM  1181



>gb|KDO74224.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1048

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 120/195 (62%), Gaps = 17/195 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSLA D++    
Sbjct  848   KEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEP  907

Query  221   ---DASVNAS-DDKESTWDIGN----NRTALENNGVRP-------VRAGLSVIGQLAEEF  355
                DAS +    D E T  +G+      T ++   + P           L+ +  L +EF
Sbjct  908   GRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEF  967

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             EQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV  +KL
Sbjct  968   EQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKL  1027

Query  536   GSEEGASDKMKKKWW  580
             G  E   +K ++KWW
Sbjct  1028  GQSE--VEKTRRKWW  1040



>ref|XP_006464672.1| PREDICTED: myosin-2-like isoform X1 [Citrus sinensis]
 ref|XP_006464673.1| PREDICTED: myosin-2-like isoform X2 [Citrus sinensis]
 ref|XP_006464674.1| PREDICTED: myosin-2-like isoform X3 [Citrus sinensis]
 ref|XP_006464675.1| PREDICTED: myosin-2-like isoform X4 [Citrus sinensis]
 ref|XP_006464676.1| PREDICTED: myosin-2-like isoform X5 [Citrus sinensis]
Length=1221

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 120/195 (62%), Gaps = 17/195 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSLA D++    
Sbjct  1021  KEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEP  1080

Query  221   ---DASVNAS-DDKESTWDIGN----NRTALENNGVRP-------VRAGLSVIGQLAEEF  355
                DAS +    D E T  +G+      T ++   + P           L+ +  L +EF
Sbjct  1081  GRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEF  1140

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             EQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV  +KL
Sbjct  1141  EQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKL  1200

Query  536   GSEEGASDKMKKKWW  580
             G  E   +K ++KWW
Sbjct  1201  GQSE--VEKTRRKWW  1213



>gb|KDO74218.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74219.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74220.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74221.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1221

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 120/195 (62%), Gaps = 17/195 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSLA D++    
Sbjct  1021  KEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEP  1080

Query  221   ---DASVNAS-DDKESTWDIGN----NRTALENNGVRP-------VRAGLSVIGQLAEEF  355
                DAS +    D E T  +G+      T ++   + P           L+ +  L +EF
Sbjct  1081  GRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEF  1140

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             EQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV  +KL
Sbjct  1141  EQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKL  1200

Query  536   GSEEGASDKMKKKWW  580
             G  E   +K ++KWW
Sbjct  1201  GQSE--VEKTRRKWW  1213



>ref|XP_006451996.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451997.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65236.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65237.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1221

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 120/195 (62%), Gaps = 17/195 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQY+ +W EYE KMKSMEE+WQKQM SLQ SL+ A+KSLA D++    
Sbjct  1021  KEEENAALREQLQQYDAKWLEYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEP  1080

Query  221   ---DASVNAS-DDKESTWDIGN----NRTALENNGVRP-------VRAGLSVIGQLAEEF  355
                DAS +    D E T  +G+      T ++   + P           L+ +  L +EF
Sbjct  1081  GRLDASTSPHLYDSEDTMSMGSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEF  1140

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             EQR Q F DDAK L+E+K+    + ++PD ELR+LK  FE+WKKDY  RL+E KV  +KL
Sbjct  1141  EQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKL  1200

Query  536   GSEEGASDKMKKKWW  580
             G  E   +K ++KWW
Sbjct  1201  GQSE--VEKTRRKWW  1213



>gb|KHG19058.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1038

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 118/197 (60%), Gaps = 21/197 (11%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K++EN  L ++LQ+ E RW +YE KMKSMEE+WQKQM SLQ+SL+ A+KSLA D+ A   
Sbjct  841   KEQENATLREQLQKSEARWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSLAADNGAGQL  900

Query  212   --------RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEE  352
                     R  D+  N S    +T   G N   L +  +  V  G     L+ +G L +E
Sbjct  901   GRADVLSPRCYDSEDNVSMGSRTT---GGNTPVLFSGAMPDVVGGRENGSLNALGNLLKE  957

Query  353   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
             FEQR Q F  DAK L++++     +N+NPD ELR L+  FE+WKKDY +RLK  K   HK
Sbjct  958   FEQRKQNFDADAKSLIDIRVPQQASNVNPDDELRTLRLRFETWKKDYKLRLKAAKARLHK  1017

Query  533   LGSEEGASDKMKKKWWG  583
              G  E  SDK ++KWWG
Sbjct  1018  RGHPE--SDKARRKWWG  1032



>gb|KHG13556.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1072

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 118/197 (60%), Gaps = 21/197 (11%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K++EN  L ++LQ+ E RW +YE KMKSMEE+WQKQM SLQ+SL+ A+KSLA D+ A   
Sbjct  875   KEQENATLREQLQKSEARWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSLAADNGAGQL  934

Query  212   --------RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEE  352
                     R  D+  N S    +T   G N   L +  +  V  G     L+ +G L +E
Sbjct  935   GRADVLSPRCYDSEDNVSMGSRTT---GGNTPVLFSGAMPDVVGGRENGSLNALGNLLKE  991

Query  353   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
             FEQR Q F  DAK L++++     +N+NPD ELR L+  FE+WKKDY +RLK  K   HK
Sbjct  992   FEQRKQNFDADAKSLIDIRVPQQASNVNPDDELRTLRLRFETWKKDYKLRLKAAKARLHK  1051

Query  533   LGSEEGASDKMKKKWWG  583
              G  E  SDK ++KWWG
Sbjct  1052  RGHPE--SDKARRKWWG  1066



>gb|KJB62696.1| hypothetical protein B456_009G430900 [Gossypium raimondii]
 gb|KJB62697.1| hypothetical protein B456_009G430900 [Gossypium raimondii]
Length=1201

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 118/197 (60%), Gaps = 21/197 (11%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K+ EN  L ++LQ+ E RW +YE KMKSMEE+WQKQM SLQ+SL+ A+KSLA D+ A   
Sbjct  1004  KEHENATLREQLQKSEARWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSLAADNGAGQL  1063

Query  212   --------RNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAG-----LSVIGQLAEE  352
                     R  D+  N S    +T   G N   L +  +  V  G     L+ +G L +E
Sbjct  1064  GRADVLSPRCYDSEDNVSMGSRTT---GGNTPVLFSGAMPDVVGGRENGSLNALGNLLKE  1120

Query  353   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
             FEQR Q F  DAK L++++     +N+NPD ELR L+  FE+WKKDY +RLKE K   HK
Sbjct  1121  FEQRKQNFDADAKSLMDLRVPQQASNMNPDDELRTLRLRFETWKKDYKLRLKEAKARLHK  1180

