BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017H07 636 bp,

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007017515.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    323   9e-107   Theobroma cacao [chocolate]
ref|XP_002510373.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    325   6e-106   Ricinus communis
ref|XP_007017514.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    324   9e-106   Theobroma cacao [chocolate]
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg                324   1e-105   Erythranthe guttata [common monkey flower]
gb|KDP38494.1|  hypothetical protein JCGZ_04419                         323   1e-105   Jatropha curcas
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      320   3e-104   Sesamum indicum [beniseed]
ref|XP_007017516.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    320   5e-104   Theobroma cacao [chocolate]
ref|XP_002509479.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    318   2e-103   Ricinus communis
emb|CDP07525.1|  unnamed protein product                                318   2e-103   Coffea canephora [robusta coffee]
ref|XP_002282736.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    318   3e-103   Vitis vinifera
ref|XP_010664681.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    318   4e-103   Vitis vinifera
emb|CAN61862.1|  hypothetical protein VITISV_043447                     318   5e-103   Vitis vinifera
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             314   7e-102   Populus trichocarpa [western balsam poplar]
ref|XP_008236880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      314   9e-102   Prunus mume [ume]
gb|KJB32498.1|  hypothetical protein B456_005G243100                    308   2e-101   Gossypium raimondii
ref|XP_008466580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      313   2e-101   Cucumis melo [Oriental melon]
gb|KCW67838.1|  hypothetical protein EUGRSUZ_F01563                     308   4e-101   Eucalyptus grandis [rose gum]
gb|KJB58293.1|  hypothetical protein B456_009G202900                    312   4e-101   Gossypium raimondii
gb|KJB58294.1|  hypothetical protein B456_009G202900                    313   7e-101   Gossypium raimondii
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      312   1e-100   Vitis vinifera
gb|KDP46246.1|  hypothetical protein JCGZ_10086                         310   2e-100   Jatropha curcas
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    310   2e-100   Malus domestica [apple tree]
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      310   2e-100   Pyrus x bretschneideri [bai li]
gb|KHG11479.1|  hypothetical protein F383_06303                         310   3e-100   Gossypium arboreum [tree cotton]
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    310   3e-100   Pyrus x bretschneideri [bai li]
gb|KJB32496.1|  hypothetical protein B456_005G243100                    310   4e-100   Gossypium raimondii
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    310   4e-100   Populus euphratica
gb|KJB32499.1|  hypothetical protein B456_005G243100                    310   5e-100   Gossypium raimondii
ref|XP_006423251.1|  hypothetical protein CICLE_v10028372mg             309   7e-100   Citrus clementina
ref|XP_010060941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    310   8e-100   Eucalyptus grandis [rose gum]
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      310   8e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      309   8e-100   Elaeis guineensis
ref|XP_010060942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    309   9e-100   Eucalyptus grandis [rose gum]
gb|KHN20986.1|  Glucan endo-1,3-beta-glucosidase 7                      304   1e-99    Glycine soja [wild soybean]
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             308   1e-99    Prunus persica
gb|AFS50098.1|  glucan endo-1,3-beta-glucosidase                        308   1e-99    Elaeis guineensis
ref|XP_007042210.1|  O-Glycosyl hydrolases family 17 protein isof...    308   2e-99    Theobroma cacao [chocolate]
ref|XP_004169494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    308   2e-99    
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    308   2e-99    Cucumis sativus [cucumbers]
ref|XP_010263687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    308   3e-99    Nelumbo nucifera [Indian lotus]
ref|XP_006379239.1|  hypothetical protein POPTR_0009s11830g             307   4e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010096392.1|  Glucan endo-1,3-beta-glucosidase 7                 307   5e-99    Morus notabilis
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             307   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      306   8e-99    Phoenix dactylifera
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    306   9e-99    Populus euphratica
ref|XP_010519110.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      306   1e-98    Tarenaya hassleriana [spider flower]
gb|KHG04672.1|  hypothetical protein F383_30229                         306   1e-98    Gossypium arboreum [tree cotton]
gb|KHN33758.1|  Glucan endo-1,3-beta-glucosidase 7                      304   1e-98    Glycine soja [wild soybean]
ref|XP_003544417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    306   2e-98    Glycine max [soybeans]
ref|XP_003522947.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    305   4e-98    Glycine max [soybeans]
ref|XP_009364443.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    304   7e-98    Pyrus x bretschneideri [bai li]
ref|XP_007136171.1|  hypothetical protein PHAVU_009G024000g             304   7e-98    Phaseolus vulgaris [French bean]
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    305   1e-97    Populus euphratica
ref|XP_004299094.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      304   3e-97    Fragaria vesca subsp. vesca
ref|XP_010065396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    302   4e-97    Eucalyptus grandis [rose gum]
ref|XP_008377338.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    301   2e-96    Malus domestica [apple tree]
ref|XP_008220789.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      300   3e-96    Prunus mume [ume]
gb|KJB34916.1|  hypothetical protein B456_006G090600                    299   3e-96    Gossypium raimondii
ref|XP_003606895.1|  Glucan endo-1,3-beta-glucosidase                   300   4e-96    Medicago truncatula
ref|XP_007222662.1|  hypothetical protein PRUPE_ppa004976mg             300   6e-96    Prunus persica
ref|XP_010107844.1|  Glucan endo-1,3-beta-glucosidase 7                 298   1e-95    Morus notabilis
gb|KDP38495.1|  hypothetical protein JCGZ_04420                         296   3e-95    Jatropha curcas
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      298   4e-95    Tarenaya hassleriana [spider flower]
gb|AES74164.2|  glucan endo-1,3-beta-glucosidase-like protein           291   1e-94    Medicago truncatula
ref|XP_006412222.1|  hypothetical protein EUTSA_v10024968mg             296   2e-94    Eutrema salsugineum
ref|XP_011088385.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    296   3e-94    Sesamum indicum [beniseed]
gb|ACN26761.1|  unknown                                                 290   4e-94    Zea mays [maize]
gb|KHN20071.1|  Glucan endo-1,3-beta-glucosidase 7                      293   5e-94    Glycine soja [wild soybean]
ref|XP_009804916.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    294   7e-94    Nicotiana sylvestris
ref|XP_006581120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    294   9e-94    
ref|XP_006581121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    293   1e-93    
ref|XP_004230886.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      293   1e-93    Solanum lycopersicum
ref|XP_009605959.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    293   1e-93    Nicotiana tomentosiformis
ref|XP_009365605.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    293   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_008375942.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    293   2e-93    
ref|XP_003603912.1|  Glucan endo-1,3-beta-glucosidase                   292   3e-93    Medicago truncatula
ref|XP_008377425.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    292   3e-93    
gb|EPS59066.1|  hypothetical protein M569_15744                         291   4e-93    Genlisea aurea
ref|XP_003603913.1|  Glucan endo-1,3-beta-glucosidase                   292   4e-93    
ref|XP_009407686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   6e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004293211.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      292   6e-93    Fragaria vesca subsp. vesca
ref|NP_001275210.1|  glucan endo-1,3-beta-D-glucosidase-like prec...    291   8e-93    Solanum tuberosum [potatoes]
ref|XP_007160762.1|  hypothetical protein PHAVU_001G014900g             291   1e-92    Phaseolus vulgaris [French bean]
emb|CDX69064.1|  BnaC01g03890D                                          292   1e-92    Brassica napus [oilseed rape]
ref|NP_001148381.1|  glucan endo-1,3-beta-glucosidase 7 precursor       290   2e-92    Zea mays [maize]
emb|CDX75437.1|  BnaA01g02650D                                          291   2e-92    Brassica napus [oilseed rape]
ref|XP_004499144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   2e-92    Cicer arietinum [garbanzo]
gb|KEH40123.1|  glucan endo-1,3-beta-glucosidase-like protein           290   2e-92    Medicago truncatula
gb|KEH40125.1|  glucan endo-1,3-beta-glucosidase-like protein           290   2e-92    Medicago truncatula
ref|XP_009112198.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      291   2e-92    Brassica rapa
gb|KHN25369.1|  Glucan endo-1,3-beta-glucosidase 7                      285   3e-92    Glycine soja [wild soybean]
gb|KEH40124.1|  glucan endo-1,3-beta-glucosidase-like protein           290   3e-92    Medicago truncatula
ref|XP_004148850.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    289   4e-92    Cucumis sativus [cucumbers]
ref|XP_004499143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   5e-92    
ref|XP_008457927.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    289   6e-92    Cucumis melo [Oriental melon]
ref|XP_004507424.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   1e-91    Cicer arietinum [garbanzo]
ref|XP_009406752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIR93913.1|  glucanase                                               288   2e-91    Cicer arietinum [garbanzo]
ref|XP_010432409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_006283912.1|  hypothetical protein CARUB_v10005030mg             284   5e-91    Capsella rubella
ref|XP_010447074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    287   6e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010444969.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    287   7e-91    Camelina sativa [gold-of-pleasure]
ref|XP_007042209.1|  O-Glycosyl hydrolases family 17 protein isof...    287   8e-91    Theobroma cacao [chocolate]
gb|KFK30062.1|  hypothetical protein AALP_AA7G211800                    286   2e-90    Arabis alpina [alpine rockcress]
gb|ACJ84511.1|  unknown                                                 281   8e-90    Medicago truncatula
gb|AAP44659.1|  putative beta 1,3-glucanase                             283   9e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004500813.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    282   1e-89    Cicer arietinum [garbanzo]
gb|AIR93908.1|  glucanase                                               282   1e-89    Cicer arietinum [garbanzo]
ref|XP_002466692.1|  hypothetical protein SORBIDRAFT_01g012380          283   2e-89    Sorghum bicolor [broomcorn]
ref|NP_195174.6|  glucan endo-1,3-beta-glucosidase 7                    283   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             281   3e-89    Phaseolus vulgaris [French bean]
ref|XP_009138298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    283   4e-89    Brassica rapa
gb|EAY91326.1|  hypothetical protein OsI_12942                          281   5e-89    Oryza sativa Indica Group [Indian rice]
gb|EMS60868.1|  Glucan endo-1,3-beta-glucosidase 7                      277   8e-89    Triticum urartu
ref|XP_010690895.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    281   8e-89    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006409465.1|  hypothetical protein EUTSA_v10022641mg             281   3e-88    Eutrema salsugineum
ref|XP_006299612.1|  hypothetical protein CARUB_v10015799mg             280   4e-88    Capsella rubella
ref|XP_002886212.1|  glycosyl hydrolase family 17 protein               278   4e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_010423738.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    280   5e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      280   7e-88    Camelina sativa [gold-of-pleasure]
ref|XP_003561438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    278   8e-88    Brachypodium distachyon [annual false brome]
gb|AAD22313.1|  putative beta-1,3-glucanase                             278   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690894.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    279   2e-87    Beta vulgaris subsp. vulgaris [Swiss chard]
dbj|BAJ87172.1|  predicted protein                                      277   2e-87    Hordeum vulgare subsp. vulgare [barley]
ref|NP_179219.4|  O-glycosyl hydrolases family 17 protein               277   7e-87    Arabidopsis thaliana [mouse-ear cress]
gb|EMT27870.1|  Glucan endo-1,3-beta-glucosidase 7                      271   7e-87    Aegilops tauschii
ref|XP_004982218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    276   9e-87    Setaria italica
ref|XP_004982217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    276   1e-86    
ref|NP_001141090.1|  uncharacterized protein LOC100273173               268   1e-85    Zea mays [maize]
ref|XP_008681421.1|  PREDICTED: uncharacterized protein LOC100273...    270   2e-84    Zea mays [maize]
ref|XP_008681422.1|  PREDICTED: uncharacterized protein LOC100273...    269   2e-84    Zea mays [maize]
ref|XP_009138297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    270   4e-84    Brassica rapa
sp|Q94G86.1|ALL9_OLEEU  RecName: Full=Glucan endo-1,3-beta-D-gluc...    268   7e-84    Olea europaea
emb|CDO97058.1|  unnamed protein product                                264   1e-82    Coffea canephora [robusta coffee]
emb|CDX72483.1|  BnaC07g45050D                                          273   3e-82    Brassica napus [oilseed rape]
ref|XP_009758633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    261   1e-81    Nicotiana sylvestris
ref|XP_009123249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      263   2e-81    Brassica rapa
ref|XP_009804917.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    261   3e-81    Nicotiana sylvestris
emb|CDY45313.1|  BnaA03g52860D                                          270   4e-81    Brassica napus [oilseed rape]
ref|XP_009605960.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    259   9e-81    Nicotiana tomentosiformis
ref|XP_006856026.1|  hypothetical protein AMTR_s00059p00061500          259   1e-80    Amborella trichopoda
emb|CDY26761.1|  BnaC09g08880D                                          260   3e-80    Brassica napus [oilseed rape]
ref|XP_006341928.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    254   6e-79    Solanum tuberosum [potatoes]
ref|XP_004238250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      253   3e-78    Solanum lycopersicum
ref|XP_009758632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    253   4e-78    Nicotiana sylvestris
ref|XP_006372050.1|  hypothetical protein POPTR_0018s08730g             244   3e-77    Populus trichocarpa [western balsam poplar]
ref|XP_002313051.1|  glycosyl hydrolase family 17 family protein        246   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_002306099.1|  hypothetical protein POPTR_0004s16120g             244   8e-76    Populus trichocarpa [western balsam poplar]
ref|XP_009411141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    245   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006434974.1|  hypothetical protein CICLE_v10003630mg             246   1e-75    Citrus clementina
gb|KDO84535.1|  hypothetical protein CISIN_1g040787mg                   246   1e-75    Citrus sinensis [Valencia orange]
ref|XP_006423252.1|  hypothetical protein CICLE_v10028372mg             243   2e-75    Citrus clementina
ref|XP_011088386.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    245   3e-75    Sesamum indicum [beniseed]
gb|KJB32497.1|  hypothetical protein B456_005G243100                    241   2e-74    Gossypium raimondii
gb|KDO49091.1|  hypothetical protein CISIN_1g0122621mg                  236   2e-74    Citrus sinensis [Valencia orange]
ref|XP_006375635.1|  hypothetical protein POPTR_0014s18270g             241   2e-74    Populus trichocarpa [western balsam poplar]
ref|XP_002321274.1|  hypothetical protein POPTR_0014s18110g             240   4e-74    Populus trichocarpa [western balsam poplar]
ref|XP_006375633.1|  hypothetical protein POPTR_0014s18250g             240   4e-74    Populus trichocarpa [western balsam poplar]
ref|XP_011012794.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      241   5e-74    Populus euphratica
ref|XP_006375631.1|  hypothetical protein POPTR_0014s18230g             241   1e-73    Populus trichocarpa [western balsam poplar]
gb|EYU37792.1|  hypothetical protein MIMGU_mgv1a006258mg                238   1e-72    Erythranthe guttata [common monkey flower]
ref|XP_006375618.1|  hypothetical protein POPTR_0014s18040g             234   3e-72    Populus trichocarpa [western balsam poplar]
ref|XP_002321266.1|  hypothetical protein POPTR_0014s18060g             235   4e-72    Populus trichocarpa [western balsam poplar]
ref|XP_009394306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   3e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002321268.2|  hypothetical protein POPTR_0014s18060g             235   3e-71    Populus trichocarpa [western balsam poplar]
ref|XP_006595937.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   5e-71    Glycine max [soybeans]
ref|XP_008785661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   1e-70    
ref|XP_004173544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    228   3e-70    
ref|XP_010939269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   4e-70    Elaeis guineensis
ref|XP_009394780.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   5e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394779.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   5e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006372047.1|  hypothetical protein POPTR_0018s08710g             228   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_002867117.1|  hypothetical protein ARALYDRAFT_491210             228   2e-69    Arabidopsis lyrata subsp. lyrata
ref|XP_006372048.1|  hypothetical protein POPTR_0018s08710g             228   2e-69    Populus trichocarpa [western balsam poplar]
emb|CAA18827.1|  putative protein (fragment)                            226   2e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CAB80165.1|  putative protein (fragment)                            227   4e-69    Arabidopsis thaliana [mouse-ear cress]
gb|KEH40122.1|  glucan endo-1,3-beta-glucosidase-like protein           227   2e-68    Medicago truncatula
ref|XP_009101841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      224   4e-67    Brassica rapa
ref|NP_001049445.2|  Os03g0227400                                       218   4e-67    
gb|ADE76367.1|  unknown                                                 224   1e-66    Picea sitchensis
ref|XP_007160761.1|  hypothetical protein PHAVU_001G014900g             222   1e-66    Phaseolus vulgaris [French bean]
emb|CDY22386.1|  BnaA06g37080D                                          221   6e-66    Brassica napus [oilseed rape]
gb|EPS70348.1|  hypothetical protein M569_04409                         221   6e-66    Genlisea aurea
gb|EEC74801.1|  hypothetical protein OsI_10603                          218   5e-65    Oryza sativa Indica Group [Indian rice]
gb|ABF94756.1|  Glucan endo-1,3-beta-glucosidase 7 precursor, put...    218   6e-65    Oryza sativa Japonica Group [Japonica rice]
gb|AAN60993.1|  Putative glycosyl hydrolase                             218   8e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006403361.1|  hypothetical protein EUTSA_v10003213mg             217   2e-64    Eutrema salsugineum
dbj|BAK02637.1|  predicted protein                                      216   2e-64    Hordeum vulgare subsp. vulgare [barley]
gb|ABK25242.1|  unknown                                                 218   3e-64    Picea sitchensis
ref|XP_006649666.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    216   4e-64    Oryza brachyantha
ref|XP_004978983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    216   5e-64    
ref|XP_004978982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    216   6e-64    Setaria italica
ref|NP_001147326.1|  LOC100280934 precursor                             215   8e-64    Zea mays [maize]
ref|XP_002468213.1|  hypothetical protein SORBIDRAFT_01g041880          215   8e-64    Sorghum bicolor [broomcorn]
gb|EMT19757.1|  Glucan endo-1,3-beta-glucosidase 7                      216   9e-64    Aegilops tauschii
emb|CDX71547.1|  BnaC04g17820D                                          214   2e-63    Brassica napus [oilseed rape]
dbj|BAJ95272.1|  predicted protein                                      213   2e-63    Hordeum vulgare subsp. vulgare [barley]
gb|ABK24319.1|  unknown                                                 214   6e-63    Picea sitchensis
emb|CAN83700.1|  hypothetical protein VITISV_027546                     209   1e-62    Vitis vinifera
ref|XP_002283647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        210   1e-61    Vitis vinifera
gb|KFK31822.1|  hypothetical protein AALP_AA6G162900                    209   2e-61    Arabis alpina [alpine rockcress]
ref|XP_006350772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    209   2e-61    Solanum tuberosum [potatoes]
ref|XP_002865493.1|  glycosyl hydrolase family 17 protein               208   5e-61    Arabidopsis lyrata subsp. lyrata
ref|XP_006827757.1|  hypothetical protein AMTR_s00009p00263650          209   5e-61    
ref|XP_010494214.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   1e-60    Camelina sativa [gold-of-pleasure]
ref|XP_008802734.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        207   1e-60    Phoenix dactylifera
gb|AFW67776.1|  putative O-glycosyl hydrolase family 17 protein         206   1e-60    Zea mays [maize]
ref|XP_004986270.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   1e-60    
gb|AFW67777.1|  putative O-glycosyl hydrolase family 17 protein         207   2e-60    Zea mays [maize]
ref|XP_002466550.1|  hypothetical protein SORBIDRAFT_01g009770          207   2e-60    Sorghum bicolor [broomcorn]
ref|XP_010228925.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   2e-60    Brachypodium distachyon [annual false brome]
ref|XP_006375634.1|  hypothetical protein POPTR_0014s18260g             204   2e-60    Populus trichocarpa [western balsam poplar]
ref|XP_006651673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    204   2e-60    
ref|NP_001150853.1|  glucan endo-1,3-beta-glucosidase 7 precursor       206   3e-60    Zea mays [maize]
ref|NP_199086.2|  glycosyl hydrolase family 17 protein                  206   5e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003561857.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    205   6e-60    Brachypodium distachyon [annual false brome]
ref|XP_010481959.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    205   6e-60    Camelina sativa [gold-of-pleasure]
ref|XP_004241225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    205   6e-60    Solanum lycopersicum
ref|XP_010256938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    205   1e-59    Nelumbo nucifera [Indian lotus]
gb|KFK27709.1|  hypothetical protein AALP_AA8G419000                    204   2e-59    Arabis alpina [alpine rockcress]