Query  533   LGSEEGASDKMKKKWWG  583
              G  E  SDK ++KWWG
Sbjct  1181  RGHPE--SDKARRKWWG  1195



>ref|XP_004294488.1| PREDICTED: myosin-2 [Fragaria vesca subsp. vesca]
Length=1123

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 118/188 (63%), Gaps = 17/188 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++LQQ+E RWSEYE +MKSM++VWQKQM SLQ SL+ A+KSL  +++A   
Sbjct  943   KEEENADLQEQLQQFETRWSEYEARMKSMQDVWQKQMSSLQVSLAAARKSLTANNTA-GQ  1001

Query  221   DASVNASD---DKESTWDIGNNRTALEN--NGV-RPVRAGLSVIGQLAEEFEQRSQVFGD  382
                V+AS    D E    +G+         NGV R     LS +G L +EF+QR Q F D
Sbjct  1002  PGRVDASSPRYDSEDALSMGSRTPGASTPINGVARETNGSLSAVGNLVKEFDQRRQTFDD  1061

Query  383   DAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETK--VISHKLGSEEGAS  556
             + K L+EVK+G      N D EL++LKH FESWKK+Y  RL+ETK  +  H+ G  +   
Sbjct  1062  EVKALIEVKTG------NTDEELKKLKHQFESWKKEYKARLRETKTRLRLHRHGHSD--D  1113

Query  557   DKMKKKWW  580
             +K ++KWW
Sbjct  1114  EKKRRKWW  1121



>ref|XP_010101784.1| Myosin-2 heavy chain [Morus notabilis]
 gb|EXB89639.1| Myosin-2 heavy chain [Morus notabilis]
Length=1122

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 118/192 (61%), Gaps = 17/192 (9%)
 Frame = +2

Query  53    NDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA----RNS  220
             N  L ++LQQ+E RWS+YE KMKSMEE+WQKQM SLQ SL+ A+KSL +D S     R+ 
Sbjct  926   NAALREQLQQFETRWSDYEAKMKSMEEMWQKQMASLQMSLAAARKSLGVDHSVGQPGRHD  985

Query  221   DASVNASDDKESTWDIGNNR----TALENN------GV-RPVRAGLSVIGQLAEEFEQRS  367
              A+     D E    +G+      T L+ +      GV R     LS +  L +EFEQ+ 
Sbjct  986   AATSPRYYDSEDATSMGSRTPGASTPLKYSNSGHDVGVGRDTNGTLSAVSNLMKEFEQQR  1045

Query  368   QVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEE  547
             Q F +DAK LV+VK G + +N N D ELR L+  FE WKK+Y VRL+ETK   H+LG  E
Sbjct  1046  QAFDNDAKALVDVKPGQSASNKNSDAELRMLRSRFEMWKKEYKVRLRETKAKLHRLGHSE  1105

Query  548   GASDKMKKKWWG  583
               +++ ++KWWG
Sbjct  1106  --AERSRRKWWG  1115



>ref|XP_002525757.1| myosin vIII, putative [Ricinus communis]
 gb|EEF36593.1| myosin vIII, putative [Ricinus communis]
Length=1223

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 120/197 (61%), Gaps = 18/197 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K++EN  L ++LQQ+E RWSEYE KMK+ME+ WQ QM SLQ+SL+ A+KSLA D +A   
Sbjct  1017  KEDENASLREQLQQFERRWSEYETKMKTMEQTWQMQMESLQASLAAARKSLAADSTAGQH  1076

Query  218   ------SDASVNASDDKESTW--DIGNNRTALENNGVRPVRAG------LSVIGQLAEEF  355
                   S      S+D  ST     G+N     +  +  V+ G      ++ +  LA+EF
Sbjct  1077  GKLESFSSPHYYDSEDNMSTGVQTPGSNTPNKSSIAIPDVKLGRETNGSINAVSILAKEF  1136

Query  356   EQRSQVFGDDAKFLVEVKSGLTEA-NLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
             EQ+ Q F D AK L EVK G   A + NPD ELR+LK  FE WKKDY VRL+ETKV  HK
Sbjct  1137  EQQRQNFDDHAKALAEVKLGQQSASDKNPDEELRKLKIRFEDWKKDYKVRLRETKVRLHK  1196

Query  533   LGSEEGASDKMKKKWWG  583
             +G  EG  D+  ++WWG
Sbjct  1197  VGRGEG--DRRTRRWWG  1211



>ref|XP_010324344.1| PREDICTED: myosin-2-like isoform X2 [Solanum lycopersicum]
Length=1177

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 113/194 (58%), Gaps = 15/194 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K++EN  L +++ Q+E R  EYE+KM+SMEE+WQKQM SLQ SL+ A+ SL   D+    
Sbjct  982   KEKENAALKEQVNQFETRCLEYEVKMRSMEEMWQKQMTSLQVSLAAARNSLTAADTTGRP  1041

Query  212   ---RNSDASVNASDDKESTWDIGNNRT--ALENNGV-----RPVRAGLSVIGQLAEEFEQ  361
                  S +      D  ++ D    RT  +  NN +     R V  GLS+I  LA EFEQ
Sbjct  1042  GKLEGSPSPQYYDSDDATSMDTPAGRTPVSFSNNSLGVVANREVNGGLSLISHLAMEFEQ  1101

Query  362   RSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGS  541
             R Q F ++A  +V +K G  ++  NP  E RRLKH FE WKK+Y VRLKETK   HKL  
Sbjct  1102  RKQNFDNEAMAIVHLKPGQLQSTNNPADEYRRLKHRFEEWKKEYKVRLKETKSKVHKLVH  1161

Query  542   EEGASDKMKKKWWG  583
              +    K ++KWWG
Sbjct  1162  SKAG--KSRRKWWG  1173



>ref|XP_009420769.1| PREDICTED: myosin-2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 111/196 (57%), Gaps = 26/196 (13%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EEN IL Q+LQ YE RWSEYELKMKSMEE WQKQ+ +LQ S +  +KS+  ++  +  
Sbjct  300  KEEENVILKQQLQAYETRWSEYELKMKSMEETWQKQLTALQMSFTAGRKSIVPEEMTKQP  359

Query  221  ----------------DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEE  352
                            D SV A   +++   + N   A++   VR      + + QL +E
Sbjct  360  GWPDASQTNHYYEAEDDESVGAQTPEDTLAKLPNASDAMQ---VRNNDTACNAVIQLIKE  416

Query  353  FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
            F+Q+ QVF  DA  L+EVKSG     +NP  ELR LK  F SWKKDY +RL++TK    K
Sbjct  417  FDQQRQVFDTDAGLLIEVKSG----AINPYEELRNLKSHFASWKKDYKMRLRDTKTALLK  472

Query  533  LGSEEGASDKMKKKWW  580
            L + E    +  K+WW
Sbjct  473  LVNPE---KRAYKRWW  485



>ref|XP_010324342.1| PREDICTED: myosin-2-like isoform X1 [Solanum lycopersicum]
Length=1178

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 109/195 (56%), Gaps = 16/195 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiak--kslalDDSAR  214
             K++EN  L +++ Q+E R  EYE+KM+SMEE+WQKQM SLQ     A      A D + R
Sbjct  982   KEKENAALKEQVNQFETRCLEYEVKMRSMEEMWQKQMTSLQQVSLAAARNSLTAADTTGR  1041

Query  215   -----NSDASVNASDDKESTWDIGNNRT--ALENNGV-----RPVRAGLSVIGQLAEEFE  358
                   S +      D  ++ D    RT  +  NN +     R V  GLS+I  LA EFE
Sbjct  1042  PGKLEGSPSPQYYDSDDATSMDTPAGRTPVSFSNNSLGVVANREVNGGLSLISHLAMEFE  1101

Query  359   QRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLG  538
             QR Q F ++A  +V +K G  ++  NP  E RRLKH FE WKK+Y VRLKETK   HKL 
Sbjct  1102  QRKQNFDNEAMAIVHLKPGQLQSTNNPADEYRRLKHRFEEWKKEYKVRLKETKSKVHKLV  1161

Query  539   SEEGASDKMKKKWWG  583
               +    K ++KWWG
Sbjct  1162  HSKAG--KSRRKWWG  1174



>ref|XP_009420767.1| PREDICTED: myosin-2-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009420768.1| PREDICTED: myosin-2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=499

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 111/196 (57%), Gaps = 26/196 (13%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+EEN IL Q+LQ YE RWSEYELKMKSMEE WQKQ+ +LQ S +  +KS+  ++  +  
Sbjct  307  KEEENVILKQQLQAYETRWSEYELKMKSMEETWQKQLTALQMSFTAGRKSIVPEEMTKQP  366

Query  221  ----------------DASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEE  352
                            D SV A   +++   + N   A++   VR      + + QL +E
Sbjct  367  GWPDASQTNHYYEAEDDESVGAQTPEDTLAKLPNASDAMQ---VRNNDTACNAVIQLIKE  423

Query  353  FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
            F+Q+ QVF  DA  L+EVKSG     +NP  ELR LK  F SWKKDY +RL++TK    K
Sbjct  424  FDQQRQVFDTDAGLLIEVKSG----AINPYEELRNLKSHFASWKKDYKMRLRDTKTALLK  479

Query  533  LGSEEGASDKMKKKWW  580
            L + E    +  K+WW
Sbjct  480  LVNPE---KRAYKRWW  492



>ref|XP_001775964.1| predicted protein [Physcomitrella patens]
 gb|EDQ59156.1| predicted protein [Physcomitrella patens]
Length=1017

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 119/187 (64%), Gaps = 9/187 (5%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EE  +  Q++Q YE +W+EYE K+ SMEE WQKQM +L  SL+ AKKS+A +++ +  
Sbjct  825   KEEEIVLQRQKIQHYEKQWAEYEAKISSMEEKWQKQMSTLHLSLAAAKKSIATEENTQEL  884

Query  221   D---ASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDDAK  391
             D   A V    ++ S   +        + G   V AG S + QL  EF+ R QVF DD  
Sbjct  885   DEESAKVTMDSEQNSNKFLHAGSELGSSQG--EVAAGHSYVVQLDREFDHRKQVFTDDID  942

Query  392   FLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDK--M  565
             FLVEVKSG T+A+LNP+ ELR+LK  F+ WK+D+ VRL+ETKV+ +KL S   ++D+   
Sbjct  943   FLVEVKSGQTQAHLNPEDELRKLKTRFDGWKRDFKVRLRETKVVLNKL-SHTDSTDRWIR  1001

Query  566   KKKW-WG  583
              KKW WG
Sbjct  1002  GKKWHWG  1008



>emb|CDP05853.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 109/185 (59%), Gaps = 18/185 (10%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+ EN  L +++Q++E RW EYE KMK+ME+ WQKQM SLQ SL+ AKKSL  D +A   
Sbjct  703  KETENAALREQVQEFEVRWLEYEGKMKAMEDTWQKQMASLQVSLAAAKKSLGADHTAVQP  762

Query  221  DASVNASD-----DKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQVFGDD  385
               ++        D E T   G      E NG      GL+ +G LA+EFE R Q+F +D
Sbjct  763  AGRLDGLTSPRYYDSEDTMSGGARTPGGEANG------GLNSVGHLAKEFENRKQIFDED  816

Query  386  AKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGASDKM  565
            AK +VEVKSG      NP  E RRLKH FE+WKKDY  RL+E K    K G  EG  +K 
Sbjct  817  AKAIVEVKSG-----QNPGEEYRRLKHRFEAWKKDYKARLREAKSRLQKHGHLEG--EKR  869

Query  566  KKKWW  580
             +KWW
Sbjct  870  NRKWW  874



>ref|XP_008454630.1| PREDICTED: myosin-2-like [Cucumis melo]
Length=1207

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 124/200 (62%), Gaps = 23/200 (12%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++++Q+E+R  EYE KMKSME++WQKQM SLQ SL+ AKK+LA +++A   
Sbjct  1005  KEEENAALREQVKQFESRRLEYEAKMKSMEDMWQKQMASLQMSLAAAKKTLAAENAA--P  1062

Query  221   DASVNASD------DKESTWDIGNNRTALEN----NGVRPVRAG------LSVIGQLAEE  352
                V+A +      D E T  +G+    +      +G+  V AG      L  +  L +E
Sbjct  1063  PGRVDACNSPPHYYDSEDTTSMGSRTPGVTTPKKASGISEVGAGREMNGTLVAVNNLVKE  1122

Query  353   FEQRSQVFGDDAKFLVEVKSGLTE--ANLNPDHELRRLKHMFESWKKDYGVRLKETKV-I  523
             FEQR   F DDAK L+E KSG T+  +N NPD E R++K  FE+WKK+Y  RL+ETK  +
Sbjct  1123  FEQRRIAFDDDAKALIEAKSGQTQMGSNANPDEEYRKIKVRFEAWKKEYKARLRETKAKV  1182