ref|XP_010230690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      204   2e-59    Brachypodium distachyon [annual false brome]
emb|CDP05033.1|  unnamed protein product                                204   2e-59    Coffea canephora [robusta coffee]
ref|XP_006280516.1|  hypothetical protein CARUB_v10026453mg             202   7e-59    Capsella rubella
ref|XP_010442129.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   1e-58    Camelina sativa [gold-of-pleasure]
gb|KHG22731.1|  Glucan endo-1,3-beta-glucosidase                        202   2e-58    Gossypium arboreum [tree cotton]
gb|KHG05533.1|  Glucan endo-1,3-beta-glucosidase                        201   2e-58    Gossypium arboreum [tree cotton]
gb|KJB37375.1|  hypothetical protein B456_006G202300                    203   2e-58    Gossypium raimondii
gb|KJB53907.1|  hypothetical protein B456_009G010800                    201   2e-58    Gossypium raimondii
ref|XP_007039107.1|  O-Glycosyl hydrolases family 17 protein            202   2e-58    Theobroma cacao [chocolate]
ref|XP_004505326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    201   7e-58    
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    200   8e-58    Elaeis guineensis
ref|XP_010922329.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    199   1e-57    Elaeis guineensis
ref|XP_006491986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    199   2e-57    Citrus sinensis [Valencia orange]
ref|XP_004505325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    200   2e-57    Cicer arietinum [garbanzo]
ref|NP_001051111.1|  Os03g0722500                                       198   3e-57    
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    199   5e-57    Ricinus communis
ref|XP_010264453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        198   5e-57    Nelumbo nucifera [Indian lotus]
ref|XP_006441150.1|  hypothetical protein CICLE_v10020075mg             198   6e-57    Citrus clementina
dbj|BAF02203.1|  hypothetical protein                                   192   6e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002526252.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    198   7e-57    
emb|CDP21469.1|  unnamed protein product                                197   7e-57    Coffea canephora [robusta coffee]
gb|KDO69312.1|  hypothetical protein CISIN_1g0384522mg                  196   7e-57    Citrus sinensis [Valencia orange]
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             197   7e-57    Populus trichocarpa [western balsam poplar]
ref|XP_006846179.1|  hypothetical protein AMTR_s00012p00207210          198   9e-57    Amborella trichopoda
ref|XP_002530862.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    197   1e-56    
ref|XP_004151673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    198   1e-56    
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    197   1e-56    Populus euphratica
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    197   1e-56    Phoenix dactylifera
ref|XP_007016411.1|  O-Glycosyl hydrolases family 17 protein isof...    197   1e-56    Theobroma cacao [chocolate]
ref|XP_010048931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        197   2e-56    Eucalyptus grandis [rose gum]
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    197   2e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             196   2e-56    Citrus clementina
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    196   3e-56    Elaeis guineensis
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    196   3e-56    Citrus sinensis [Valencia orange]
gb|EMS53042.1|  Glucan endo-1,3-beta-glucosidase 7                      190   3e-56    Triticum urartu
ref|XP_008376760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        196   3e-56    Malus domestica [apple tree]
ref|NP_001119271.1|  O-Glycosyl hydrolases family 17 protein            196   3e-56    Arabidopsis thaliana [mouse-ear cress]
gb|KDP44958.1|  hypothetical protein JCGZ_01458                         196   4e-56    Jatropha curcas
gb|ABK24695.1|  unknown                                                 196   4e-56    Picea sitchensis
ref|XP_004295910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    197   4e-56    Fragaria vesca subsp. vesca
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        198   5e-56    
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            195   5e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109237.1|  Glucan endo-1,3-beta-glucosidase                   195   8e-56    Morus notabilis
ref|XP_006375624.1|  hypothetical protein POPTR_0014s18100g             188   9e-56    Populus trichocarpa [western balsam poplar]
ref|XP_004309121.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        196   1e-55    Fragaria vesca subsp. vesca
ref|XP_002298356.1|  glycosyl hydrolase family 17 family protein        194   1e-55    Populus trichocarpa [western balsam poplar]
ref|XP_008223598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    195   2e-55    Prunus mume [ume]
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    194   2e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394688.1|  hypothetical protein EUTSA_v10004182mg             194   2e-55    Eutrema salsugineum
gb|KHF99783.1|  Glucan endo-1,3-beta-glucosidase                        195   2e-55    Gossypium arboreum [tree cotton]
gb|KDO72847.1|  hypothetical protein CISIN_1g0375832mg                  194   2e-55    Citrus sinensis [Valencia orange]
ref|XP_011015294.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    194   3e-55    Populus euphratica
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        193   3e-55    Nelumbo nucifera [Indian lotus]
ref|XP_007157802.1|  hypothetical protein PHAVU_002G099500g             194   3e-55    Phaseolus vulgaris [French bean]
ref|XP_004960035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    193   4e-55    Setaria italica
ref|XP_006488330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    194   4e-55    Citrus sinensis [Valencia orange]
gb|KCW85570.1|  hypothetical protein EUGRSUZ_B02367                     193   4e-55    Eucalyptus grandis [rose gum]
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    194   4e-55    Populus euphratica
gb|KDP35193.1|  hypothetical protein JCGZ_09352                         193   5e-55    Jatropha curcas
ref|XP_006424832.1|  hypothetical protein CICLE_v10028241mg             194   5e-55    
ref|XP_007205054.1|  hypothetical protein PRUPE_ppa004320mg             193   1e-54    
ref|XP_010043555.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    193   1e-54    
emb|CDX87130.1|  BnaC09g04450D                                          192   1e-54    
tpg|DAA35302.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    191   1e-54    
ref|XP_002448791.1|  hypothetical protein SORBIDRAFT_06g033250          191   2e-54    
ref|XP_010106478.1|  Glucan endo-1,3-beta-glucosidase                   192   2e-54    
gb|KJB83778.1|  hypothetical protein B456_013G263800                    192   3e-54    
ref|NP_001151529.1|  LOC100285163 precursor                             190   4e-54    
ref|XP_008234701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        190   6e-54    
ref|XP_002874188.1|  hydrolase, hydrolyzing O-glycosyl compounds        189   9e-54    
ref|XP_009353665.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    190   1e-53    
ref|XP_009345982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    190   1e-53    
ref|XP_009345986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    190   1e-53    
gb|KGN49838.1|  hypothetical protein Csa_5G139170                       189   2e-53    
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        189   2e-53    
ref|XP_006287713.1|  hypothetical protein CARUB_v10000922mg             188   3e-53    
gb|EEE58635.1|  hypothetical protein OsJ_10001                          187   3e-53    
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   4e-53    
ref|XP_007013798.1|  O-Glycosyl hydrolases family 17 protein, put...    188   4e-53    
ref|XP_011029787.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    187   6e-53    
ref|XP_008437641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        188   7e-53    
gb|KDP34495.1|  hypothetical protein JCGZ_11045                         187   9e-53    
ref|XP_007013797.1|  O-Glycosyl hydrolases family 17 protein, put...    187   1e-52    
emb|CDY19838.1|  BnaA09g04910D                                          186   1e-52    
ref|XP_009111627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        186   2e-52    
ref|XP_004145947.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    187   2e-52    
ref|XP_009392256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        186   2e-52    
dbj|BAB10628.1|  beta-1,3-glucanase-like protein                        185   3e-52    
ref|XP_010034118.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        185   3e-52    
ref|XP_006653891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    184   3e-52    
ref|XP_002312098.1|  glucan endo-1 family protein                       185   4e-52    
ref|XP_011029669.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    184   7e-52    
ref|XP_006375627.1|  hypothetical protein POPTR_0014s18190g             182   9e-52    
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    183   1e-51    
gb|EYU33213.1|  hypothetical protein MIMGU_mgv1a006294mg                184   1e-51    
ref|XP_002312097.1|  hypothetical protein POPTR_0008s05600g             184   1e-51    
ref|XP_007220925.1|  hypothetical protein PRUPE_ppa023079mg             184   1e-51    
ref|XP_010421258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    183   2e-51    
ref|XP_003607845.1|  Glucan endo-1,3-beta-glucosidase                   184   2e-51    
ref|XP_010690550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   2e-51    
gb|AES90042.2|  O-glycosyl hydrolase family 17 protein                  184   2e-51    
ref|XP_010690542.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   3e-51    
gb|EYU19897.1|  hypothetical protein MIMGU_mgv1a006105mg                182   4e-51    
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        182   7e-51    
gb|ABK95730.1|  unknown                                                 182   7e-51    
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     182   8e-51    
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    181   1e-50    
emb|CDP00093.1|  unnamed protein product                                180   2e-50    
ref|XP_003622030.1|  Glucan endo-1,3-beta-glucosidase                   180   2e-50    
ref|XP_010685761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    180   3e-50    
ref|XP_002451320.1|  hypothetical protein SORBIDRAFT_05g027690          180   3e-50    
ref|XP_004516968.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    180   3e-50    
ref|XP_009796709.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    179   4e-50    
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...    179   4e-50    
gb|ACN39797.1|  unknown                                                 180   4e-50    
ref|XP_008667523.1|  PREDICTED: uncharacterized protein LOC100273...    179   5e-50    
ref|NP_001141385.1|  uncharacterized protein LOC100273476 precursor     179   5e-50    
gb|ACF79258.1|  unknown                                                 179   5e-50    
ref|NP_001241760.1|  glucan endo-1,3-beta-glucosidase precursor         179   6e-50    
ref|XP_009419749.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    179   6e-50    
gb|EPS63364.1|  glycoside hydrolase                                     179   7e-50    
ref|NP_001275174.1|  glucan endo-1,3-beta-glucosidase-like precursor    178   2e-49    
ref|XP_010091148.1|  Glucan endo-1,3-beta-glucosidase                   172   2e-49    
emb|CAB85903.1|  beta-1,3 glucanase                                     177   4e-49    
ref|XP_002993419.1|  hypothetical protein SELMODRAFT_137087             177   4e-49    
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      177   5e-49    
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     175   5e-49    
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   6e-49    
gb|AHL24655.1|  Fra e 9.02 allergen                                     176   9e-49    
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    176   1e-48    
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   1e-48    
gb|KHN13912.1|  Glucan endo-1,3-beta-glucosidase                        173   1e-48    
gb|KFK33989.1|  hypothetical protein AALP_AA5G087500                    176   1e-48    
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   1e-48    
sp|P52409.1|E13B_WHEAT  RecName: Full=Glucan endo-1,3-beta-glucos...    176   2e-48    
gb|AAX95357.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    176   2e-48    
ref|NP_001068545.2|  Os11g0704600                                       176   2e-48    
gb|EEC68648.1|  hypothetical protein OsI_37085                          176   2e-48    
emb|CBI31680.3|  unnamed protein product                                174   2e-48    
ref|XP_006375623.1|  hypothetical protein POPTR_0014s18090g             166   2e-48    
ref|XP_008461659.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        174   6e-48    
ref|XP_001761806.1|  predicted protein                                  174   7e-48    
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   8e-48    
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    174   8e-48    
gb|EMT12982.1|  Glucan endo-1,3-beta-glucosidase                        168   1e-47    
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             173   1e-47    
ref|XP_003552703.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        173   2e-47    
dbj|BAF01977.1|  putative beta-1,3-glucanase                            169   2e-47    
ref|NP_001234416.1|  beta-glucosidase 08 precursor                      172   2e-47    
ref|XP_007139210.1|  hypothetical protein PHAVU_008G010600g             172   2e-47    
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    172   3e-47    
ref|XP_006663687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    172   3e-47    
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   3e-47    
ref|XP_002321270.2|  hypothetical protein POPTR_0014s18290g             168   3e-47    
gb|EEE52578.1|  hypothetical protein OsJ_34867                          176   3e-47    
ref|XP_010519454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   4e-47    
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     172   4e-47    
ref|XP_009789910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    172   4e-47    
ref|XP_011101632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    171   6e-47    
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    171   8e-47    
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     171   8e-47    
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    171   1e-46    
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   1e-46    
gb|EEC78268.1|  hypothetical protein OsI_17962                          175   1e-46    
gb|AHL24654.1|  Fra e 9.01 allergen                                     171   1e-46    
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             170   1e-46    
ref|XP_004147695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    170   1e-46    
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                171   1e-46    
ref|XP_009365112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   1e-46    
ref|XP_004167482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    170   1e-46    
ref|XP_010519453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-46    
gb|EPS73917.1|  hypothetical protein M569_00835                         170   2e-46    
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   2e-46    
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   2e-46    
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   2e-46    
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   2e-46    
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          170   2e-46    
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   3e-46    
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     170   3e-46    
emb|CAJ86292.1|  H0124B04.9                                             175   3e-46    
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   3e-46    
emb|CAB36529.1|  putative beta-1, 3-glucanase                           169   3e-46    
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               169   3e-46    
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   3e-46    
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               169   4e-46    
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        169   4e-46    
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     170   4e-46    
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             169   4e-46    
gb|AAD26909.1|  putative beta-1,3-glucanase                             169   5e-46    
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        169   7e-46    
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    169   7e-46    
ref|XP_002967295.1|  hypothetical protein SELMODRAFT_87381              169   7e-46    
gb|KHG05496.1|  hypothetical protein F383_30989                         168   9e-46    
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   1e-45    
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   1e-45    
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             168   1e-45    
emb|CDP05678.1|  unnamed protein product                                168   1e-45    
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     168   1e-45    
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             168   1e-45    
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     168   2e-45    
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     168   2e-45    
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   2e-45    
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   2e-45    
ref|XP_002960423.1|  hypothetical protein SELMODRAFT_73476              167   2e-45    
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             167   2e-45    
gb|AIF76053.1|  putative glucan-endo-1,3-beta-glucosidase precursor     159   2e-45    
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   2e-45    
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     167   3e-45    
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   3e-45    
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    167   3e-45    
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                167   3e-45    
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             167   4e-45    
emb|CDP14397.1|  unnamed protein product                                167   4e-45    
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              166   4e-45    
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              166   4e-45    
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   5e-45    
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     166   5e-45    
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   5e-45    
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   5e-45    
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   6e-45    
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   6e-45    
gb|KJB10704.1|  hypothetical protein B456_001G216900                    163   6e-45    
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   6e-45    
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   7e-45    
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    166   8e-45    
emb|CDY19908.1|  BnaC09g31740D                                          166   1e-44    
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   1e-44    
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         166   1e-44    
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             166   1e-44    
gb|AIF76051.1|  putative glucan-endo-1,3-beta-glucosidase precursor     157   1e-44    
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   1e-44    
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     166   1e-44    
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   1e-44    
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   1e-44    
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     165   1e-44    
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             165   1e-44    
ref|XP_009417707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   1e-44    
ref|XP_001752749.1|  predicted protein                                  164   2e-44    
ref|XP_010046177.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   2e-44    
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    165   2e-44    
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             165   2e-44    
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  165   2e-44    
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        165   2e-44    
ref|XP_010046172.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   2e-44    
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   166   2e-44    
emb|CDY20780.1|  BnaA02g09200D                                          164   2e-44    
ref|XP_008385844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   2e-44    
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   2e-44    
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   3e-44    
gb|EMT31321.1|  Glucan endo-1,3-beta-glucosidase                        165   3e-44    
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     164   3e-44    
ref|XP_006375636.1|  hypothetical protein POPTR_0014s18280g             160   4e-44    
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               164   4e-44    
ref|XP_004980076.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   4e-44    
emb|CDY06601.1|  BnaC02g13250D                                          164   4e-44    
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   5e-44    
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         164   5e-44    
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   5e-44    
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            164   6e-44    
gb|EEE59830.1|  hypothetical protein OsJ_12394                          163   6e-44    
gb|ADU15553.1|  GLU                                                     164   6e-44    
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             163   7e-44    
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    163   7e-44    
gb|AAL77689.1|  AT5g55180/MCO15_13                                      163   7e-44    
gb|AAZ74753.1|  MOP9.15                                                 157   7e-44    
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               163   7e-44    
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            163   8e-44    
gb|KJB10701.1|  hypothetical protein B456_001G216900                    163   8e-44    
gb|KJB10702.1|  hypothetical protein B456_001G216900                    163   8e-44    
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             163   9e-44    
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     163   1e-43    
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        163   1e-43    
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   162   1e-43    
emb|CDY46679.1|  BnaA03g48290D                                          162   2e-43    
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             162   2e-43    
gb|KHG04965.1|  hypothetical protein F383_30444                         162   2e-43    
emb|CAM58806.1|  putative glucan-endo-1,3-beta-glucosidase precursor    156   3e-43    
emb|CDY17308.1|  BnaA10g09420D                                          161   3e-43    
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    162   3e-43    
ref|XP_001784088.1|  predicted protein                                  161   4e-43    