Query  524   SHKLGSEEGASDKMKKKWWG  583
              HK G  E   DK+++KWWG
Sbjct  1183  HHKHGHFE--VDKLRRKWWG  1200



>gb|EYU19161.1| hypothetical protein MIMGU_mgv1a000383mg [Erythranthe guttata]
Length=1199

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 121/190 (64%), Gaps = 15/190 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             K++EN  L +++QQ+E+RWSEYE KMKSMEE+WQKQM SLQ SL+ AKKSL  D++    
Sbjct  1010  KEKENAALREQVQQFESRWSEYETKMKSMEEMWQKQMASLQMSLAAAKKSLGTDNTTGQP  1069

Query  212   --RNSDASVNASDDKESTW----DIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQRSQV  373
                +   S +  D +E ++      G+  T + NNG      GL+ I  LA EFEQ  + 
Sbjct  1070  EKHHGAQSPSFYDSEEMSFGPHTPSGSTPTRILNNGTN-TNGGLNSISTLANEFEQSRRN  1128

Query  374   FGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSEEGA  553
             F  +A+ +VEVKS  T   +N   ++R LK+ FE+WKKD+ VRL+E K  +H+LG   G 
Sbjct  1129  FDHEAQAIVEVKSADT---VNSVEDIRSLKYKFEAWKKDFKVRLREAKAKAHRLGY--GD  1183

Query  554   SDKMKKKWWG  583
             ++K ++KWWG
Sbjct  1184  AEKYRRKWWG  1193



>ref|XP_011098363.1| PREDICTED: myosin-2-like [Sesamum indicum]
Length=1209

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 122/200 (61%), Gaps = 25/200 (13%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalD------  202
             K++EN  L +++QQ+E RW EYE KMKSMEE+WQKQM SLQ SL+ A+KSL         
Sbjct  1011  KEKENAALREQVQQFEARWPEYETKMKSMEEMWQKQMASLQMSLASAQKSLGAHNTIGQP  1070

Query  203   ---DSARNS------DASVNASDDKESTWDIGNNRTALENNGVR--PVR---AGLSVIGQ  340
                D A++       D S++ S   ++    G+      NNG+   P R    GL+ IG 
Sbjct  1071  GRLDGAQSPQFYDSEDMSMSLSMGTQTPG--GSTPMRFVNNGIEELPCRDTNGGLNPIGP  1128

Query  341   LAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKV  520
             L +EFE+R Q F ++A+ +VEVK G +  ++NP  +LRRLKH FESWKKDY VRLKE K 
Sbjct  1129  LMKEFERRRQNFDEEAQAIVEVKPGHS-PSVNPVEDLRRLKHRFESWKKDYKVRLKEAKA  1187

Query  521   ISHKLGSEEGASDKMKKKWW  580
              + KL   +   ++ ++KWW
Sbjct  1188  KAQKLVQND--PERHRRKWW  1205



>ref|XP_006362935.1| PREDICTED: myosin-2-like isoform X2 [Solanum tuberosum]
Length=1202

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 118/197 (60%), Gaps = 19/197 (10%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K++EN  L +++ Q E+RWS+YE++M+SMEE+WQKQM SLQ+SL  AKKSL +D+SA + 
Sbjct  1004  KEKENAALKEQVNQLESRWSDYEVRMRSMEEMWQKQMASLQASLVSAKKSLGVDNSASHP  1063

Query  218   -------SDASVNASD--------DKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEE  352
                    S     + D            +  I      ++  G+R +  GL V+  L+ E
Sbjct  1064  GKPEGSPSPCGYESEDTTTTMGTRTPGGSTPIEYASNGVDFGGIREINGGLCVVNYLSRE  1123

Query  353   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
             FE R Q F D+A  + ++KSG  ++  +P  + RRL+H F+ WKKDY  RLKETK+  HK
Sbjct  1124  FELRKQNFDDEAMAISQLKSGQLQST-SPAEDFRRLRHKFDEWKKDYKARLKETKLKVHK  1182

Query  533   LGSEEGASDKMKKKWWG  583
             LG  E  ++K ++ WWG
Sbjct  1183  LGYSE--AEKTRRNWWG  1197



>ref|XP_006362934.1| PREDICTED: myosin-2-like isoform X1 [Solanum tuberosum]
Length=1203

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 118/197 (60%), Gaps = 19/197 (10%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K++EN  L +++ Q E+RWS+YE++M+SMEE+WQKQM SLQ+SL  AKKSL +D+SA + 
Sbjct  1005  KEKENAALKEQVNQLESRWSDYEVRMRSMEEMWQKQMASLQASLVSAKKSLGVDNSASHP  1064

Query  218   -------SDASVNASD--------DKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEE  352
                    S     + D            +  I      ++  G+R +  GL V+  L+ E
Sbjct  1065  GKPEGSPSPCGYESEDTTTTMGTRTPGGSTPIEYASNGVDFGGIREINGGLCVVNYLSRE  1124

Query  353   FEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
             FE R Q F D+A  + ++KSG  ++  +P  + RRL+H F+ WKKDY  RLKETK+  HK
Sbjct  1125  FELRKQNFDDEAMAISQLKSGQLQST-SPAEDFRRLRHKFDEWKKDYKARLKETKLKVHK  1183

Query  533   LGSEEGASDKMKKKWWG  583
             LG  E  ++K ++ WWG
Sbjct  1184  LGYSE--AEKTRRNWWG  1198



>ref|XP_006592898.1| PREDICTED: myosin-2-like isoform X3 [Glycine max]
Length=1083

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 114/209 (55%), Gaps = 45/209 (22%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+          +AR S
Sbjct  885   KEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLA----------AARKS  934

Query  221   DASVNASD-------------DKESTWDIGNNRTALENNGVRPVR-------AG------  322
              AS NAS              D E    +G +RT        P++       AG      
Sbjct  935   LASENASSQIARRDVASPFGYDSEDATSVG-SRTPRTPGASTPLKYSSSLTEAGAGRDAK  993

Query  323   --LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYG  496
               L+ +  L +EFEQR   F DDA+ LVEVK+G + AN N   ELR+LKH FE WKK+Y 
Sbjct  994   GTLTSVSNLMKEFEQRRHTFDDDARALVEVKTGQS-ANTNSVEELRKLKHSFEGWKKEYK  1052

Query  497   VRLKETKVISHKLGSEEGASDKMKKKWWG  583
              RL+ETK   HK        DK +++WWG
Sbjct  1053  ARLRETKARLHK-----SEMDKSRRRWWG  1076



>ref|XP_003539582.1| PREDICTED: myosin-2-like isoform X1 [Glycine max]
Length=1196

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 113/209 (54%), Gaps = 45/209 (22%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+          +AR S
Sbjct  998   KEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLA----------AARKS  1047

Query  221   DASVNASD-------------DKESTWDIGNNRTALENNGVRPVR-------AG------  322
              AS NAS              D E    +G +RT        P++       AG      
Sbjct  1048  LASENASSQIARRDVASPFGYDSEDATSVG-SRTPRTPGASTPLKYSSSLTEAGAGRDAK  1106

Query  323   --LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYG  496
               L+ +  L +EFEQR   F DDA+ LVEVK+G   AN N   ELR+LKH FE WKK+Y 
Sbjct  1107  GTLTSVSNLMKEFEQRRHTFDDDARALVEVKTG-QSANTNSVEELRKLKHSFEGWKKEYK  1165

Query  497   VRLKETKVISHKLGSEEGASDKMKKKWWG  583
              RL+ETK   HK        DK +++WWG
Sbjct  1166  ARLRETKARLHK-----SEMDKSRRRWWG  1189



>ref|XP_006592897.1| PREDICTED: myosin-2-like isoform X2 [Glycine max]
Length=1197

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 113/209 (54%), Gaps = 45/209 (22%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+          +AR S
Sbjct  999   KEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLA----------AARKS  1048

Query  221   DASVNASD-------------DKESTWDIGNNRTALENNGVRPVR-------AG------  322
              AS NAS              D E    +G +RT        P++       AG      
Sbjct  1049  LASENASSQIARRDVASPFGYDSEDATSVG-SRTPRTPGASTPLKYSSSLTEAGAGRDAK  1107

Query  323   --LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYG  496
               L+ +  L +EFEQR   F DDA+ LVEVK+G   AN N   ELR+LKH FE WKK+Y 
Sbjct  1108  GTLTSVSNLMKEFEQRRHTFDDDARALVEVKTG-QSANTNSVEELRKLKHSFEGWKKEYK  1166

Query  497   VRLKETKVISHKLGSEEGASDKMKKKWWG  583
              RL+ETK   HK        DK +++WWG
Sbjct  1167  ARLRETKARLHK-----SEMDKSRRRWWG  1190



>gb|KHN28019.1| Myosin-J heavy chain [Glycine soja]
Length=1196

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 113/209 (54%), Gaps = 45/209 (22%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q+E RW EYE +MKSME++WQKQM SLQ SL+          +AR S
Sbjct  998   KEEENAELKEQLKQFERRWIEYEKRMKSMEDMWQKQMASLQMSLA----------AARKS  1047

Query  221   DASVNASD-------------DKESTWDIGNNRTALENNGVRPVR-------AG------  322
              AS NAS              D E    +G +RT        P++       AG      
Sbjct  1048  LASENASGQIARRDVASPFGYDSEDATSVG-SRTPRTPGASTPLKYSSSLTEAGAGRDAN  1106

Query  323   --LSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYG  496
               L+ +  L +EFEQR   F DDA+ LVEVK+G   AN N   ELR+LKH FE WKK+Y 
Sbjct  1107  GTLTSVSNLMKEFEQRRHTFDDDARALVEVKAG-QSANTNSVEELRKLKHSFEGWKKEYK  1165

Query  497   VRLKETKVISHKLGSEEGASDKMKKKWWG  583
              RL+ETK   HK        DK +++WWG
Sbjct  1166  ARLRETKARLHK-----SEMDKSRRRWWG  1189



>gb|EMS67686.1| Myosin-J heavy chain [Triticum urartu]
Length=1240

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 95/133 (71%), Gaps = 15/133 (11%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             KDEEN++LHQRLQQYENRW EYE KMK+MEE+WQKQMRSLQSSLS+AKKSLALD++ R S
Sbjct  1101  KDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMS  1160

Query  221   DASVNASDDKESTWDIGNNRT---------ALENNGVRPVRAGLSVIGQLAEEFEQRSQV  373
             D+SV      E +W+   N           A      R + A +SVIG+LAEE EQRSQV
Sbjct  1161  DSSV------EQSWESNGNHVGGGSSQQLAAAPRITGRDMNASMSVIGRLAEELEQRSQV  1214

Query  374   FGDDAKFLVEVKS  412
             F DDAKFLV + S
Sbjct  1215  FADDAKFLVCLVS  1227



>ref|XP_009792547.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009792548.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
Length=1197

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 113/196 (58%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             KD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ+SL+ AKKSL +D+ A   
Sbjct  1000  KDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQASLAAAKKSLGVDNPAGHP  1059

Query  212   -RNSDASVNASDDKESTWDIGNNRT-----------ALENNGVRPVRAGLSVIGQLAEEF  355
              +   +      D E T  +G +              ++  G+R    GL V+  L  EF
Sbjct  1060  GKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLCVVNYLNREF  1119

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLKETK   HK 
Sbjct  1120  ELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKF  1178

Query  536   GSEEGASDKMKKKWWG  583
             G  E  ++K ++ WWG
Sbjct  1179  GYSE--AEKTRRNWWG  1192



>ref|XP_009792549.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1196

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 113/196 (58%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             KD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ+SL+ AKKSL +D+ A   
Sbjct  999   KDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQASLAAAKKSLGVDNPAGHP  1058

Query  212   -RNSDASVNASDDKESTWDIGNNRT-----------ALENNGVRPVRAGLSVIGQLAEEF  355
              +   +      D E T  +G +              ++  G+R    GL V+  L  EF
Sbjct  1059  GKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLCVVNYLNREF  1118

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLKETK   HK 
Sbjct  1119  ELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKF  1177

Query  536   GSEEGASDKMKKKWWG  583
             G  E  ++K ++ WWG
Sbjct  1178  GYSE--AEKTRRNWWG  1191



>ref|XP_006279905.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
 gb|EOA12803.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
Length=1215

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 117/202 (58%), Gaps = 25/202 (12%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN  L  +L+Q+E RWSEYE+KMKSME+ WQKQM SLQ SL+ A+KSLA +     +
Sbjct  1015  KEEENTALRDQLRQFEERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSLATESITGQA  1074

Query  209   ARNSDASVNA----SDDKESTWDIG-NNRTALENNG------VRPVRAGLSVIGQLAEEF  355
                 D S++     S+D  ST   G    T    NG      +R +   L+ +  LA EF
Sbjct  1075  GGRQDTSISPFGYDSEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREF  1134

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKDYGVRLKETK  517
             +QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKDY  RL++TK
Sbjct  1135  DQRRLNFDEDARAIVEVKLGGPQATPNGQQQQHPEDEFRRLKQRFETWKKDYKARLRDTK  1194