>ref|XP_007017515.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 2 
[Theobroma cacao]
 gb|EOY14740.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 2 
[Theobroma cacao]
Length=341

 Score =   323 bits (827),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR DA +KI YMNMFDAQ+ AVR+ALNAMGFK VEI VAETG
Sbjct  86   RSDPRPETLAFCLFQPNSGRVDANTKIKYMNMFDAQVDAVRSALNAMGFKNVEIVVAETG  145

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDS+EVGPS++NAKAY GNL++HLRSMVGTPLMPG SVDTYLFALYDEDLKPGPTS
Sbjct  146  WPYKGDSDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGNSVDTYLFALYDEDLKPGPTS  205

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFG++ +DLTM YD GLS+SS     TP        P+S+   + WCVP+ GVSDA+L
Sbjct  206  ERSFGIFKSDLTMIYDIGLSQSSQTPVETPAMPKTPVTPSSQPKKAAWCVPRAGVSDAEL  265

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC   GIDCSPIQPGGACFEPNTIA
Sbjct  266  QASLDYACG-HGIDCSPIQPGGACFEPNTIA  295



>ref|XP_002510373.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF52560.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=461

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  210  RSDPRPETLAFCLFQPNAGRLDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY+GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  270  WPYKGDSNEVGPSLENAKAYIGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DLTMT+DAGL  S T    +    P    P  K N + WCVPK GVSDAQ 
Sbjct  330  ERAFGLFKPDLTMTFDAGL--SKTSQTPSTPKTPVNSSP--KPNKAAWCVPKEGVSDAQF  385

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC  QGIDCSPIQPGGACFEPNT+A
Sbjct  386  QANLDYACG-QGIDCSPIQPGGACFEPNTVA  415



>ref|XP_007017514.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
 gb|EOY14739.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
Length=464

 Score =   324 bits (831),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR DA +KI YMNMFDAQ+ AVR+ALNAMGFK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNSGRVDANTKIKYMNMFDAQVDAVRSALNAMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDS+EVGPS++NAKAY GNL++HLRSMVGTPLMPG SVDTYLFALYDEDLKPGPTS
Sbjct  269  WPYKGDSDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGNSVDTYLFALYDEDLKPGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFG++ +DLTM YD GLS+SS     TP        P+S+   + WCVP+ GVSDA+L
Sbjct  329  ERSFGIFKSDLTMIYDIGLSQSSQTPVETPAMPKTPVTPSSQPKKAAWCVPRAGVSDAEL  388

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC   GIDCSPIQPGGACFEPNTIA
Sbjct  389  QASLDYACG-HGIDCSPIQPGGACFEPNTIA  418



>gb|EYU45144.1| hypothetical protein MIMGU_mgv1a006001mg [Erythranthe guttata]
Length=461

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 183/211 (87%), Gaps = 2/211 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D+GSKI Y NMFDAQ+ A+R+AL+AMGF  VEI VAETG
Sbjct  207  RSDPRPETLAFCLFQPNSGRVDSGSKIKYTNMFDAQVDAIRSALDAMGFNSVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFA+YDED KPGPTS
Sbjct  267  WPYKGDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFAVYDEDQKPGPTS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DLTMTYD GLSK+S  TP+TPK+   I P    +  ++WCVPKGGVSDAQL
Sbjct  327  ERSFGLFKPDLTMTYDVGLSKTSQTTPSTPKTP-TINPAPKPEKEAYWCVPKGGVSDAQL  385

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDY C  QG+DCSPIQPGGACFEP+T+A
Sbjct  386  QANLDYVCG-QGLDCSPIQPGGACFEPSTVA  415



>gb|KDP38494.1| hypothetical protein JCGZ_04419 [Jatropha curcas]
Length=461

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 177/211 (84%), Gaps = 4/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR+DA +KI YMNMFDAQ+ AV +AL++MGFK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNAGRFDANTKINYMNMFDAQVDAVHSALSSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD+NEVGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDNNEVGPSMENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DLTMTYD GL  S +    +    P++ P    K ++ WCVPK GVSDAQL
Sbjct  329  ERAFGLFKPDLTMTYDVGL--SKSSQSPSTPKTPSLSPSPKPKQAT-WCVPKAGVSDAQL  385

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC   G+DCSPIQPGGACFEPNT+A
Sbjct  386  QANLDYACG-HGVDCSPIQPGGACFEPNTVA  415



>ref|XP_011083694.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Sesamum indicum]
Length=462

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 178/211 (84%), Gaps = 3/211 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D+GSKI Y NMFDAQ+ A+R+AL+AMGFKGVEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNSGRVDSGSKIKYTNMFDAQVDAIRSALDAMGFKGVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD++EVGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDED KPGPTS
Sbjct  269  WPYKGDNDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDQKPGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DLTM YD GLSK+  Q  ++   A     P SKK++  WCVPK GVSDAQL
Sbjct  329  ERSFGLFKPDLTMVYDVGLSKTGNQNTSSTPKASVKPAPKSKKDA--WCVPKAGVSDAQL  386

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q NLDYAC  QGIDCS IQPGGACFEP T+A
Sbjct  387  QENLDYACG-QGIDCSAIQPGGACFEPMTVA  416



>ref|XP_007017516.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
 gb|EOY14741.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
Length=465

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 178/212 (84%), Gaps = 2/212 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQ-LGAVRTALNAMGFKGVEIAVAET  178
            +SDPRPETLAFCLFQPN GR DA +KI YMNMFDAQ + AVR+ALNAMGFK VEI VAET
Sbjct  209  RSDPRPETLAFCLFQPNSGRVDANTKIKYMNMFDAQQVDAVRSALNAMGFKNVEIVVAET  268

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGDS+EVGPS++NAKAY GNL++HLRSMVGTPLMPG SVDTYLFALYDEDLKPGPT
Sbjct  269  GWPYKGDSDEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGNSVDTYLFALYDEDLKPGPT  328

Query  359  SERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQ  538
            SERSFG++ +DLTM YD GLS+SS     TP        P+S+   + WCVP+ GVSDA+
Sbjct  329  SERSFGIFKSDLTMIYDIGLSQSSQTPVETPAMPKTPVTPSSQPKKAAWCVPRAGVSDAE  388

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            LQA+LDYAC   GIDCSPIQPGGACFEPNTIA
Sbjct  389  LQASLDYACG-HGIDCSPIQPGGACFEPNTIA  419



>ref|XP_002509479.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF50866.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=460

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+ALN +GFK +EI VAETG
Sbjct  209  QSDPRPETLAFCLFQPNSGRIDSGNGIKYMNMFDAQVDAVRSALNGIGFKDIEILVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GDSNEVGPSV+NA+AY GNL++HLRS+VGTPLMPGKSVDTYLFALYDEDLKPGP+S
Sbjct  269  WPYRGDSNEVGPSVENARAYNGNLIAHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPSS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YDAGLSK+S    +    A     P++K   + WC+PK GV DAQL
Sbjct  329  ERAFGLFKTDLSMAYDAGLSKASVTPSSPKTPA----TPSTKPTGAGWCMPKSGVPDAQL  384

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC  QGIDCSPIQPGGACFEPNT+A
Sbjct  385  QASLDYACG-QGIDCSPIQPGGACFEPNTLA  414



>emb|CDP07525.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 176/213 (83%), Gaps = 3/213 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+KI Y NMFDAQ+ AVR+ALNAMGFKGVEI VAETG
Sbjct  209  QSDPRPETLAFCLFQPNSGRVDSGTKIKYTNMFDAQVDAVRSALNAMGFKGVEILVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL++HL+SMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDSNEVGPSLENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksst--qtpttpksAPAIGPPASKKNSSWWCVPKGGVSDA  535
            ER+FGL+  D+TM YD GLSK+S        P +      PA K   S WCVPK GVSDA
Sbjct  329  ERAFGLFKLDMTMNYDTGLSKTSQAPSNAKNPATPTIPTTPAPKAKKSVWCVPKAGVSDA  388

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QLQANLDYAC+  G DCS IQPGGACFEPNTIA
Sbjct  389  QLQANLDYACS-HGTDCSSIQPGGACFEPNTIA  420



>ref|XP_002282736.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Vitis 
vinifera]
 emb|CBI19687.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 178/213 (84%), Gaps = 4/213 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR+D+G+ I YMNMFDAQ+ AVR ALN+MGFK +EI VAETG
Sbjct  209  RSDHRPETLAFCLFQPNSGRFDSGTNIKYMNMFDAQVDAVRAALNSMGFKEIEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL+SHLRS+VGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDSNEVGPSIENAKAYNGNLISHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpks--APAIGPPASKKNSSWWCVPKGGVSDA  535
            ER+FGL+ TDLTMTYD GLSK +  T   P +   PA   P+   N + WCVPK  VS+A
Sbjct  329  ERAFGLFKTDLTMTYDVGLSKGAQNTTPAPATPKTPATPSPSPSTNGT-WCVPKSVVSNA  387

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QLQANLDYAC  QGIDC P+QPGGACFEPNT+A
Sbjct  388  QLQANLDYACG-QGIDCRPVQPGGACFEPNTVA  419



>ref|XP_010664681.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Vitis 
vinifera]
Length=500

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 178/213 (84%), Gaps = 4/213 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR+D+G+ I YMNMFDAQ+ AVR ALN+MGFK +EI VAETG
Sbjct  209  RSDHRPETLAFCLFQPNSGRFDSGTNIKYMNMFDAQVDAVRAALNSMGFKEIEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL+SHLRS+VGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDSNEVGPSIENAKAYNGNLISHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpks--APAIGPPASKKNSSWWCVPKGGVSDA  535
            ER+FGL+ TDLTMTYD GLSK +  T   P +   PA   P+   N + WCVPK  VS+A
Sbjct  329  ERAFGLFKTDLTMTYDVGLSKGAQNTTPAPATPKTPATPSPSPSTNGT-WCVPKSVVSNA  387

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QLQANLDYAC  QGIDC P+QPGGACFEPNT+A
Sbjct  388  QLQANLDYACG-QGIDCRPVQPGGACFEPNTVA  419



>emb|CAN61862.1| hypothetical protein VITISV_043447 [Vitis vinifera]
Length=479

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 175/211 (83%), Gaps = 4/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I Y NMFDAQ+ AVR+ALNAMGFK VEI VAETG
Sbjct  229  QSDPRPETLAFCLFQPNSGRVDSGNNIKYTNMFDAQVDAVRSALNAMGFKEVEIVVAETG  288

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GD+NEVGPS++NAKAY GNL++HLRSM GTPLMPGKSVDTY+FALYDE+LKPGP S
Sbjct  289  WPYSGDANEVGPSIENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDENLKPGPGS  348

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DL+MTYD  LSKSS    T       + P  +   SS WCVPK GVSDAQL
Sbjct  349  ERAFGLFKPDLSMTYDVSLSKSSQTPSTPET---PVNPSPNPTASSVWCVPKTGVSDAQL  405

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC+ QGIDC+PIQPGGACFEPNT+A
Sbjct  406  QANLDYACS-QGIDCTPIQPGGACFEPNTVA  435



>ref|XP_006384505.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
 gb|ABK95331.1| unknown [Populus trichocarpa]
 gb|ERP62302.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
Length=456

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 173/211 (82%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+ALNAMGF  VEI VAETG
Sbjct  205  QSDPRPETLAFCLFQPNSGRVDSGNGIKYMNMFDAQVDAVRSALNAMGFIDVEIVVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGP ++NA+AY GNLV+HLRSMVGTPLMPGKSVDTY+FALYDEDLK GP S
Sbjct  265  WPYKGDSNEVGPGIENARAYNGNLVAHLRSMVGTPLMPGKSVDTYIFALYDEDLKSGPAS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+MTYD GLSKSS    T          P+ K   + WCVPK GVSDAQL
Sbjct  325  ERSFGLFKPDLSMTYDIGLSKSSLPPSTPKTPV----TPSPKPTKADWCVPKAGVSDAQL  380

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC  QGIDC PIQPGGACFEPNT+A
Sbjct  381  QASLDYACG-QGIDCGPIQPGGACFEPNTVA  410



>ref|XP_008236880.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Prunus mume]
Length=463

 Score =   314 bits (804),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 176/211 (83%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR DAG+ I YMNMFDAQ+  VR+ALNA+GFK +EI +AETG
Sbjct  208  QSDPRPETLAFCLFQPNAGRVDAGTGIKYMNMFDAQVDGVRSALNAIGFKDIEILIAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GDSNEVGPSV+NA+AY GNL++HLRS VGTPLMPGKSV+TY+FALYDEDLKPG TS
Sbjct  268  WPYRGDSNEVGPSVENARAYNGNLIAHLRSRVGTPLMPGKSVETYIFALYDEDLKPGGTS  327

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY  DLT+TYD GLSKSS    TTP +        S K SS WCVPK GVSDAQL
Sbjct  328  ERSFGLYKPDLTVTYDVGLSKSSQTPSTTPSTPSTPRVTPSPKPSSAWCVPKAGVSDAQL  387

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC   GIDCS IQPGGACF+PNT+A
Sbjct  388  QANLDYACG-HGIDCSAIQPGGACFDPNTVA  417



>gb|KJB32498.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=323

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ +V +AL+AMGFK VEI VAETG
Sbjct  72   QSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETG  131

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY GNL++HL+SMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  132  WPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  191

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY +DL+MTYD G+SKSS   PT          P     ++ WCVPK G+SDAQL
Sbjct  192  ERAFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPT----ATGWCVPKAGISDAQL  247

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LDYAC  QGIDCSPIQPGGACFEPNT+A
Sbjct  248  QSSLDYACG-QGIDCSPIQPGGACFEPNTVA  277



>ref|XP_008466580.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis melo]
Length=478

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 181/225 (80%), Gaps = 15/225 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  + I YMNMFDAQ+ A+R+ALN+MGFK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNAGRLDTNTNIKYMNMFDAQVDAIRSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD++EVGPS++NAKA+ GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDNDEVGPSLENAKAFNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSW-------------  502
            ER+FGL+  DLTMTYD GLSK+   TP++PK+ P   P +   N S              
Sbjct  329  ERAFGLFKPDLTMTYDVGLSKNGQSTPSSPKTTPVTTPSSPANNPSTKAPTSPKPKAGGG  388

Query  503  -WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             WC+PKGGVSDAQLQANLDYAC  +G+DCS IQPGGACFEPNTIA
Sbjct  389  SWCLPKGGVSDAQLQANLDYACG-RGLDCSAIQPGGACFEPNTIA  432



>gb|KCW67838.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=352

 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 175/223 (78%), Gaps = 13/223 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  ++I Y NMFDAQ+ AVR+ALN+ G+K VEI VAETG
Sbjct  85   RSDPRPETLAFCLFQPNAGRLDTKTQIKYTNMFDAQVDAVRSALNSFGYKNVEIVVAETG  144

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL++HLRS+VGTPLMPG SVDTYLFALYDEDLKPGPTS
Sbjct  145  WPYKGDSNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGISVDTYLFALYDEDLKPGPTS  204

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAP------------AIGPPASKKNSSWW  505
            ER+FGL+ +DL+M YD GLSKSS         A             A   P+ K + + W
Sbjct  205  ERAFGLFKSDLSMNYDIGLSKSSQTPAAPKMPAAPSPNATVTPSPNATVTPSPKPDKANW  264