Query  518   VISHKLGSEEGASDKMKKKWWG  583
                H++  ++G      +KWWG
Sbjct  1195  ARLHRVDGDKG----RHRKWWG  1212



>ref|XP_009589778.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009589780.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
Length=1195

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 112/196 (57%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             KD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ SL+ AKKSL +D+ A   
Sbjct  998   KDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQVSLAAAKKSLGVDNPAGHP  1057

Query  212   -RNSDASVNASDDKESTWDIGNNRT-----------ALENNGVRPVRAGLSVIGQLAEEF  355
              +   +      D E T  +G +              ++  G+R    GL V+  L  EF
Sbjct  1058  GKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLCVVNYLNREF  1117

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLKETK   HKL
Sbjct  1118  ELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKL  1176

Query  536   GSEEGASDKMKKKWWG  583
                E  ++K ++ WWG
Sbjct  1177  SYSE--AEKTRRNWWG  1190



>ref|XP_009589781.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana tomentosiformis]
Length=1194

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 112/196 (57%), Gaps = 18/196 (9%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSA---  211
             KD+EN  L +++ Q E RWS+YE++M+SMEE+WQKQM SLQ SL+ AKKSL +D+ A   
Sbjct  997   KDKENAALKEQVNQLEARWSDYEVRMRSMEEMWQKQMVSLQVSLAAAKKSLGVDNPAGHP  1056

Query  212   -RNSDASVNASDDKESTWDIGNNRT-----------ALENNGVRPVRAGLSVIGQLAEEF  355
              +   +      D E T  +G +              ++  G+R    GL V+  L  EF
Sbjct  1057  GKREGSQSPCGYDSEDTTTMGTHTPGGSTPIEFASNGVDFGGIRENNGGLCVVNYLNREF  1116

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             E R Q F D+A  + ++KS    +  NP  + RRL+H FE WKKDY  RLKETK   HKL
Sbjct  1117  ELRRQNFDDEAMAIAQLKSEQLHST-NPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKL  1175

Query  536   GSEEGASDKMKKKWWG  583
                E  ++K ++ WWG
Sbjct  1176  SYSE--AEKTRRNWWG  1189



>ref|XP_011095261.1| PREDICTED: LOW QUALITY PROTEIN: myosin-2-like [Sesamum indicum]
Length=1028

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 116/196 (59%), Gaps = 20/196 (10%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDS----  208
             K+ EN  L +++QQ+E RW EYE KMKSMEE+WQKQM SLQ SL+ A+KSL  D++    
Sbjct  832   KERENAALREQVQQFEARWLEYESKMKSMEEMWQKQMASLQMSLAAARKSLVTDNTISQP  891

Query  209   ARNSDASVNASDDKE------STWDIGNNRTALENNGVRPVRA-----GLSVIGQLAEEF  355
              ++ DA +   +D E       T D         NNG++   +     G   +  L +EF
Sbjct  892   GKHHDAQLPNFNDSEDTSLGPQTPDAAAPPIRYLNNGIKAAASGDKNGGHDPVSPLMKEF  951

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKL  535
             EQR + F ++ + +VEVKS    A LNP  E+R+LKH F+ WKKDY  RL+E K  + ++
Sbjct  952   EQRKRNFDNEVQAIVEVKS---VAPLNPTEEVRKLKHRFDVWKKDYKFRLREAKAKAQRM  1008

Query  536   GSEEGASDKMKKKWWG  583
             G  E  ++K ++ WWG
Sbjct  1009  GHAE--AEKHRRNWWG  1022



>ref|XP_006401589.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
 gb|ESQ43042.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
Length=1217

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 118/202 (58%), Gaps = 26/202 (13%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN  L ++L+Q+E RWSEYE+KMKSMEE WQKQM SLQ SL+ A+KSLA ++    +
Sbjct  1018  KEEENTALREQLRQFEERWSEYEMKMKSMEETWQKQMSSLQMSLAAARKSLAAENMTGQA  1077

Query  209   ARNSDASVNA----SDDKESTWDIG-NNRTALENNG------VRPVRAGLSVIGQLAEEF  355
                 D S++     S+D  ST   G    T    NG      VR +   L+ +  LA EF
Sbjct  1078  GGRQDTSISPFGYDSEDTTSTGTPGVRTPTTKFTNGNTPELRVRELNGSLNAVNHLAREF  1137

Query  356   EQRSQVFGDDAKFLVEVKSGLTEANLN------PDHELRRLKHMFESWKKDYGVRLKETK  517
             +QR   F +DA+ +VEVK G  +A  N      P+ E RRLK  FE+WKKDY  RL+ETK
Sbjct  1138  DQRRLNFDEDARAIVEVKLG-PQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRETK  1196

Query  518   VISHKLGSEEGASDKMKKKWWG  583
                H++  ++       +KWWG
Sbjct  1197  ARLHRVDGDKS----RHRKWWG  1214



>ref|XP_007149632.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21626.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=772

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 118/204 (58%), Gaps = 37/204 (18%)
 Frame = +2

Query  41   KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
            K+ EN  L  +L+Q+E+RW EYE +MKSMEE+WQ+QM SLQ SL+          +AR S
Sbjct  576  KEGENAELKDQLKQFESRWMEYEKRMKSMEEMWQRQMSSLQMSLA----------AARKS  625

Query  221  DASVNASD-------DKESTWD-----IGNNR----------TALENNGV-RPVRAGLSV  331
             AS NA++           T+D     +G+            T++   G+ R     L+ 
Sbjct  626  LASENANNQHARRDVSSPFTYDSEDASMGSRTPSASTPLKYSTSISEAGLGRDANGALAS  685

Query  332  IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  511
            +  L +EF+QR Q F  DA+ LV+V++G    N+N   ELR+LKH FE WKK+Y VRLKE
Sbjct  686  VSHLMKEFDQRRQTFDFDARNLVDVRTG-QSTNMNSIEELRKLKHRFEGWKKEYKVRLKE  744

Query  512  TKVISHKLGSEEGASDKMKKKWWG  583
            TK   HKLG+ E   DK +++WWG
Sbjct  745  TKARLHKLGNSE--MDK-RRRWWG  765



>ref|XP_003541859.1| PREDICTED: myosin-2-like [Glycine max]
 gb|KHN36777.1| Myosin-J heavy chain [Glycine soja]
Length=1196

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 110/208 (53%), Gaps = 43/208 (21%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q+E RW EYE +MKSMEE+WQKQM SLQ SL+          +AR S
Sbjct  998   KEEENAELKEQLKQFERRWIEYEKRMKSMEEMWQKQMSSLQMSLA----------AARKS  1047

Query  221   DASVNASD-------------DKESTWDIGN--------------NRTALENNGVRPVRA  319
              AS N S              D E    +G+              + +  E    R V  
Sbjct  1048  LASENVSGQIARRDVASPLGYDSEDAASMGSRTPRTPHASTPLKYSSSLTEAGAGRDVNG  1107

Query  320   GLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGV  499
              L+ +  L +EFEQR   F DDA+ LVE+K+G   AN N   ELR+LKH FE WKK+Y  
Sbjct  1108  TLTSVSNLMKEFEQRRHTFDDDARALVEIKTG-QSANTNSVEELRKLKHRFEGWKKEYKA  1166

Query  500   RLKETKVISHKLGSEEGASDKMKKKWWG  583
             RL+ETK   HK        +K +++WWG
Sbjct  1167  RLRETKARLHK-----SEMEKSRRRWWG  1189



>ref|XP_002993349.1| hypothetical protein SELMODRAFT_137032 [Selaginella moellendorffii]
 gb|EFJ05534.1| hypothetical protein SELMODRAFT_137032 [Selaginella moellendorffii]
Length=1085

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 119/212 (56%), Gaps = 34/212 (16%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalD--DSAR  214
             K++EN  L  +L+ YE RWSEYE KM  ME +WQ QM SLQ SL  AK SLA    D+ +
Sbjct  874   KEDENAELVMKLRLYETRWSEYEDKMNRMEGLWQNQMASLQQSLEAAKTSLATTVLDAKQ  933

Query  215   NSDASV--NAS-------------DDKESTWD----IGNNRTALENNGV-RPVRA-----  319
             N    V  NAS             +D +  WD     G          + R V+      
Sbjct  934   NDLFEVQSNASRQRAARPILPQSENDSDFDWDERTSFGTRTPESTTTSINREVKVFSLAS  993

Query  320   ----GLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKK  487
                 G +V+  L  EFE RSQVF DD +F+VEVKSG  +A L+PD EL++LK  F+ WKK
Sbjct  994   QLSQGQAVVEHLVREFEHRSQVFSDDIEFIVEVKSGQCDAELDPDMELKKLKQRFDVWKK  1053

Query  488   DYGVRLKETKVISHKLGSEEGASDKMKKKWWG  583
             D+ V+++ETK++  +L   E +S++ +KKWWG
Sbjct  1054  DFKVQVRETKMVLQRL---EASSERSRKKWWG  1082



>ref|XP_004487658.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1205

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 109/206 (53%), Gaps = 38/206 (18%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q+E RW EYE KMK+MEE+WQ+QM SLQ SL+          +AR S
Sbjct  1006  KEEENAELREQLKQFEKRWIEYETKMKTMEEMWQRQMSSLQMSLA----------AARTS  1055

Query  221   DASVNASD--------------DKESTWDIGNNRTALENNGV-----------RPVRAGL  325
              AS NA+               D E T  +G+        G            R  R G 
Sbjct  1056  LASENATGQPVRHDITASPLGYDSEDTMSMGSRTPRTPGCGTPFKYSGSLAEARAGREGN  1115

Query  326   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  505
               +  L +EFEQR Q F ++A+ LVEVK+    AN N   EL  LKH FE WKK+Y  RL
Sbjct  1116  GSLNNLMKEFEQRRQTFDNNARALVEVKTTGQSANTNSIEELHNLKHRFEGWKKEYKTRL  1175

Query  506   KETKVISHKLGSEEGASDKMKKKWWG  583
             +ETK    KLG  E   D+ ++KWWG
Sbjct  1176  RETKA-RLKLGHSE--MDRNRRKWWG  1198



>ref|XP_002972734.1| hypothetical protein SELMODRAFT_98074 [Selaginella moellendorffii]
 gb|EFJ25955.1| hypothetical protein SELMODRAFT_98074 [Selaginella moellendorffii]
Length=1081

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 120/212 (57%), Gaps = 34/212 (16%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalD--DSAR  214
             K++EN  L  +L+ YE RWSEYE KM  ME +WQ QM SLQ SL  AKKSLA    D+ +
Sbjct  870   KEDENAELVMKLRLYETRWSEYEDKMNRMEGLWQNQMASLQQSLEAAKKSLATTVLDAKQ  929

Query  215   NSDASV--NAS-------------DDKESTWD----IGNNRTALENNGV-RPVRA-----  319
             N    V  NAS             +D +  WD     G          + R V+      
Sbjct  930   NDLFEVQSNASRQRAARPILPQSENDSDFDWDERTSFGTRTPESTTTSINREVKVFSLAS  989

Query  320   ----GLSVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKK  487
                 G +V+  L  EFE RSQVF DD +F+VEVKSG  +A L+PD EL++LK  F+ WKK
Sbjct  990   QLSQGQAVVEHLVREFEHRSQVFSDDIEFIVEVKSGQCDAELDPDMELKKLKQRFDVWKK  1049

Query  488   DYGVRLKETKVISHKLGSEEGASDKMKKKWWG  583
             D+ V+++ETK++  +L   E +S++ +KKWWG
Sbjct  1050  DFKVQVRETKMVLQRL---EASSERSRKKWWG  1078



>ref|XP_009773271.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1156

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 106/193 (55%), Gaps = 15/193 (8%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD-----  205
             K+ EN  L ++L  +E R  EYE+KM+SMEE+WQKQM SLQ+SL+ AK SL   D     
Sbjct  963   KEMENVALKEQLNLFEARCLEYEVKMRSMEEMWQKQMASLQASLAAAKNSLGAGDTTGRP  1022

Query  206   -------SARNSDASVNASDDKESTWDIGNNRTALENNGVRPVRAGLSVIGQLAEEFEQR  364
                    S R  D+    S D  +         +L     R V  GL+++  L  EFEQR
Sbjct  1023  GKPEGSPSPRYYDSDDATSMDTPAGCTPVKFTNSLGVGANREVNGGLAIVSHLTLEFEQR  1082

Query  365   SQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHKLGSE  544
              Q F D+A  +V +K G   +  NP  E RRLK  FE WKKDY VRLKETK   HKLG  
Sbjct  1083  KQNFDDEALAIVHLKPGQLHST-NPADEYRRLKCRFEEWKKDYKVRLKETKAKVHKLGCS  1141

Query  545   EGASDKMKKKWWG  583
             +    K ++KWWG
Sbjct  1142  KAG--KNRRKWWG  1152



>ref|XP_010446745.1| PREDICTED: myosin-2-like [Camelina sativa]
Length=1217

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 119/203 (59%), Gaps = 26/203 (13%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN  L ++L+Q+E RWSEYE+KMKSME+ WQKQM SLQ SL+ A+KSLA +     +
Sbjct  1016  KEEENTALREQLRQFEERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSLATESITGQA  1075