Query  506  CVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            C+PK GVSDAQLQANLDYAC  QGIDC PIQPGGACFEPNT+A
Sbjct  265  CIPKSGVSDAQLQANLDYACG-QGIDCRPIQPGGACFEPNTLA  306



>gb|KJB58293.1| hypothetical protein B456_009G202900 [Gossypium raimondii]
Length=472

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 180/219 (82%), Gaps = 9/219 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AVR+AL+AMGFK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNSGRLDGNTKINYMNMFDAQVDAVRSALDAMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDS+EVG S++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDE+LKPGPTS
Sbjct  269  WPYKGDSDEVGASIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPTS  328

Query  362  ERSFGLYNT-DLTMTYDAGLsksstqtpttpksAPAIGP-------PASKKNSSWWCVPK  517
            ERSFGLY + DLTMTYD GLSKSS+Q  T    A    P       P+ +   + WCVPK
Sbjct  329  ERSFGLYQSADLTMTYDVGLSKSSSQAQTPASPATEKTPATLSVVAPSPEPKKASWCVPK  388

Query  518  GGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
              V+DA+LQA+LDYACA  GIDCSPIQPGG+CFEPNT++
Sbjct  389  KDVTDAELQASLDYACA-HGIDCSPIQPGGSCFEPNTLS  426



>gb|KJB58294.1| hypothetical protein B456_009G202900 [Gossypium raimondii]
Length=491

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 180/219 (82%), Gaps = 9/219 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AVR+AL+AMGFK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNSGRLDGNTKINYMNMFDAQVDAVRSALDAMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDS+EVG S++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDE+LKPGPTS
Sbjct  269  WPYKGDSDEVGASIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPTS  328

Query  362  ERSFGLYNT-DLTMTYDAGLsksstqtpttpksAPAIGP-------PASKKNSSWWCVPK  517
            ERSFGLY + DLTMTYD GLSKSS+Q  T    A    P       P+ +   + WCVPK
Sbjct  329  ERSFGLYQSADLTMTYDVGLSKSSSQAQTPASPATEKTPATLSVVAPSPEPKKASWCVPK  388

Query  518  GGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
              V+DA+LQA+LDYACA  GIDCSPIQPGG+CFEPNT++
Sbjct  389  KDVTDAELQASLDYACA-HGIDCSPIQPGGSCFEPNTLS  426



>ref|XP_003631648.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Vitis vinifera]
 emb|CBI32582.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 174/211 (82%), Gaps = 4/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I Y NMFDAQ+ AVR+ALNAMGFK VEI VAETG
Sbjct  240  QSDPRPETLAFCLFQPNAGRVDSGNNIKYTNMFDAQVDAVRSALNAMGFKEVEIVVAETG  299

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GD+N VGPS++NAKAY GNL++HLRSM GTPLMPGKSVDTY+FALYDE+LKPGP S
Sbjct  300  WPYSGDANGVGPSIENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDENLKPGPGS  359

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DL+MTYD  LSKSS    T       + P  +   SS WCVPK GVSDAQL
Sbjct  360  ERAFGLFKPDLSMTYDVSLSKSSQTPSTPET---PVNPSPNPTASSVWCVPKTGVSDAQL  416

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC+ QGIDC+PIQPGGACFEPNT+A
Sbjct  417  QANLDYACS-QGIDCTPIQPGGACFEPNTVA  446



>gb|KDP46246.1| hypothetical protein JCGZ_10086 [Jatropha curcas]
Length=459

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+ALNA+GFK +EI VAETG
Sbjct  208  QSDPRPETLAFCLFQPNAGRVDSGNGIMYMNMFDAQVDAVRSALNAIGFKDIEILVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NA+AY GNL++HLR++VGTPLMPGKSVDTYLFALYDEDLKPGP+S
Sbjct  268  WPYSGDSNEVGPSIENARAYNGNLINHLRTLVGTPLMPGKSVDTYLFALYDEDLKPGPSS  327

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+MTYD GL+KSS    T    A     P     ++ WC+PK GVSDAQL
Sbjct  328  ERAFGLFKTDLSMTYDVGLTKSSQVPSTPTTPATPSAKPT----ATGWCMPKSGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC  QGIDC PIQPGGACFEPN + 
Sbjct  384  QASLDYACG-QGIDCGPIQPGGACFEPNNLV  413



>ref|XP_008377317.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=459

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 171/211 (81%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+GS I YMNMFDAQ+ AVR+ALNA+GFK ++I + ETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGSGIKYMNMFDAQVDAVRSALNAVGFKDIDILITETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVG SV+NA+AY GNL++HLRSMVGTPLMPGKSV+TY+FALYDEDLKPGP S
Sbjct  270  WPYHGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVETYIFALYDEDLKPGPAS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DLT TY+ GL        +   S P +  P+ K  S+ WCVPK GVSDAQL
Sbjct  330  ERSFGLFKPDLTATYEVGL-----TKSSQTPSTPTVS-PSPKPTSAQWCVPKSGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC   GIDCS IQPGGACF+PNT+A
Sbjct  384  QANLDYACG-HGIDCSAIQPGGACFDPNTVA  413



>ref|XP_009374179.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Pyrus x bretschneideri]
Length=459

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 171/211 (81%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+GS + YMNMFDAQ+ AVR+ALNA+GFK ++I +AETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGSGVKYMNMFDAQVDAVRSALNAVGFKDIDILIAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVG SV+NA+AY GNL++HLRSMVGTPLMPGKSV+TY+FALYDEDLKPGP S
Sbjct  270  WPYHGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVETYIFALYDEDLKPGPAS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DLT TY+ GL        +   S P +  P+ K  S  WCVPK GVSDAQL
Sbjct  330  ERSFGLFKPDLTATYEVGL-----TKSSQTPSTPTVS-PSPKPTSGQWCVPKSGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC   GIDCS IQPGGACF+PNT+A
Sbjct  384  QANLDYACG-HGIDCSAIQPGGACFDPNTVA  413



>gb|KHG11479.1| hypothetical protein F383_06303 [Gossypium arboreum]
Length=456

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 173/211 (82%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ +V +AL+AMGFK VEI VAETG
Sbjct  205  QSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY GNL++HL+SMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  265  WPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY  DL+M YD G+SKSS    T          P  K  ++ WCVPK G+SDAQL
Sbjct  325  ERAFGLYKPDLSMVYDVGISKSSQTPSTPSTPV----TPQPKPTATGWCVPKAGISDAQL  380

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LDYAC  QGIDCSPIQPGGACFEPNTIA
Sbjct  381  QSSLDYACG-QGIDCSPIQPGGACFEPNTIA  410



>ref|XP_009374190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=459

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 172/211 (82%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+GS +TYMNMFDAQ+ AVR+ALN +GFK ++I +AETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGSGVTYMNMFDAQVDAVRSALNVVGFKDIDILIAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVG SV+NA+A+ GNL++HLRSMVGTPLMPGKSV+TY+FALYDEDLKPGPTS
Sbjct  270  WPYHGDSNEVGTSVENARAFNGNLIAHLRSMVGTPLMPGKSVETYIFALYDEDLKPGPTS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DLT TY+ GL        +   S P +  P+ K  S  WCVPK GVSDAQL
Sbjct  330  ERSFGLFKPDLTATYEVGL-----TKSSQTPSTPMVS-PSPKPTSGQWCVPKSGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC   GIDCS IQPGG+CF+PNT+A
Sbjct  384  QANLDYACG-HGIDCSAIQPGGSCFDPNTVA  413



>gb|KJB32496.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=456

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ +V +AL+AMGFK VEI VAETG
Sbjct  205  QSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY GNL++HL+SMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  265  WPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY +DL+MTYD G+SKSS   PT          P     ++ WCVPK G+SDAQL
Sbjct  325  ERAFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPT----ATGWCVPKAGISDAQL  380

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LDYAC  QGIDCSPIQPGGACFEPNT+A
Sbjct  381  QSSLDYACG-QGIDCSPIQPGGACFEPNTVA  410



>ref|XP_011037536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
 ref|XP_011037537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 171/211 (81%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPE LAFCLFQPN GR D+G+ + YMNMFDAQ+ AVR+ALNAMGF  VEI VAETG
Sbjct  205  QSDARPENLAFCLFQPNAGRVDSGNGMKYMNMFDAQVDAVRSALNAMGFIDVEIVVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGP ++NA+AY GNLV+HLRSMVGTPLMPGKSVDTY+FALYDEDLK GP S
Sbjct  265  WPYKGDSNEVGPGIENARAYNGNLVAHLRSMVGTPLMPGKSVDTYIFALYDEDLKSGPAS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY  DL+MTYD GLSKSS    T          P+ K   + WCVPK GVSDAQL
Sbjct  325  ERSFGLYKPDLSMTYDIGLSKSSLTPSTPKTPV----TPSPKPTKAGWCVPKAGVSDAQL  380

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC  QGIDC PIQPGGACFEPNT+A
Sbjct  381  QASLDYACG-QGIDCGPIQPGGACFEPNTVA  410



>gb|KJB32499.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=484

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ +V +AL+AMGFK VEI VAETG
Sbjct  205  QSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY GNL++HL+SMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  265  WPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY +DL+MTYD G+SKSS   PT          P     ++ WCVPK G+SDAQL
Sbjct  325  ERAFGLYKSDLSMTYDVGISKSSQTPPTPKTPVTPQPKPT----ATGWCVPKAGISDAQL  380

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LDYAC  QGIDCSPIQPGGACFEPNT+A
Sbjct  381  QSSLDYACG-QGIDCSPIQPGGACFEPNTVA  410



>ref|XP_006423251.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
 ref|XP_006487152.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Citrus sinensis]
 gb|ESR36491.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
Length=467

 Score =   309 bits (792),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 176/212 (83%), Gaps = 3/212 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AV +ALNAMGFK VEI VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD NEVGPSV+NAKAY GNL++HLRSM GTPLMPGKSVDTY+FALYDEDLKPGPTS
Sbjct  270  WPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpt--tpksAPAIGPPASKKNSSWWCVPKGGVSDA  535
            ERSFGL+  DL+  YD G+SKSS       TP +      P+ K  ++ WCVPK G+SDA
Sbjct  330  ERSFGLFKPDLSAAYDVGISKSSQTPSAPVTPSTPKTPTTPSPKPTAAGWCVPKAGISDA  389

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QLQA+LDYAC+ QGIDCSPIQPGGACFEPNT+
Sbjct  390  QLQASLDYACS-QGIDCSPIQPGGACFEPNTV  420



>ref|XP_010060941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW67839.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=480

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 175/223 (78%), Gaps = 13/223 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  ++I Y NMFDAQ+ AVR+ALN+ G+K VEI VAETG
Sbjct  207  RSDPRPETLAFCLFQPNAGRLDTKTQIKYTNMFDAQVDAVRSALNSFGYKNVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL++HLRS+VGTPLMPG SVDTYLFALYDEDLKPGPTS
Sbjct  267  WPYKGDSNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGISVDTYLFALYDEDLKPGPTS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAP------------AIGPPASKKNSSWW  505
            ER+FGL+ +DL+M YD GLSKSS         A             A   P+ K + + W
Sbjct  327  ERAFGLFKSDLSMNYDIGLSKSSQTPAAPKMPAAPSPNATVTPSPNATVTPSPKPDKANW  386

Query  506  CVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            C+PK GVSDAQLQANLDYAC  QGIDC PIQPGGACFEPNT+A
Sbjct  387  CIPKSGVSDAQLQANLDYACG-QGIDCRPIQPGGACFEPNTLA  428



>ref|XP_010254870.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Nelumbo nucifera]
Length=512

 Score =   310 bits (795),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 172/211 (82%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+AL   GFK VEI +AETG
Sbjct  261  QSDPRPETLAFCLFQPNAGRVDSGTNIKYMNMFDAQVDAVRSALLRAGFKDVEIVIAETG  320

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPSV+NAKAY GNL+ HLRSMVGTPLMPGK++DTYLFALYDEDLKPGP S
Sbjct  321  WPYKGDSNEVGPSVENAKAYNGNLIKHLRSMVGTPLMPGKAIDTYLFALYDEDLKPGPGS  380

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DLTMTYDAGLSKSS  TPT          P      + WCVPK G+SDAQL
Sbjct  381  ERAFGLFKPDLTMTYDAGLSKSSQTTPTPTTPVNPSPQP----KQTVWCVPKDGISDAQL  436

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q+NLDYAC   GIDC P+QPGGACFEPNT+A
Sbjct  437  QSNLDYACG-HGIDCGPLQPGGACFEPNTVA  466



>ref|XP_010942826.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Elaeis guineensis]
Length=464

 Score =   309 bits (791),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GRYD GSKITY NMFDAQ+ AV++AL  +GF   EI VAETG
Sbjct  209  RDDPRPETLAFCLFQPNSGRYDPGSKITYTNMFDAQVDAVKSALKGLGFPDAEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GDS+EVG +V+NA+A+VGNLVSHLRSM GTPLMPGKSVDTY+FALYDEDLKPGPTS
Sbjct  269  WPYRGDSDEVGATVENARAFVGNLVSHLRSMNGTPLMPGKSVDTYIFALYDEDLKPGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtp--ttpksAPAIGPPASKKNSSWWCVPKGGVSDA  535
            ERSFGL+  DLTMTYDAGLSKS +     ++   APA G PA+   ++ WCVPK G +D 
Sbjct  329  ERSFGLFRPDLTMTYDAGLSKSGSTAQGNSSSAGAPAKGSPAAA--TAGWCVPKEGATDE  386

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            +LQ NLDYAC   G+DC PIQPGGAC+EPNT+
Sbjct  387  ELQTNLDYACGQAGVDCGPIQPGGACYEPNTV  418



>ref|XP_010060942.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X2 [Eucalyptus 
grandis]
 gb|KCW67837.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=474

 Score =   309 bits (792),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 175/223 (78%), Gaps = 13/223 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  ++I Y NMFDAQ+ AVR+ALN+ G+K VEI VAETG
Sbjct  207  RSDPRPETLAFCLFQPNAGRLDTKTQIKYTNMFDAQVDAVRSALNSFGYKNVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL++HLRS+VGTPLMPG SVDTYLFALYDEDLKPGPTS
Sbjct  267  WPYKGDSNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGISVDTYLFALYDEDLKPGPTS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAP------------AIGPPASKKNSSWW  505
            ER+FGL+ +DL+M YD GLSKSS         A             A   P+ K + + W
Sbjct  327  ERAFGLFKSDLSMNYDIGLSKSSQTPAAPKMPAAPSPNATVTPSPNATVTPSPKPDKANW  386

Query  506  CVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            C+PK GVSDAQLQANLDYAC  QGIDC PIQPGGACFEPNT+A
Sbjct  387  CIPKSGVSDAQLQANLDYACG-QGIDCRPIQPGGACFEPNTLA  428



>gb|KHN20986.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=318

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 173/225 (77%), Gaps = 16/225 (7%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR D+ + + YMNMFDAQ+ AVR+AL+AMGFK VEI VAET
Sbjct  48   RSDPGRADNLAFCLFQPNAGRVDSNTNLKYMNMFDAQVDAVRSALDAMGFKNVEIVVAET  107

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGDSNE GPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP 
Sbjct  108  GWPYKGDSNEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPA  167

Query  359  SERSFGLYNTDLTMTYDAGLsksstqtpttpksA--------------PAIGPPASKKNS  496
            SER+FGLYN D +M YDAGLSK    +   P  A              P +  P    NS
Sbjct  168  SERAFGLYNPDQSMIYDAGLSKQQETSSPVPTVAPTTPDVSKSPSTPKPTVSSPTKTNNS  227

Query  497  SWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            + WCVPKGGV+DAQLQANLDYAC  QGIDC+ IQ GGACFEPNT+
Sbjct  228  ATWCVPKGGVADAQLQANLDYACG-QGIDCTAIQQGGACFEPNTL  271



>ref|XP_007201010.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
 gb|EMJ02209.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
Length=464

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 176/214 (82%), Gaps = 6/214 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR DAG+ I YMNMFDAQ+  VR+ALNA+GF  +EI +AETG
Sbjct  208  QSDPRPETLAFCLFQPNAGRVDAGTGIKYMNMFDAQVDGVRSALNAIGFNDIEILIAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GDSNEVGPSV+NA+AY GNL++HLRS VGTPLMPGKSV+TY+FALYDEDLKPG TS
Sbjct  268  WPYRGDSNEVGPSVENARAYNGNLIAHLRSQVGTPLMPGKSVETYIFALYDEDLKPGGTS  327

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPA---IGPPASKKNSSWWCVPKGGVSD  532
            ERSFGLY  DLT+TYD GLSKSS    T   S P    + P  S K SS WCVPK GVSD
Sbjct  328  ERSFGLYKPDLTVTYDVGLSKSSQTPSTPSTSTPTTPRVTP--SPKPSSAWCVPKAGVSD  385

Query  533  AQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            AQLQANLDYAC   GIDCS IQPGGACF+PNT+A
Sbjct  386  AQLQANLDYACG-HGIDCSAIQPGGACFDPNTVA  418



>gb|AFS50098.1| glucan endo-1,3-beta-glucosidase [Elaeis guineensis]
Length=465

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GRYD GSKITY NMFDAQ+ AV++AL  +GF   EI VAETG
Sbjct  210  RDDPRPETLAFCLFQPNSGRYDPGSKITYTNMFDAQVDAVKSALKGLGFPDAEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GDS+EVG +V+NA+A+VGNLVSHLRSM GTPLMPGKSVDTY+FALYDEDLKPGPTS
Sbjct  270  WPYRGDSDEVGATVENARAFVGNLVSHLRSMNGTPLMPGKSVDTYIFALYDEDLKPGPTS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtp--ttpksAPAIGPPASKKNSSWWCVPKGGVSDA  535
            ERSFGL+  DLTMTYDAGLSKS +     ++   APA G PA+   ++ WCVPK G +D 
Sbjct  330  ERSFGLFRPDLTMTYDAGLSKSGSTAQGNSSSAGAPAKGSPAAA--TAGWCVPKEGATDE  387

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            +LQ NLDYAC   G+DC PIQPGGAC+EPNT+
Sbjct  388  ELQTNLDYACGQAGVDCGPIQPGGACYEPNTV  419



>ref|XP_007042210.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX98041.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=459

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 173/211 (82%), Gaps = 2/211 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPETLAF LFQPN GR D+G+ I Y NMFDAQ+ AV +AL+AMGFK VEI VAETG
Sbjct  205  QSDSRPETLAFSLFQPNAGRVDSGNGIKYTNMFDAQVDAVHSALSAMGFKDVEIMVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLK GP S
Sbjct  265  WPYAGDSNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKSGPAS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DL+MTYDAGLSKSS    T       +  P  K  +S WCVPK G+SDAQL
Sbjct  325  ERAFGLFRPDLSMTYDAGLSKSSQTPSTPQNPVTPVT-PQPKPTASGWCVPKAGISDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC+ QGIDC PIQPGGACFEPNT+A
Sbjct  384  QASLDYACS-QGIDCGPIQPGGACFEPNTVA  413



>ref|XP_004169494.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
Length=478

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 179/225 (80%), Gaps = 15/225 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  + I YMNMFDAQ+ A+R+ALN+MGFK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNAGRLDTNTNIKYMNMFDAQVDAIRSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD++EVG S++NAKA+ GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDNDEVGSSLENAKAFNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSW-------------  502
            ER+FGL+  DLTM YD GLSK+   TPT+PK+ P   P +   N S              
Sbjct  329  ERAFGLFKPDLTMAYDVGLSKNGQSTPTSPKTTPVTTPSSPANNPSTKSPTSPKPKAGGG  388

Query  503  -WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             WC+PKGGVSDAQLQANLDYAC  +G+DCS IQPGGACFEPNTIA
Sbjct  389  SWCLPKGGVSDAQLQANLDYACG-RGLDCSAIQPGGACFEPNTIA  432



>ref|XP_004147788.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
 gb|KGN59949.1| hypothetical protein Csa_3G855430 [Cucumis sativus]
Length=478

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 179/225 (80%), Gaps = 15/225 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  + I YMNMFDAQ+ A+R+ALN+MGFK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNAGRLDTNTNIKYMNMFDAQVDAIRSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD++EVG S++NAKA+ GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDNDEVGSSLENAKAFNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSW-------------  502
            ER+FGL+  DLTM YD GLSK+   TPT+PK+ P   P +   N S              
Sbjct  329  ERAFGLFKPDLTMAYDVGLSKNGQSTPTSPKTTPVTTPSSPANNPSTKSPTSPKPKAGGG  388

Query  503  -WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             WC+PKGGVSDAQLQANLDYAC  +G+DCS IQPGGACFEPNTIA
Sbjct  389  SWCLPKGGVSDAQLQANLDYACG-RGLDCSAIQPGGACFEPNTIA  432



>ref|XP_010263687.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Nelumbo nucifera]
Length=465

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 181/212 (85%), Gaps = 3/212 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR+D+G+ I YMNMFDAQ+  VR+AL  +GF+ VEIAVAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRFDSGTNIKYMNMFDAQVDGVRSALVRLGFE-VEIAVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL++HLRSMVGTPLMPGKS+DTYLFALYDEDLKPGP S
Sbjct  269  WPYKGDSNEVGPSMENAKAYNGNLINHLRSMVGTPLMPGKSIDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNS-SWWCVPKGGVSDAQ  538
            ER+FGL+  DLTMTYD GLSKS+ QTP TP   P      S ++  + WCVPK G+S+AQ
Sbjct  329  ERAFGLFKPDLTMTYDVGLSKSNQQTPATPTPTPTTPVNPSPQSKMTVWCVPKDGISEAQ  388

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            LQANLDYAC  QGIDCSP+QPGGAC+EPNT+A
Sbjct  389  LQANLDYACG-QGIDCSPLQPGGACYEPNTVA  419



>ref|XP_006379239.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
 gb|ABK95837.1| unknown [Populus trichocarpa]
 gb|ERP57036.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
Length=452

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 173/211 (82%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ + YMNMFDAQ+ AVR+ALNAMGF  +EI VAETG
Sbjct  204  QSDPRPETLAFCLFQPNSGRVDSGNGMKYMNMFDAQVDAVRSALNAMGFNDIEILVAETG  263

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPSV+NA+AY GNL+S LRSMVGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  264  WPYKGDSNEVGPSVENARAYNGNLISRLRSMVGTPLMPGKSVDTYIFALYDEDLKPGPAS  323

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+MTYD GLSKSS    T   S+P       K  +  WCVPK G S+AQL
Sbjct  324  ERSFGLFKPDLSMTYDIGLSKSSLTPSTPVTSSP-------KPATVGWCVPKTGASEAQL  376

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC  QGIDC PIQPGGACF P+T+A
Sbjct  377  QASLDYACG-QGIDCGPIQPGGACFIPDTLA  406



>ref|XP_010096392.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXB63955.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=467

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 177/213 (83%), Gaps = 3/213 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRP+TLAFCLFQPN GR+D+ +KI YMNMFDAQ+ A+R+ALN++GFK VEI VAETG
Sbjct  210  RGDPRPQTLAFCLFQPNSGRFDSNTKIKYMNMFDAQVDAIRSALNSLGFKNVEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD +EVGPSV+NAKAY GNL++HLRSM GTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  270  WPYQGDGDEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYLFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGP--PASKKNSSWWCVPKGGVSDA  535
            ER+FGL+  DL+M+YD GLSK+S+ + +   S+    P  P+ K   + WCVPK GVSDA
Sbjct  330  ERAFGLFKPDLSMSYDVGLSKTSSGSQSPTPSSTPKTPVNPSPKSKKTVWCVPKAGVSDA  389

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QLQAN+DYAC   G+DCS IQ GGACFEPNT+A
Sbjct  390  QLQANIDYACG-HGVDCSAIQHGGACFEPNTVA  421



>ref|XP_006386924.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
 gb|ERP64721.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
Length=463

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 169/211 (80%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQ N GR D  +KI YMNMFDAQ+ AV +ALN++GFK VEI VAETG
Sbjct  210  RSDTRPETLAFCLFQQNAGRVDGNTKIKYMNMFDAQVDAVFSALNSIGFKNVEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NE+GPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  270  WPYKGDDNEIGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DLTM Y+ GL  S +         P    P SKK  + WCVPK GVSDAQL
Sbjct  330  ERSFGLFKPDLTMAYNVGL--SKSSQTPATPKTPTNPSPTSKK--ATWCVPKSGVSDAQL  385

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q NLDYAC  +GIDCSPI+PGGACFEPNT+A
Sbjct  386  QDNLDYACG-RGIDCSPIEPGGACFEPNTLA  415



>ref|XP_008783477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Phoenix dactylifera]
Length=464

 Score =   306 bits (785),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GRYDAGSKI Y NMFDAQL AV++AL  +GF   EI VAETG
Sbjct  209  RDDPRPETLAFCLFQPNSGRYDAGSKIRYTNMFDAQLDAVKSALKGLGFPETEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD++EVG +V+NAKAYVGNLV+ L+SMVGTPLMPGKSVDTY+FALYDEDLKPGPTS
Sbjct  269  WPYRGDADEVGATVENAKAYVGNLVARLKSMVGTPLMPGKSVDTYIFALYDEDLKPGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+MTYDAGLSKSS+       SA A    +    ++ WCVPK G +D +L
Sbjct  329  ERSFGLFRPDLSMTYDAGLSKSSSTAQGNSSSAAAPAKRSPAAAATGWCVPKEGATDEEL  388

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QANLDYAC   G+DC PIQPGGAC+EPNT+
Sbjct  389  QANLDYACGQAGVDCGPIQPGGACYEPNTL  418



>ref|XP_011048644.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   306 bits (784),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 170/211 (81%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+ALNAMGF  +EI VAETG
Sbjct  205  QSDPRPETLAFCLFQPNSGRVDSGNGIKYMNMFDAQVDAVRSALNAMGFNDIEILVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDS+EVGPSV+NA+AY GNL+SHLRSMVGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  265  WPYNGDSSEVGPSVENARAYNGNLISHLRSMVGTPLMPGKSVDTYIFALYDEDLKPGPAS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+MTYD GL  S +    +    P    P  K  +  WCVPK G S AQL
Sbjct  325  ERSFGLFKPDLSMTYDIGL--SKSSLTPSTPKTPVTSSP--KPAAVGWCVPKTGASGAQL  380

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LDYAC  QGIDC PIQPGGACF+P+T+A
Sbjct  381  QASLDYACG-QGIDCGPIQPGGACFQPDTLA  410



>ref|XP_010519110.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Tarenaya hassleriana]
Length=475

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 177/221 (80%), Gaps = 11/221 (5%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            ++DPRPETL+FCLFQPN GR+D+ +KI YMNMFDAQ+ AVR+AL+ MGFK VEI VAETG
Sbjct  210  RADPRPETLSFCLFQPNSGRFDSNTKIKYMNMFDAQVDAVRSALDGMGFKNVEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVG +V+NAKAY  NLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  270  WPYKGDPNEVGATVENAKAYNENLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPMS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksA----PAIGP------PASKKNSSWWCV  511
            ER+FGL+  DLTMTYD GLSKSS+        A    PA  P      PA  KN++ WCV
Sbjct  330  ERAFGLFRPDLTMTYDVGLSKSSSSGGNNQAPATPKTPATSPRSPATTPAPNKNTN-WCV  388

Query  512  PKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            PK GVSD+QLQAN+DY C  Q +DCS IQPGG+CFEPNT+A
Sbjct  389  PKAGVSDSQLQANIDYVCGTQALDCSAIQPGGSCFEPNTVA  429



>gb|KHG04672.1| hypothetical protein F383_30229 [Gossypium arboreum]
Length=472

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 178/219 (81%), Gaps = 9/219 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AVR AL+AM FK VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNSGRLDGNTKINYMNMFDAQVDAVRAALDAMEFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDS+EVG S++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDE+LK GPTS
Sbjct  269  WPYKGDSDEVGASIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKSGPTS  328

Query  362  ERSFGLYNT-DLTMTYDAGLsksstqtpttpksA-------PAIGPPASKKNSSWWCVPK  517
            ERSFGLY + DLTMTYD GLSKSS+Q  T    A       P+   P+ +   + WCVPK
Sbjct  329  ERSFGLYQSADLTMTYDVGLSKSSSQAQTPASPATEKTPETPSAVAPSPEPKKASWCVPK  388

Query  518  GGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
              V+D++LQA+LDYACA  GIDCSPIQPGG+CFEPNT++
Sbjct  389  KDVTDSELQASLDYACA-HGIDCSPIQPGGSCFEPNTLS  426



>gb|KHN33758.1| Glucan endo-1,3-beta-glucosidase 7, partial [Glycine soja]
Length=403

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 170/211 (81%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AMGF+ VEI VAETG
Sbjct  155  QSDPRPETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMGFQDVEIVVAETG  214

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNE+GPSV+NAKAY GNL+SHLRS+VGTPLMPGKSVDTY+FALYDEDLK GP S
Sbjct  215  WPSRGDSNELGPSVENAKAYNGNLISHLRSLVGTPLMPGKSVDTYIFALYDEDLKQGPGS  274

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FG++ TD T++YD GL         + +  P+  P      ++ WC+PK GVSDAQL
Sbjct  275  ERAFGMFKTDRTVSYDVGL-------TKSSQQTPSTSPTTPAPKTAGWCIPKAGVSDAQL  327

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC+ QGIDC PIQPGGACFEPNT+A
Sbjct  328  QANIDYACS-QGIDCGPIQPGGACFEPNTVA  357



>ref|XP_003544417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=484

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 173/225 (77%), Gaps = 16/225 (7%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR D+ + + YMNMFDAQ+ AVR+AL+AMGFK VEI VAET
Sbjct  214  RSDPGRADNLAFCLFQPNAGRVDSNTNLKYMNMFDAQVDAVRSALDAMGFKNVEIVVAET  273

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGDSNE GPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP 
Sbjct  274  GWPYKGDSNEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPA  333

Query  359  SERSFGLYNTDLTMTYDAGLsksstqtpttpksA--------------PAIGPPASKKNS  496
            SER+FGLYN D +M YDAGLSK    +   P  A              P +  P    NS
Sbjct  334  SERAFGLYNPDQSMIYDAGLSKQQETSSPVPTVAPTTPDVSKSPSTPKPTVSSPTKTNNS  393

Query  497  SWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            + WCVPKGGV+DAQLQANLDYAC  QGIDC+ IQ GGACFEPNT+
Sbjct  394  ATWCVPKGGVADAQLQANLDYACG-QGIDCTAIQQGGACFEPNTL  437



>ref|XP_003522947.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Glycine max]
Length=459

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 170/211 (81%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AMGF+ VEI VAETG
Sbjct  211  QSDPRPETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMGFQDVEIVVAETG  270

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNE+GPSV+NAKAY GNL+SHLRS+VGTPLMPGKSVDTY+FALYDEDLK GP S
Sbjct  271  WPSRGDSNELGPSVENAKAYNGNLISHLRSLVGTPLMPGKSVDTYIFALYDEDLKQGPGS  330

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FG++ TD T++YD GL         + +  P+  P      ++ WC+PK GVSDAQL
Sbjct  331  ERAFGMFKTDRTVSYDVGL-------TKSSQQTPSTSPTTPAPKTAGWCIPKAGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC+ QGIDC PIQPGGACFEPNT+A
Sbjct  384  QANIDYACS-QGIDCGPIQPGGACFEPNTVA  413



>ref|XP_009364443.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=470

 Score =   304 bits (779),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 172/219 (79%), Gaps = 10/219 (5%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR+D+ +KI YMNMFDAQ+ A+R+AL+++GFKGVEI VAETG
Sbjct  206  RSDPRPETLAFCLFQPNNGRFDSNTKINYMNMFDAQVDAIRSALDSIGFKGVEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSV NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDE+LKPGP S
Sbjct  266  WPYKGDDNEVGPSVQNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsk---------sstqtpttpksAPAIGPPASKKNSSWWCVP  514
            ER+FGL+  DLTMTYD GLSK         + +   T       + P   K     +CVP
Sbjct  326  ERAFGLFKPDLTMTYDVGLSKSTQTPTTPTTPSTPTTPSMPPTPVNPSGPKPKKGSYCVP  385

Query  515  KGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            K GVSD+QLQAN+DY C   G DC+PIQPGG+CFEPNT+
Sbjct  386  KAGVSDSQLQANIDYVCG-HGFDCTPIQPGGSCFEPNTV  423



>ref|XP_007136171.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
 gb|ESW08165.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
Length=457

 Score =   304 bits (778),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 176/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AMGF+ +EI VAETG
Sbjct  206  QSDTRPETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMGFQDIEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVGPS++NAKA+ GNL++HLRS+VGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  266  WPSRGDSNEVGPSLENAKAFNGNLINHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TD TM YDAGL+KSS QTP+T    P    P    N+S WCVPK G+SD QL
Sbjct  326  ERAFGLFKTDGTMAYDAGLAKSSQQTPSTSPKTPVTPAP----NTSGWCVPKAGISDDQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC+ QGIDC PIQPGGACFEPNT+A
Sbjct  382  QANIDYACS-QGIDCGPIQPGGACFEPNTVA  411



>ref|XP_011024410.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Populus euphratica]
Length=510

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 167/211 (79%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQ N GR D  +KI YMNMFDAQ+ AV +ALN++GFK VEI VAETG
Sbjct  257  RSDTRPETLAFCLFQQNAGRVDGNTKIKYMNMFDAQVDAVFSALNSIGFKNVEIVVAETG  316

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NE+GPS++NAKAY GNL++HLRSM GTPLMPGKSVDTYLF LYDEDLKPGP S
Sbjct  317  WPYKGDDNEIGPSIENAKAYNGNLIAHLRSMEGTPLMPGKSVDTYLFGLYDEDLKPGPGS  376

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DLTM Y+ GL  S +         P    P SKK  + WCVPK G SDAQL
Sbjct  377  ERSFGLFKPDLTMAYNVGL--SKSSQTPATPKTPTNPSPTSKK--ATWCVPKSGASDAQL  432

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC  +GIDCSPI+PGGACFEPNTIA
Sbjct  433  QANLDYACG-RGIDCSPIEPGGACFEPNTIA  462



>ref|XP_004299094.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 175/220 (80%), Gaps = 10/220 (5%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+GS I YMNMFDAQ+ AV++ALNA+GF  ++I VAETG
Sbjct  207  QSDPRPETLAFCLFQPNAGRVDSGSGIKYMNMFDAQVDAVKSALNAIGFNDIDILVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPSV+NAKAY GNL+ HLRSMVGTPL+PGK V+TY+FALYDEDLKPGP S
Sbjct  267  WPYHGDSNEVGPSVENAKAYNGNLIQHLRSMVGTPLIPGKPVETYIFALYDEDLKPGPAS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpk--------sAPAIGPPASKKNSSWWCVPK  517
            ERSFGL+  DL+ TYDAGLSKSS    T           S P++ P      SS WCVPK
Sbjct  327  ERSFGLFKPDLSPTYDAGLSKSSQTPSTPSVTPSPKPTPSTPSVTPSPKPATSSKWCVPK  386