Query  209   ARNSDASVNA----SDDKESTWDIG-NNRTALENNG------VRPVRAGLSVIGQLAEEF  355
                 D S++     S+D  ST   G    T    NG      +R +   L+ +  LA EF
Sbjct  1076  GGRQDTSISPFGYESEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREF  1135

Query  356   EQRSQVFGDDAKFLVEVKSGL-TEANLN------PDHELRRLKHMFESWKKDYGVRLKET  514
             +QR   F +DA+ +VEVK G+  +A  N      P+ E RRLK  FE+WKKDY  RL++T
Sbjct  1136  DQRRLNFDEDARAIVEVKLGVGPQATPNGQQQQHPEDEFRRLKQRFETWKKDYKARLRDT  1195

Query  515   KVISHKLGSEEGASDKMKKKWWG  583
             K   H++  ++G      +KWWG
Sbjct  1196  KARLHRVDGDKG----RHRKWWG  1214



>ref|XP_010443003.1| PREDICTED: myosin-2 [Camelina sativa]
Length=1215

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 119/203 (59%), Gaps = 26/203 (13%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDD----S  208
             K+EEN  L ++L+Q+E RWSEYE+KMKSME+ WQKQM SLQ SL+ A+KSLA +     +
Sbjct  1014  KEEENTALREQLRQFEERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSLATESITGQA  1073

Query  209   ARNSDASVNA----SDDKESTWDIG-NNRTALENNG------VRPVRAGLSVIGQLAEEF  355
                 D S++     S+D  ST   G    T    NG      +R +   L+ +  LA EF
Sbjct  1074  GGRQDTSISPFGYESEDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREF  1133

Query  356   EQRSQVFGDDAKFLVEVKSGL-TEANLN------PDHELRRLKHMFESWKKDYGVRLKET  514
             +QR   F +DA+ +VEVK G+  +A  N      P+ E RRLK  FE+WKKDY  RL++T
Sbjct  1134  DQRRLNFDEDARAIVEVKLGVGPQATPNGQQQQHPEDEFRRLKQRFETWKKDYKARLRDT  1193

Query  515   KVISHKLGSEEGASDKMKKKWWG  583
             K   H++  ++G      +KWWG
Sbjct  1194  KARLHRVDGDKG----RHRKWWG  1212



>ref|XP_004487659.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1077

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 109/206 (53%), Gaps = 38/206 (18%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+EEN  L ++L+Q+E RW EYE KMK+MEE+WQ+QM SLQ SL+          +AR S
Sbjct  878   KEEENAELREQLKQFEKRWIEYETKMKTMEEMWQRQMSSLQMSLA----------AARTS  927

Query  221   DASVNASD--------------DKESTWDIGNNRTALENNGV-----------RPVRAGL  325
              AS NA+               D E T  +G+        G            R  R G 
Sbjct  928   LASENATGQPVRHDITASPLGYDSEDTMSMGSRTPRTPGCGTPFKYSGSLAEARAGREGN  987

Query  326   SVIGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRL  505
               +  L +EFEQR Q F ++A+ LVEVK+    AN N   EL  LKH FE WKK+Y  RL
Sbjct  988   GSLNNLMKEFEQRRQTFDNNARALVEVKTTGQSANTNSIEELHNLKHRFEGWKKEYKTRL  1047

Query  506   KETKVISHKLGSEEGASDKMKKKWWG  583
             +ETK    KLG  E   D+ ++KWWG
Sbjct  1048  RETKA-RLKLGHSE--MDRNRRKWWG  1070



>ref|XP_010520892.1| PREDICTED: myosin-2-like [Tarenaya hassleriana]
Length=1207

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 115/197 (58%), Gaps = 20/197 (10%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARN-  217
             K++EN  L  +L+Q+E RWS+YE+KMKSMEE W KQ+ SLQ SL+ A+K+LA D++  + 
Sbjct  1011  KEDENVALRDQLRQFEARWSDYEVKMKSMEETWLKQVASLQMSLAAARKTLASDNNGIHT  1070

Query  218   -----SDASVNASDDKESTWDIG----NNRTALENNGVRPVR--AGLSVIGQLAEEFEQR  364
                  S + +    D E T  IG    N  T   N G   +R    L+ +  LA EFEQR
Sbjct  1071  TKPEPSISPLGYGYDSEDTLSIGTPGVNTPTKYINGGTPEIRINGSLNAVTNLAREFEQR  1130

Query  365   SQVFGDDAKFLVEVKSGLT----EANLNPDHELRRLKHMFESWKKDYGVRLKETKVISHK  532
                F +D +FL E K G T    E   +P+ EL++LK  F++WKKDY  RL+ET+   H+
Sbjct  1131  KFNFDEDVRFLAEEKPGPTSTSSEGQHHPEEELKKLKQRFKTWKKDYKARLRETRARLHR  1190

Query  533   LGSEEGASDKMKKKWWG  583
             L  ++G      +KWWG
Sbjct  1191  LEGQKG----HHRKWWG  1203



>ref|XP_007149633.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21627.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=1186

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 118/204 (58%), Gaps = 37/204 (18%)
 Frame = +2

Query  41    KDEENDILHQRLQQYENRWSEYELKMKSMEEVWQKQMRslqsslsiakkslalDDSARNS  220
             K+ EN  L  +L+Q+E+RW EYE +MKSMEE+WQ+QM SLQ SL+          +AR S
Sbjct  990   KEGENAELKDQLKQFESRWMEYEKRMKSMEEMWQRQMSSLQMSLA----------AARKS  1039

Query  221   DASVNASD-------DKESTWD-----IGNNR----------TALENNGV-RPVRAGLSV  331
              AS NA++           T+D     +G+            T++   G+ R     L+ 
Sbjct  1040  LASENANNQHARRDVSSPFTYDSEDASMGSRTPSASTPLKYSTSISEAGLGRDANGALAS  1099

Query  332   IGQLAEEFEQRSQVFGDDAKFLVEVKSGLTEANLNPDHELRRLKHMFESWKKDYGVRLKE  511
             +  L +EF+QR Q F  DA+ LV+V++G    N+N   ELR+LKH FE WKK+Y VRLKE
Sbjct  1100  VSHLMKEFDQRRQTFDFDARNLVDVRTG-QSTNMNSIEELRKLKHRFEGWKKEYKVRLKE  1158

Query  512   TKVISHKLGSEEGASDKMKKKWWG  583
             TK   HKLG+ E   DK +++WWG
Sbjct  1159  TKARLHKLGNSE--MDK-RRRWWG  1179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455