Query  518  -GGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
              GVSDAQLQANLDYAC   GIDCSPIQPGGACF+PNT+A
Sbjct  387  TSGVSDAQLQANLDYACG-HGIDCSPIQPGGACFDPNTVA  425



>ref|XP_010065396.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Eucalyptus 
grandis]
 gb|KCW62850.1| hypothetical protein EUGRSUZ_G00445 [Eucalyptus grandis]
Length=470

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 171/212 (81%), Gaps = 2/212 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AV +AL A+G+K +EI VAETG
Sbjct  214  QSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVYSALKALGYKDIEIMVAETG  273

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVG SV+NAKAY GNL++HLRS+VGTPLMPGKSVDTY+FALYDEDLKPGPTS
Sbjct  274  WPYNGDSNEVGTSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPTS  333

Query  362  ERSFGLYNTDLTMTYDAGLsksstq-tpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQ  538
            ERSFG+Y  DLTMTYD GL+KSS           P    P  K     WCVPK GVSDAQ
Sbjct  334  ERSFGMYKPDLTMTYDIGLAKSSQTPASPKAPVTPTPVTPTPKPTGPGWCVPKSGVSDAQ  393

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            LQA+LDYAC+   IDCSPIQPGGACF+PNTIA
Sbjct  394  LQASLDYACS-NNIDCSPIQPGGACFDPNTIA  424



>ref|XP_008377338.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=473

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 169/219 (77%), Gaps = 10/219 (5%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR+D+ + I YMNMFDAQ+ A+R+AL+++GFKGVEI VAETG
Sbjct  206  RSDPRPETLAFCLFQPNNGRFDSNTNIKYMNMFDAQVDAIRSALDSIGFKGVEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSV NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDE+LKPGP S
Sbjct  266  WPYKGDDNEVGPSVQNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPVS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksst---------qtpttpksAPAIGPPASKKNSSWWCVP  514
            ER+FGL+  DLTM YD GLSKSS             T         P   K     +CVP
Sbjct  326  ERAFGLFKPDLTMNYDVGLSKSSQTPTTPATPSTPTTPSTPPTPANPSGPKPKKGSYCVP  385

Query  515  KGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            K GVSD+QLQAN+DY C   G DC+PIQPGG+CFEPNT+
Sbjct  386  KAGVSDSQLQANIDYVCG-HGFDCTPIQPGGSCFEPNTV  423



>ref|XP_008220789.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Prunus mume]
Length=480

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 172/229 (75%), Gaps = 20/229 (9%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPNGGR+D+ + I YMNMFDAQ+ A+R+AL++MG K VEI VAETG
Sbjct  206  RSDPRPETLAFCLFQPNGGRFDSKTNIKYMNMFDAQVDAIRSALDSMGAKNVEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPSV+NAKAY GNL++HLRSM GTPLMPGKSVDTYLFALYDE+LKPGP S
Sbjct  266  WPYKGDSNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYLFALYDENLKPGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPA-------------------IGPPAS  484
            ER+FGL+  DLTMTYD GLSK+     T   +                      + P A 
Sbjct  326  ERAFGLFKPDLTMTYDVGLSKTGQTPSTPSSTPSTPSTTPSTTPSTPSAVPKTPVNPSAP  385

Query  485  KKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            K   + WC+PK GVSD+QLQAN+DY C   G DCSPIQ GGACFEPNT+
Sbjct  386  KPKKAAWCLPKAGVSDSQLQANIDYVCG-HGFDCSPIQQGGACFEPNTV  433



>gb|KJB34916.1| hypothetical protein B456_006G090600 [Gossypium raimondii]
Length=448

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 167/211 (79%), Gaps = 13/211 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D  S I YMNMFDAQ+ AV +AL+ MGFK VEI VAETG
Sbjct  205  QSDPRPETLAFCLFQPNEGRVDRVSGIKYMNMFDAQVDAVHSALSDMGFKDVEIMVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD+NEVGPS++NAKAY GNL++HL+SMVGTPLMPGKSVDTYLFALYDEDLK GP S
Sbjct  265  WPYRGDNNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKVGPGS  324

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            +R+FGLY  DL+MTYD G+S                 P   K  ++ WCVPK G+SDAQL
Sbjct  325  KRAFGLYKPDLSMTYDVGISNCYPT------------PSTLKPTATIWCVPKAGISDAQL  372

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LDYAC  QGIDCSPIQPGGACFEPN +A
Sbjct  373  QSSLDYACG-QGIDCSPIQPGGACFEPNIVA  402



>ref|XP_003606895.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES89092.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=464

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 173/211 (82%), Gaps = 2/211 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+ MGF+ +EI VAETG
Sbjct  210  QSDPRSETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSGMGFQDIEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+NEVGPSV+NAKAY GNL++HLRS+VGTPLMPGKS+DTY+FALYDEDLKPG  S
Sbjct  270  WPSRGDNNEVGPSVENAKAYNGNLITHLRSLVGTPLMPGKSIDTYIFALYDEDLKPGAGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY TDLT+ YD GL KS+ + P +      + P  + K +S WC+PKGGVSD QL
Sbjct  330  ERAFGLYKTDLTVAYDVGLDKSTQKGPPSTSPNAPVTP--APKTTSQWCIPKGGVSDDQL  387

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC+ +G+DC PIQPGGAC++PNT+A
Sbjct  388  QANLDYACSREGMDCGPIQPGGACYDPNTVA  418



>ref|XP_007222662.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
 gb|EMJ23861.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
Length=483

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 172/232 (74%), Gaps = 23/232 (10%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPNGGR+D+ + I YMNMFDAQ+ A+R+AL++MG K VEI VAETG
Sbjct  206  RSDPRPETLAFCLFQPNGGRFDSKTNIKYMNMFDAQVDAIRSALDSMGAKNVEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPSV+NAKAY GNL++HLRSM GTPLMPGKSVDTYLFALYDE+LKPGP S
Sbjct  266  WPYKGDSNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYLFALYDENLKPGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPA----------------------IGP  475
            ER+FGL+  DLTMTYD GLSK+     T   +                         + P
Sbjct  326  ERAFGLFKPDLTMTYDVGLSKTRQTPSTPSSTPSTPSTTPSTPSTTPSTPSAVPQTPVNP  385

Query  476  PASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
             A K   + WC+PK GVSD+QLQAN+DY C   G DCSPIQ GGACFEPNT+
Sbjct  386  SAPKPKKAAWCLPKAGVSDSQLQANIDYVCG-HGFDCSPIQQGGACFEPNTV  436



>ref|XP_010107844.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXC17244.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=479

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 172/228 (75%), Gaps = 24/228 (11%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQL-----------------GAVRTA  130
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+                  AV +A
Sbjct  213  QSDPRPETLAFCLFQPNSGRVDSGTGIKYMNMFDAQIFDFEFYCKTGPNYQVQVDAVHSA  272

Query  131  LNAMGFKGVEIAVAETGWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVD  310
            LN++GFK VEI VAETGWPY+GDSNEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKSVD
Sbjct  273  LNSLGFKDVEIMVAETGWPYRGDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVD  332

Query  311  TYLFALYDEDLKPGPTSERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKK  490
            TY+FALYDE+LKPGP SER+FGL+  DLTMTYD GLS +     ++  +      P+   
Sbjct  333  TYIFALYDENLKPGPGSERAFGLFKPDLTMTYDVGLSNARQGPSSSTVN------PSPNP  386

Query  491  NSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             +S WCVPK GVSDAQLQ NLDYAC+   IDC  IQPGGACFEPNT+A
Sbjct  387  TASQWCVPKAGVSDAQLQTNLDYACS-HSIDCGLIQPGGACFEPNTVA  433



>gb|KDP38495.1| hypothetical protein JCGZ_04420 [Jatropha curcas]
Length=437

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 166/211 (79%), Gaps = 4/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDP PETLAFCLFQPN GR+DA + I YMNMFDAQ+ AV +AL++MGFK VEI VAETG
Sbjct  208  RSDPTPETLAFCLFQPNAGRFDANTNINYMNMFDAQVDAVHSALSSMGFKNVEIVVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  268  WPYKGDDNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  327

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DLTM YD GL  S +    +    P++  P+   N + WC PK  VSDA+ 
Sbjct  328  ERAFGLFKPDLTMIYDIGL--SKSNQAPSTPKTPSVS-PSPTPNQATWCTPKAAVSDAKS  384

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QANLDYAC   G DCSP +PGG CFEP+ +A
Sbjct  385  QANLDYACE-NGKDCSPKKPGGTCFEPHIVA  414



>ref|XP_010530842.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Tarenaya hassleriana]
Length=499

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 172/211 (82%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+ + I YMNMFDAQ+ AV +AL +MGF+GVEI VAETG
Sbjct  204  QSDPRPETLAFCLFQPNSGRVDSNTGIKYMNMFDAQVDAVHSALKSMGFEGVEIVVAETG  263

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVGPS++NAKAY GNL++HLRSM GTPLMPGK VDTY+FALYDE+ KPGP S
Sbjct  264  WPSRGDSNEVGPSLENAKAYNGNLIAHLRSMAGTPLMPGKPVDTYIFALYDENQKPGPPS  323

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+NTDL+M YD GL+KSS+ + T+        PP+ K  S  WCVPK  V+D QL
Sbjct  324  ERAFGLFNTDLSMVYDVGLAKSSSASNTSQ------APPSGKTTSVGWCVPKKDVTDEQL  377

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD++C   GIDC PIQPGGAC+EPN++A
Sbjct  378  QASLDWSCG-HGIDCGPIQPGGACYEPNSVA  407



>gb|AES74164.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=325

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 170/211 (81%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL FCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AM ++ +EI VAETG
Sbjct  75   QSDPRPETLTFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMSYEDIEIVVAETG  134

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD+NEVGPSV+NAKAY GNL++HLRS+VGTPL+PGKSVDTY+FALYDEDLKPGP S
Sbjct  135  WPSSGDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGS  194

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M+YD GL  + +     P ++P    P +   S+ WCVPK GVSDAQL
Sbjct  195  ERAFGLFKTDLSMSYDIGL--AKSSQQNPPSTSPVTPAPIT---SAGWCVPKAGVSDAQL  249

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q N+DYAC+ QGIDC PI PGGACFEPNT+A
Sbjct  250  QNNIDYACS-QGIDCGPILPGGACFEPNTVA  279



>ref|XP_006412222.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
 gb|ESQ53675.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
Length=504

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 170/211 (81%), Gaps = 5/211 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D  + I YMNMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  207  QSDPRPETLAFCLFQPNPGRPDVNTGIKYMNMFDAQVDAVHSALKSMGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVGPSVDNAKAY GNL++HLRSMVGTPLMPGKSVDTY+FALYDE+LKPGP+S
Sbjct  267  WASRGDTNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKPGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YD GL+KSS  +     S      P+ K  S+ WCVPK G +D QL
Sbjct  327  ERAFGLFKTDLSMAYDVGLAKSSGSSSGNSSSQ----TPSGKVTSTGWCVPKKGATDEQL  382

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD+AC  QGIDC PIQPGGACFEPN +A
Sbjct  383  QASLDWACG-QGIDCGPIQPGGACFEPNNVA  412



>ref|XP_011088385.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Sesamum 
indicum]
Length=506

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 175/248 (71%), Gaps = 39/248 (16%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D+GS I YMNMFDAQ+ AV +AL  MGFK VEI VAETG
Sbjct  215  QSDPRPDTLAFCLFQPNAGRVDSGSGIKYMNMFDAQVDAVHSALKGMGFKDVEIVVAETG  274

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD+NEVGPS+DNAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  275  WPYKGDANEVGPSLDNAKAYNGNLINHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  334

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPA-------------------------  466
            ERSFGL+  DL+MTYD GLSKS+     TP +                            
Sbjct  335  ERSFGLFKPDLSMTYDVGLSKSTQTPAPTPATPAPAPTTPATPAPTTPVNPAPTTPTTPV  394

Query  467  ------------IGPPASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGA  610
                        + P  S   + W CVP+ G+SDAQLQANLDYAC  QGIDCSPIQPGGA
Sbjct  395  VNPAPTTPTTPDVNPVPSPIAAGW-CVPRPGISDAQLQANLDYACG-QGIDCSPIQPGGA  452

Query  611  CFEPNTIA  634
            CFEP T+A
Sbjct  453  CFEPTTVA  460



>gb|ACN26761.1| unknown [Zea mays]
Length=323

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 166/210 (79%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D GSK+ Y NMFDAQL AV++AL   G+ GV+I VAETG
Sbjct  73   QSDPRPETLAFCLFQPNAGRVDGGSKVRYANMFDAQLDAVKSALVRAGYGGVDIVVAETG  132

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+ E G +V+NA+AYV NLV+HLRS  GTPLMPG+SVDTYLFALYDEDLKPGPTS
Sbjct  133  WPTRGDAGEPGATVENARAYVSNLVAHLRSGAGTPLMPGRSVDTYLFALYDEDLKPGPTS  192

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDLTM YDAGL+ +S     T  +APA      +  +  WCV + G SDA+L
Sbjct  193  ERSFGLYHTDLTMAYDAGLTSNSNAGGGTGTAAPA------QPKAGGWCVARDGASDAEL  246

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYAC+  G+DC  IQPGGACFEPNT+
Sbjct  247  QADLDYACSQVGVDCGAIQPGGACFEPNTV  276



>gb|KHN20071.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=445

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 174/211 (82%), Gaps = 9/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AMGF+ VEI VAETG
Sbjct  198  QSDPRSETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMGFQDVEIVVAETG  257

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVGPSV+NAKAY GNL++HLRS+VGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  258  WPSRGDSNEVGPSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGS  317

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FG++ TD T+ YD GL+KSS QTPTTP             N++ WCV K GVSDAQL
Sbjct  318  ERAFGMFKTDRTVLYDVGLTKSSQQTPTTPV--------TPAPNTAGWCVAKAGVSDAQL  369

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC+ QGIDC PIQPGG+CFEPNTIA
Sbjct  370  QANIDYACS-QGIDCGPIQPGGSCFEPNTIA  399



>ref|XP_009804916.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
sylvestris]
Length=480

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 167/225 (74%), Gaps = 14/225 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+GS I YMNMFDAQ+ A+ +ALNA GFK V+I VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGSGIKYMNMFDAQVDAIHSALNAWGFKEVQIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSVDNAKAY GNL++HLRSMVGTPLMPG SVDTY+FALYDEDLKPGP S
Sbjct  270  WPYKGDPNEVGPSVDNAKAYNGNLINHLRSMVGTPLMPGISVDTYIFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNS--------------S  499
            ERSFGL+  DL++TYD GLSK++                     +              +
Sbjct  330  ERSFGLFKPDLSVTYDVGLSKNAQTPTAPVTPVSPAPATTPTTPTTPVTPVTPTPKPTGA  389

Query  500  WWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             WC+PK G  DA+LQANLDYAC+  GIDC+PIQ GGACFEPNT+A
Sbjct  390  AWCMPKPGTPDAELQANLDYACSQAGIDCTPIQAGGACFEPNTVA  434



>ref|XP_006581120.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=480

 Score =   294 bits (752),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 174/211 (82%), Gaps = 9/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AMGF+ VEI VAETG
Sbjct  233  QSDPRSETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMGFQDVEIVVAETG  292

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVGPSV+NAKAY GNL++HLRS+VGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  293  WPSRGDSNEVGPSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGS  352

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FG++ TD T+ YD GL+KSS QTPTTP             N++ WCV K GVSDAQL
Sbjct  353  ERAFGMFKTDRTVLYDVGLTKSSQQTPTTPV--------TPAPNTAGWCVAKAGVSDAQL  404

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC+ QGIDC PIQPGG+CFEPNTIA
Sbjct  405  QANIDYACS-QGIDCGPIQPGGSCFEPNTIA  434



>ref|XP_006581121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Glycine max]
Length=459

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 174/211 (82%), Gaps = 9/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AMGF+ VEI VAETG
Sbjct  212  QSDPRSETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMGFQDVEIVVAETG  271

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVGPSV+NAKAY GNL++HLRS+VGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  272  WPSRGDSNEVGPSVENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYIFALYDEDLKPGPGS  331

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FG++ TD T+ YD GL+KSS QTPTTP             N++ WCV K GVSDAQL
Sbjct  332  ERAFGMFKTDRTVLYDVGLTKSSQQTPTTPV--------TPAPNTAGWCVAKAGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC+ QGIDC PIQPGG+CFEPNTIA
Sbjct  384  QANIDYACS-QGIDCGPIQPGGSCFEPNTIA  413



>ref|XP_004230886.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Solanum lycopersicum]
Length=473

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 171/219 (78%), Gaps = 9/219 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+ALNA GFK ++I VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDAVRSALNAWGFKEIQIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPS+DNAKAY GNL++HLRSMVGTPLMPG SVDTY+FALYDEDLKPGP S
Sbjct  270  WPYKGDPNEVGPSMDNAKAYNGNLINHLRSMVGTPLMPGISVDTYIFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASK--------KNSSWWCVPK  517
            ERSFGL+  DL+ TYDAGLSK+S         AP                  S+ WC+PK
Sbjct  330  ERSFGLFKPDLSTTYDAGLSKNSQAPTAPVTPAPVTPTTPITPVTPAPKPTGSATWCLPK  389

Query  518  GGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             G+ D++LQ+NLDYAC++ GIDCSPIQ GG CFEPNT+A
Sbjct  390  PGIPDSELQSNLDYACSM-GIDCSPIQEGGPCFEPNTVA  427



>ref|XP_009605959.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 167/225 (74%), Gaps = 14/225 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AV +ALNA GFK V+I VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDAVHSALNAWGFKEVQIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSVDNAKAY GNL++HLRSMVGTP+MPG SVDTY+FALYDEDLKPGP S
Sbjct  270  WPYKGDPNEVGPSVDNAKAYNGNLINHLRSMVGTPVMPGISVDTYIFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNS--------------S  499
            ERSFGL+  DL++TYD GLSK++                     +              S
Sbjct  330  ERSFGLFKPDLSVTYDVGLSKNAQTPTAPVTPVSPAPATTPTTPTTPVTPVTPTPKPTGS  389

Query  500  WWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             WC+PK G  DA+LQANLDYAC+  GIDC+PIQ GGACFEPNT+A
Sbjct  390  AWCMPKPGTPDAELQANLDYACSQAGIDCTPIQAGGACFEPNTVA  434



>ref|XP_009365605.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=483

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 173/234 (74%), Gaps = 27/234 (12%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  + I YMNMFDAQ+ A+R+AL++MGFKGVEI VAETG
Sbjct  206  RSDPRPETLAFCLFQPNEGRLDTNTNIKYMNMFDAQVDAIRSALDSMGFKGVEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDE+LKPGP S
Sbjct  266  WPYKGDDNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDENLKPGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksA----------------PAIGP------  475
            ER+FGL+  DLTM YD GLSKSS    T                     P+  P      
Sbjct  326  ERAFGLFKPDLTMAYDVGLSKSSQTPTTPITPTTPSMPTTPSTPSASPMPSAVPKTPVNP  385

Query  476  --PASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
              P  KK S  +CVPK GVSD+QLQAN+DY C  +G DC+PIQPGG+CFEPN +
Sbjct  386  SGPNPKKES--YCVPKAGVSDSQLQANIDYVCG-RGFDCTPIQPGGSCFEPNNV  436



>ref|XP_008375942.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
7 [Malus domestica]
Length=486

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 170/216 (79%), Gaps = 7/216 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR ++G+ I YMN+FDA +  VR+ALNA+GFK ++I +AETG
Sbjct  212  QSDPRPETLAFCLFQPNAGRVNSGNGIKYMNLFDAXVDVVRSALNAVGFKDIDILIAETG  271

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GD NE+GPSV+NA+AY GNL++HLRSMVGTPLMPG+SV+TY+FALYDEDLKPGP S
Sbjct  272  WPYHGDDNEIGPSVENARAYNGNLIAHLRSMVGTPLMPGQSVETYIFALYDEDLKPGPAS  331

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpk-----sAPAIGPPASKKNSSWWCVPKGGV  526
            ER FGL+  DLT TYD GL+KSS  T          S P +  P+ K  S+ WCVPK  V
Sbjct  332  ERYFGLFKPDLTATYDVGLTKSSQMTHLKTFQRNTPSTPTVS-PSPKPTSAQWCVPKSDV  390

Query  527  SDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
              AQLQANLDYAC   GIDCS IQPGGACF+PNT+A
Sbjct  391  FIAQLQANLDYACG-HGIDCSAIQPGGACFDPNTVA  425



>ref|XP_003603912.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES74163.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=459

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 170/211 (81%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL FCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AM ++ +EI VAETG
Sbjct  209  QSDPRPETLTFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMSYEDIEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD+NEVGPSV+NAKAY GNL++HLRS+VGTPL+PGKSVDTY+FALYDEDLKPGP S
Sbjct  269  WPSSGDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M+YD GL  + +     P ++P    P +   S+ WCVPK GVSDAQL
Sbjct  329  ERAFGLFKTDLSMSYDIGL--AKSSQQNPPSTSPVTPAPIT---SAGWCVPKAGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q N+DYAC+ QGIDC PI PGGACFEPNT+A
Sbjct  384  QNNIDYACS-QGIDCGPILPGGACFEPNTVA  413



>ref|XP_008377425.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=474

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 171/225 (76%), Gaps = 18/225 (8%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GR D  + I YMNMFDAQ+ A+R+AL++MGFKGVEI VAETG
Sbjct  206  RGDPRPETLAFCLFQPNEGRLDTNTNIKYMNMFDAQVDAIRSALDSMGFKGVEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSV+NAKAY GNL++HLRSM+GTPLMPGKSVDTYLFALYDE+LKPGP S
Sbjct  266  WPYKGDDNEVGPSVENAKAYNGNLIAHLRSMLGTPLMPGKSVDTYLFALYDENLKPGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksA-------PAIGP--------PASKKNS  496
            ER+FGL+  DLTM YD GLSKSS    T            P+  P        P  KK S
Sbjct  326  ERAFGLFKPDLTMAYDVGLSKSSXTPTTPITPTTPSASPMPSAVPKTPVNPSGPNPKKES  385

Query  497  SWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
              +CVPK GVSD+QLQAN+DY C   G DC+PIQPGG+CFEPN +
Sbjct  386  --YCVPKAGVSDSQLQANIDYVCG-SGFDCTPIQPGGSCFEPNNV  427



>gb|EPS59066.1| hypothetical protein M569_15744, partial [Genlisea aurea]
Length=440

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 162/207 (78%), Gaps = 13/207 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AV +AL +MGF  +EI VAETG
Sbjct  199  QSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALKSMGFGDLEIVVAETG  258

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD  E+GPS+DNAKAY GNL++HLRSMVGTPLMP KSVDTYLFALYDEDLKPGP S
Sbjct  259  WPYRGDPTEIGPSLDNAKAYNGNLINHLRSMVGTPLMPRKSVDTYLFALYDEDLKPGPLS  318

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+ TY+ GLS              ++ P     +++ WCVP+ GV DA+L
Sbjct  319  ERSFGLFKPDLSTTYNVGLSSL------------SVSPARPTPSAARWCVPRAGVGDAEL  366

Query  542  QANLDYACALQGIDCSPIQPGGACFEP  622
            Q+NLDYAC  QGIDC PIQPGGACFEP
Sbjct  367  QSNLDYACG-QGIDCGPIQPGGACFEP  392



>ref|XP_003603913.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=477

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 170/211 (81%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL FCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AM ++ +EI VAETG
Sbjct  227  QSDPRPETLTFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMSYEDIEIVVAETG  286

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD+NEVGPSV+NAKAY GNL++HLRS+VGTPL+PGKSVDTY+FALYDEDLKPGP S
Sbjct  287  WPSSGDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGS  346

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M+YD GL  + +     P ++P    P +   S+ WCVPK GVSDAQL
Sbjct  347  ERAFGLFKTDLSMSYDIGL--AKSSQQNPPSTSPVTPAPIT---SAGWCVPKAGVSDAQL  401

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q N+DYAC+ QGIDC PI PGGACFEPNT+A
Sbjct  402  QNNIDYACS-QGIDCGPILPGGACFEPNTVA  431



>ref|XP_009407686.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 164/210 (78%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLF+PN GR+D GSK+TY NMFDAQL AV++AL A GF   E+ VAETG
Sbjct  209  QSDPRPETLAFCLFRPNPGRFDGGSKLTYTNMFDAQLDAVKSALTAAGFSEAEVVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD +E G +VDNAKA+  NLV+HLRSM GTPLMPG+SVDTY+FALYDEDLKPGPTS
Sbjct  269  WPYRGDQDEAGATVDNAKAFNVNLVAHLRSMAGTPLMPGRSVDTYIFALYDEDLKPGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+  YDAGL+K+ T          + G PA K  ++ WCVPK   +D  L
Sbjct  329  ERSFGLFRADLSPVYDAGLAKTGTTQGN------STGTPARKPVAAGWCVPKAEATDEDL  382

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QANLDYACA QG+DC PIQ GGAC+ PNT+
Sbjct  383  QANLDYACAQQGVDCRPIQEGGACYLPNTV  412



>ref|XP_004293211.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   292 bits (747),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 171/229 (75%), Gaps = 19/229 (8%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GR+D+ + I YMNMFDAQ+ A+++ALN+MG   VEI VAETG
Sbjct  207  RDDPRPETLAFCLFQPNEGRFDSNTNIKYMNMFDAQVDAIKSALNSMGHGDVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSV NAKAY GNL++HLRSMVGTPLMPGKSVDTY FALYDE+LKPGP S
Sbjct  267  WPYKGDDNEVGPSVQNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYFFALYDENLKPGPGS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstq------------------tpttpksAPAIGPPASK  487
            ER+FGL+  DLTMTYD GL+KS++Q                  TP+T    PA    A K
Sbjct  327  ERAFGLFKPDLTMTYDVGLAKSASQTPTTPTMPATPTVPTTPKTPSTGPKTPANPSAAPK  386

Query  488  KNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             N   WC+PK G S+ QLQAN+DY C   G DCSPIQPGGACFEPN +A
Sbjct  387  PNKGVWCLPKKGASETQLQANIDYVCG-HGFDCSPIQPGGACFEPNNVA  434



>ref|NP_001275210.1| glucan endo-1,3-beta-D-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52647.1| beta-1,3-glucanase 12 [Solanum tuberosum]
Length=470

 Score =   291 bits (745),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+ALNA GFK ++I VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDAVRSALNAWGFKEIQIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPS+DNAKAY GNL++HLRSMVGTPLMPG SVDTY+FALYDEDLKPGP S
Sbjct  270  WPYKGDPNEVGPSMDNAKAYNGNLINHLRSMVGTPLMPGISVDTYIFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKN-----SSWWCVPKGGV  526
            ERSFGL+  DL+ TYDAGLSK S         APA              S+ WC+PK G+
Sbjct  330  ERSFGLFKPDLSTTYDAGLSKKSQTPTAPVTPAPATPTTPVTPAPKPTGSATWCLPKPGI  389

Query  527  SDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             D++LQ+NLDYAC++ GIDCSPIQ GG CFEP T+A
Sbjct  390  PDSELQSNLDYACSM-GIDCSPIQEGGPCFEPITVA  424



>ref|XP_007160762.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
 gb|ESW32756.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
Length=473

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 171/220 (78%), Gaps = 11/220 (5%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR D  + + YMNMFDAQ+ AVR+AL+++GFK VEI VAET
Sbjct  208  RSDPGRADNLAFCLFQPNAGRVDPNTNLKYMNMFDAQVDAVRSALDSLGFKNVEIVVAET  267

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPG  
Sbjct  268  GWPYKGDTSEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGDA  327

Query  359  SERSFGLYNTDLTMTYDAGLsksstqtpttpksAPA--------IGPPASKKNSS-WWCV  511
            SER+FGL+N D +M YDAGL+K        P SAP         + P  +K NSS  WCV
Sbjct  328  SERAFGLFNPDQSMIYDAGLTKQQQTNSPVPVSAPTTPDLSKSPVTPKPTKTNSSGTWCV  387

Query  512  PKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            PK GVSDA+LQANLDYAC  QGIDC  IQ GGACFEPNT+
Sbjct  388  PKAGVSDAELQANLDYACG-QGIDCVAIQQGGACFEPNTL  426



>emb|CDX69064.1| BnaC01g03890D [Brassica napus]
Length=505

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 169/211 (80%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + D RPETLAFCLFQPN GR D  + I YMNMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  207  RDDTRPETLAFCLFQPNPGRVDGNTGIKYMNMFDAQVDAVHSALKSMGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD NEVGPSVDNAKAY GNL++HL+SMVGTPLMPGKSVDTY+FALYDE+LKPGP+S
Sbjct  267  WPSRGDPNEVGPSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL++ YDAGL+KSS  +  +         P+ K  S+ WCVP+ G +D QL
Sbjct  327  ERAFGLFKTDLSIAYDAGLAKSSGSSSNSSSQT-----PSGKVTSTGWCVPRNGATDQQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD+AC  QGIDC PIQPGGACFEPN +A
Sbjct  382  QASLDWACG-QGIDCGPIQPGGACFEPNNVA  411



>ref|NP_001148381.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACG31222.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 tpg|DAA50560.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=461

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 166/210 (79%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D GSK+ Y NMFDAQL AV++AL   G+ GV+I VAETG
Sbjct  211  QSDPRPETLAFCLFQPNAGRVDGGSKVRYANMFDAQLDAVKSALVRAGYGGVDIVVAETG  270

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+ E G +V+NA+AYV NLV+HLRS  GTPLMPG+SVDTYLFALYDEDLKPGPTS
Sbjct  271  WPTRGDAGEPGATVENARAYVSNLVAHLRSGAGTPLMPGRSVDTYLFALYDEDLKPGPTS  330

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDLTM YDAGL+ +S     T  +APA      +  +  WCV + G SDA+L
Sbjct  331  ERSFGLYHTDLTMAYDAGLTSNSNAGGGTGTAAPA------QPKAGGWCVARDGASDAEL  384

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYAC+  G+DC  IQPGGACFEPNT+
Sbjct  385  QADLDYACSQVGVDCGAIQPGGACFEPNTV  414



>emb|CDX75437.1| BnaA01g02650D [Brassica napus]
Length=506

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 169/211 (80%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + D RPETLAFCLFQPN GR D  + I YMNMFDAQ+ AV +AL ++GF+ VEI VAETG
Sbjct  207  RGDTRPETLAFCLFQPNPGRVDGNTGIKYMNMFDAQVDAVHSALKSVGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD NEVGPSVDNAKAY GNL++HL+SMVGTPLMPGKSVDTY+FALYDE+LKPGP+S
Sbjct  267  WPSRGDPNEVGPSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YDAGL+KSS  +  +         P+ K  S+ WCVP+ G +D QL
Sbjct  327  ERAFGLFKTDLSMAYDAGLAKSSGSSSNSSGQT-----PSGKVTSTGWCVPRNGATDEQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD+AC  QGIDC PIQPGGACFEPN +A
Sbjct  382  QASLDWACG-QGIDCGPIQPGGACFEPNNVA  411



>ref|XP_004499144.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Cicer arietinum]
Length=485

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 172/230 (75%), Gaps = 20/230 (9%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR D+ +K+ YMNMFDAQ+ AVR+AL++MGFK +EI VAET
Sbjct  211  KSDPGRADNLAFCLFQPNSGRVDSNTKLNYMNMFDAQVDAVRSALDSMGFKDIEIVVAET  270

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL+SHLRS VGTPLMPGKSVDTY+FALYDEDLKPG  
Sbjct  271  GWPYKGDNDEAGPSLENAKAYNGNLISHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAA  330

Query  359  SERSFGLYNTDLTMTYDAGLskss-----------------tqtpttpksAPAIGPPASK  487
            SER+FGLYN D +M YD GLSK                     + +   S P +  P   
Sbjct  331  SERAFGLYNPDQSMIYDVGLSKQQSTSPTPTTSPMVAPINPNVSKSPTNSTPKVSSPTKP  390

Query  488  KNSSW-WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             NS+  WCVPK GV+DAQLQANLDYAC  QGIDCS IQPGGACFEPNT+A
Sbjct  391  NNSNIAWCVPKPGVTDAQLQANLDYACG-QGIDCSLIQPGGACFEPNTLA  439



>gb|KEH40123.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=479

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 174/230 (76%), Gaps = 20/230 (9%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR DA +K+ YMNMFDAQ+ AVR+AL++MGFK VEI VAET
Sbjct  205  KSDPGRADNLAFCLFQPNAGRVDANTKLNYMNMFDAQVDAVRSALDSMGFKDVEIVVAET  264

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL+ HLRS VGTPLMPGKSVDTY+FALYDEDLKPG  
Sbjct  265  GWPYKGDNDEAGPSIENAKAYNGNLIKHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAG  324

Query  359  SERSFGLYNTDLTMTYDAGLsksst-----------------qtpttpksAPAIGPPASK  487
            SE++FGLYNTD +M YDAGLSK  +                  + +   S P +  P + 
Sbjct  325  SEKAFGLYNTDQSMIYDAGLSKQQSTTPTPTSSPVVSPINQDVSKSPMNSTPKVPSPTTP  384

Query  488  KNSSW-WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             NS+  WCVPK G++D QLQANLDYAC  QGIDCS IQPGGACFEPNT+A
Sbjct  385  YNSNIAWCVPKAGLTDVQLQANLDYACG-QGIDCSLIQPGGACFEPNTLA  433



>gb|KEH40125.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=481

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 174/230 (76%), Gaps = 20/230 (9%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR DA +K+ YMNMFDAQ+ AVR+AL++MGFK VEI VAET
Sbjct  205  KSDPGRADNLAFCLFQPNAGRVDANTKLNYMNMFDAQVDAVRSALDSMGFKDVEIVVAET  264

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL+ HLRS VGTPLMPGKSVDTY+FALYDEDLKPG  
Sbjct  265  GWPYKGDNDEAGPSIENAKAYNGNLIKHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAG  324

Query  359  SERSFGLYNTDLTMTYDAGLsksst-----------------qtpttpksAPAIGPPASK  487
            SE++FGLYNTD +M YDAGLSK  +                  + +   S P +  P + 
Sbjct  325  SEKAFGLYNTDQSMIYDAGLSKQQSTTPTPTSSPVVSPINQDVSKSPMNSTPKVPSPTTP  384

Query  488  KNSSW-WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             NS+  WCVPK G++D QLQANLDYAC  QGIDCS IQPGGACFEPNT+A
Sbjct  385  YNSNIAWCVPKAGLTDVQLQANLDYACG-QGIDCSLIQPGGACFEPNTLA  433



>ref|XP_009112198.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
Length=506

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 169/211 (80%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + D RPETLAFCLFQPN GR D  + I YMNMFDAQ+ AV +AL ++GF+ VEI VAETG
Sbjct  207  RGDTRPETLAFCLFQPNPGRVDGNTGIKYMNMFDAQVDAVHSALKSVGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD NEVGPSVDNAKAY GNL++HL+SMVGTPLMPGKSVDTY+FALYDE+LKPGP+S
Sbjct  267  WPSRGDPNEVGPSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YDAGL+KSS  +  +         P+ K  S+ WCVP+ G +D QL
Sbjct  327  ERAFGLFKTDLSMAYDAGLAKSSGSSSNSSGQT-----PSGKVTSTGWCVPRNGATDEQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD+AC  QGIDC PIQPGGACFEPN +A
Sbjct  382  QASLDWACG-QGIDCGPIQPGGACFEPNNVA  411



>gb|KHN25369.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=321

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D GS   Y NMFDAQ+ AV  AL++MGFK +EI +AETG
Sbjct  69   QSDPRPETLAFCLFQPNSGRVDTGSGKVYSNMFDAQVDAVHAALSSMGFKDMEIVIAETG  128

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVG SV+NAKAY GNL+ HLRS+VGTPLMPGKSVDT++FALYDEDLK GP S
Sbjct  129  WPSRGDSNEVGASVENAKAYNGNLIEHLRSLVGTPLMPGKSVDTFIFALYDEDLKRGPAS  188

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPAS-----KKNSSWWCVPKGGV  526
            ER+FGL+ TDLTM YD GL KS +             PP S      K  + WC+PK  V
Sbjct  189  ERAFGLFKTDLTMAYDVGLDKSGSTHK---------NPPTSPVTPAPKTGTQWCIPKVEV  239

Query  527  SDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            ++AQLQAN+DY C  Q +DC PIQP GAC+EPNTI+
Sbjct  240  TEAQLQANIDYICGSQVVDCGPIQPEGACYEPNTIS  275



>gb|KEH40124.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=486

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 174/230 (76%), Gaps = 20/230 (9%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR DA +K+ YMNMFDAQ+ AVR+AL++MGFK VEI VAET
Sbjct  205  KSDPGRADNLAFCLFQPNAGRVDANTKLNYMNMFDAQVDAVRSALDSMGFKDVEIVVAET  264

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL+ HLRS VGTPLMPGKSVDTY+FALYDEDLKPG  
Sbjct  265  GWPYKGDNDEAGPSIENAKAYNGNLIKHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAG  324

Query  359  SERSFGLYNTDLTMTYDAGLsksst-----------------qtpttpksAPAIGPPASK  487
            SE++FGLYNTD +M YDAGLSK  +                  + +   S P +  P + 
Sbjct  325  SEKAFGLYNTDQSMIYDAGLSKQQSTTPTPTSSPVVSPINQDVSKSPMNSTPKVPSPTTP  384

Query  488  KNSSW-WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             NS+  WCVPK G++D QLQANLDYAC  QGIDCS IQPGGACFEPNT+A
Sbjct  385  YNSNIAWCVPKAGLTDVQLQANLDYACG-QGIDCSLIQPGGACFEPNTLA  433



>ref|XP_004148850.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
 gb|KGN61789.1| hypothetical protein Csa_2G246520 [Cucumis sativus]
Length=464

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 169/211 (80%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMG-FKGVEIAVAET  178
            QSDPR ETLAFCLFQPN GR D+G+ I YMNMFDAQL AVR+ALNA+G FK VEI VAET
Sbjct  212  QSDPRDETLAFCLFQPNSGRVDSGNGIKYMNMFDAQLDAVRSALNALGGFKDVEIMVAET  271

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GW Y+GDSNEVG SV+NA+AY GNL++HLRSMVGTPLMPGKSVDTY+FALYDE+LKPGPT
Sbjct  272  GWAYRGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKPGPT  331

Query  359  SERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQ  538
            SER+FGL+  +LTMTYD GLSK+S    T           +SK  +  WC+PK  + D Q
Sbjct  332  SERAFGLFYPNLTMTYDVGLSKNSQTPTTPTTPTTP----SSKPTAPVWCLPKADIPDDQ  387

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            LQ+NLDYAC   GIDC PIQPGGACFEPNTI
Sbjct  388  LQSNLDYACG-HGIDCGPIQPGGACFEPNTI  417



>ref|XP_004499143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Cicer arietinum]
Length=520

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 172/230 (75%), Gaps = 20/230 (9%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR D+ +K+ YMNMFDAQ+ AVR+AL++MGFK +EI VAET
Sbjct  211  KSDPGRADNLAFCLFQPNSGRVDSNTKLNYMNMFDAQVDAVRSALDSMGFKDIEIVVAET  270

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL+SHLRS VGTPLMPGKSVDTY+FALYDEDLKPG  
Sbjct  271  GWPYKGDNDEAGPSLENAKAYNGNLISHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAA  330

Query  359  SERSFGLYNTDLTMTYDAGLskss-----------------tqtpttpksAPAIGPPASK  487
            SER+FGLYN D +M YD GLSK                     + +   S P +  P   
Sbjct  331  SERAFGLYNPDQSMIYDVGLSKQQSTSPTPTTSPMVAPINPNVSKSPTNSTPKVSSPTKP  390

Query  488  KNSSW-WCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             NS+  WCVPK GV+DAQLQANLDYAC  QGIDCS IQPGGACFEPNT+A
Sbjct  391  NNSNIAWCVPKPGVTDAQLQANLDYACG-QGIDCSLIQPGGACFEPNTLA  439



>ref|XP_008457927.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cucumis melo]
Length=464

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 167/211 (79%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMG-FKGVEIAVAET  178
            QSDPR ETLAFCLFQPN GR D+G+ I YMNMFDAQL AVR+ LNA+G FK VEI VAET
Sbjct  212  QSDPRDETLAFCLFQPNSGRVDSGNGIKYMNMFDAQLDAVRSGLNALGDFKDVEIMVAET  271

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GW Y+GDSNEVG SV+NA+AY GNL++HLRSMVGTPLMPGKSVDTY+FALYDE+LKPGPT
Sbjct  272  GWAYRGDSNEVGTSVENARAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKPGPT  331

Query  359  SERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQ  538
            SERSFGL+  +LTMTYD GLSK+S    T           + K  +  WC+PK  + D Q
Sbjct  332  SERSFGLFYPNLTMTYDVGLSKNSQTPTTPTTPTTP----SPKPTAPVWCLPKADIPDDQ  387

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            LQ+NLDYAC   GIDC PIQPGGACFEPNT+
Sbjct  388  LQSNLDYACG-HGIDCGPIQPGGACFEPNTV  417



>ref|XP_004507424.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cicer arietinum]
Length=458

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 162/211 (77%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL AMGF+ +EI VAETG
Sbjct  209  QSDPRSETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALGAMGFEEIEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+NE+GPSV+NAKAY GNL++HLRS+VGTPLMP KS+DTY+F LYDEDLKPGP S
Sbjct  269  WPSRGDNNEIGPSVENAKAYNGNLITHLRSLVGTPLMPAKSIDTYIFGLYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY  DLT+ YD GL         + + +P+  P      ++ WC+P  GV+D+QL
Sbjct  329  ERAFGLYKIDLTVAYDVGL-------DKSTQKSPSSSPKGRVTPATQWCIPVVGVTDSQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q NLDY C+ +GIDC  IQ GGACFEPNTIA
Sbjct  382  QTNLDYVCSREGIDCKEIQQGGACFEPNTIA  412



>ref|XP_009406752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR+DAGS +TYMNMFDAQL  V +A+ A+GFKG EI VAETG
Sbjct  210  RSDPRPETLAFCLFQPNAGRHDAGSGVTYMNMFDAQLDGVGSAVAAVGFKGAEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD  EVG +V+NA+AY G LVSHLRS+ GTP+ PGKSVDTY+FALYDEDLKPGPTS
Sbjct  270  WPYRGDEGEVGATVENAQAYNGGLVSHLRSLAGTPMAPGKSVDTYIFALYDEDLKPGPTS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL++ DLT TYD GL++SS+ +     +  +    A+ K    WCVP+ G +DA+L
Sbjct  330  ERSFGLFHPDLTPTYDIGLARSSSSSTPAQGNGTSAPRAAAAKG---WCVPREGATDAEL  386

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QANLDYAC   G+DC PIQ GGAC+ PNT+
Sbjct  387  QANLDYACGQPGVDCRPIQEGGACYLPNTV  416



>gb|AIR93913.1| glucanase [Cicer arietinum]
Length=460

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 162/211 (77%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL AMGF+ +EI VAETG
Sbjct  209  QSDPRSETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALGAMGFEEIEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+NE+GPSV+NAKAY GNL++HLRS+VGTPLMP KS+DTY+F LYDEDLKPGP S
Sbjct  269  WPSRGDNNEIGPSVENAKAYNGNLITHLRSLVGTPLMPAKSIDTYIFGLYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY  DLT+ YD GL         + + +P+  P      ++ WC+P  GV+D+QL
Sbjct  329  ERAFGLYKIDLTVAYDVGL-------DKSTQKSPSSSPKGRVTPATQWCIPVVGVTDSQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q NLDY C+ +GIDC  IQ GGACFEPNTIA
Sbjct  382  QTNLDYVCSREGIDCKEIQQGGACFEPNTIA  412



>ref|XP_010432409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 168/211 (80%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL+FCLFQPN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  209  QSDPRPETLSFCLFQPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNA+AY GNL++HL+SMVGTPLMPGK VDTYLFALYDE+LKPGP+S
Sbjct  269  WASRGDANEVGTSVDNARAYNGNLIAHLKSMVGTPLMPGKPVDTYLFALYDENLKPGPSS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YD GL+KSS+    +         P+ K  S+ WCVPK G +D QL
Sbjct  329  ERAFGLFKTDLSMAYDVGLAKSSSSDSNSSGQT-----PSGKMTSTGWCVPKKGATDDQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LD+AC  QGIDC PIQPGGACFEPN +A
Sbjct  384  QSSLDWACG-QGIDCGPIQPGGACFEPNNVA  413



>ref|XP_006283912.1| hypothetical protein CARUB_v10005030mg [Capsella rubella]
 gb|EOA16810.1| hypothetical protein CARUB_v10005030mg [Capsella rubella]
Length=385

 Score =   284 bits (726),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 167/211 (79%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL+FCLFQPN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  86   QSDPRPETLSFCLFQPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  145

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNAKAY GNL++HL+SM+GTPLMPGK VDTY+FALY+E+LKPGP+S
Sbjct  146  WASRGDANEVGTSVDNAKAYNGNLIAHLKSMIGTPLMPGKPVDTYIFALYEENLKPGPSS  205

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YD GL+KSS+    +         P+ K  S+ WCVPK G ++ QL
Sbjct  206  ERAFGLFKTDLSMAYDVGLAKSSSSGSNSSGQT-----PSGKVTSTGWCVPKKGATNEQL  260

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD+AC  QGIDC  IQPGGACFEPN +A
Sbjct  261  QASLDWACG-QGIDCGAIQPGGACFEPNNVA  290



>ref|XP_010447074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   287 bits (735),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 168/211 (80%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL+FCLFQPN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  209  QSDPRPETLSFCLFQPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNA+AY GNL++HL+SM+GTPLMPGK VDTYLFALYDE+LKPGP+S
Sbjct  269  WASRGDANEVGTSVDNARAYNGNLIAHLKSMIGTPLMPGKPVDTYLFALYDENLKPGPSS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YD GL+KSS+    +         P+ K  S+ WCVPK G +D QL
Sbjct  329  ERAFGLFKTDLSMAYDVGLAKSSSSDSNSSGQT-----PSGKVTSTGWCVPKKGATDDQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LD+AC  QGIDC PIQPGGACFEPN +A
Sbjct  384  QSSLDWACG-QGIDCGPIQPGGACFEPNNVA  413



>ref|XP_010444969.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
7-like [Camelina sativa]
Length=507

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 168/211 (80%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL+FCLFQPN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  208  QSDPRPETLSFCLFQPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNA+AY GNL++HL+SM+GTPLMPGK VDTYLFALYDE+LKPGP+S
Sbjct  268  WASRGDANEVGTSVDNARAYNGNLIAHLKSMIGTPLMPGKPVDTYLFALYDENLKPGPSS  327

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YD GL+KSS+    +         P+ K  S+ WCVPK G +D QL
Sbjct  328  ERAFGLFKTDLSMAYDVGLAKSSSSDSNSSGQT-----PSGKVTSTGWCVPKKGATDDQL  382

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q++LD+AC  QGIDC PIQPGGACFEPN +A
Sbjct  383  QSSLDWACG-QGIDCGPIQPGGACFEPNNVA  412



>ref|XP_007042209.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX98040.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=511

 Score =   287 bits (735),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 173/254 (68%), Gaps = 45/254 (18%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQ------------------------  109
            QSD RPETLAF LFQPN GR D+G+ I Y NMFDAQ                        
Sbjct  205  QSDSRPETLAFSLFQPNAGRVDSGNGIKYTNMFDAQAPVLSVMVLMTFFFHVVPKYIRAG  264

Query  110  -------------------LGAVRTALNAMGFKGVEIAVAETGWPYKGDSNEVGPSVDNA  232
                               + AV +AL+AMGFK VEI VAETGWPY GDSNEVGPS++NA
Sbjct  265  HCNNSRFALPGFHLWLDVDVDAVHSALSAMGFKDVEIMVAETGWPYAGDSNEVGPSIENA  324

Query  233  KAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGLYNTDLTMTYDA  412
            KAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLK GP SER+FGL+  DL+MTYDA
Sbjct  325  KAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKSGPASERAFGLFRPDLSMTYDA  384

Query  413  GLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSP  592
            GLSKSS    T       +  P  K  +S WCVPK G+SDAQLQA+LDYAC+ QGIDC P
Sbjct  385  GLSKSSQTPSTPQNPVTPVT-PQPKPTASGWCVPKAGISDAQLQASLDYACS-QGIDCGP  442

Query  593  IQPGGACFEPNTIA  634
            IQPGGACFEPNT+A
Sbjct  443  IQPGGACFEPNTVA  456



>gb|KFK30062.1| hypothetical protein AALP_AA7G211800 [Arabis alpina]
Length=503

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 169/211 (80%), Gaps = 7/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GR D  + I YMNMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  208  RDDPRPETLAFCLFQPNAGRVDHNTGIKYMNMFDAQVDAVHSALKSMGFEKVEIVVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNAKAY GNL++HL+SMVGTPLMPGKSVDTY+FALYDE+LKPGP+S
Sbjct  268  WASRGDANEVGTSVDNAKAYNGNLIAHLKSMVGTPLMPGKSVDTYIFALYDENLKPGPSS  327

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YD GL+KSS+   ++ ++      P+ K  S+ WCVPK G +  QL
Sbjct  328  ERAFGLFKTDLSMAYDVGLAKSSSSGNSSGQT------PSGKVTSTGWCVPKKGATVEQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD+AC  QGIDC PIQPGG CF+PN +A
Sbjct  382  QASLDWACG-QGIDCGPIQPGGVCFDPNNVA  411



>gb|ACJ84511.1| unknown [Medicago truncatula]
Length=407

 Score =   281 bits (720),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 164/205 (80%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL FCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+AM ++ +EI VAETG
Sbjct  209  QSDPRPETLTFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAMSYEDIEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD+NEVGPSV+NAKAY GNL++HLRS+VGTPL+PGKSVDTY+FALYDEDLKPGP S
Sbjct  269  WPSSGDNNEVGPSVENAKAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M+YD GL  + +     P ++P    P +   S+ WCVPK GVSDAQL
Sbjct  329  ERAFGLFKTDLSMSYDIGL--AKSSQQNPPSTSPVTPAPIT---SAGWCVPKAGVSDAQL  383

Query  542  QANLDYACALQGIDCSPIQPGGACF  616
            Q N+DYAC+ QGIDC PI PGGACF
Sbjct  384  QNNIDYACS-QGIDCGPILPGGACF  407



>gb|AAP44659.1| putative beta 1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF98103.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE63416.1| hypothetical protein OsJ_18228 [Oryza sativa Japonica Group]
Length=464

 Score =   283 bits (724),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR DAGSKI Y NMFDAQ+ AV++AL   G+  VEI VAETG
Sbjct  211  QSDPRPETLAFCLFQPNAGRVDAGSKIKYTNMFDAQVDAVKSALGRAGYGDVEIVVAETG  270

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+ E G + DNA+AYV NLVSHLRS  GTPLMPGK VDTYLFALYDEDLKPGPTS
Sbjct  271  WPTRGDAGEAGATADNARAYVSNLVSHLRSGAGTPLMPGKPVDTYLFALYDEDLKPGPTS  330

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDLTM YDAGL+ SS    +      +   P  +     WCV   G ++A L
Sbjct  331  ERSFGLYHTDLTMAYDAGLTSSSGGAASPSNGGASQQQP--RGGGGGWCVASAGATEADL  388

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYACA  G+DC  IQ GGACFEPNT+
Sbjct  389  QADLDYACAQVGVDCGAIQAGGACFEPNTV  418



>ref|XP_004500813.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cicer arietinum]
Length=440

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 164/211 (78%), Gaps = 19/211 (9%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q+DPRPETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+A  ++ +EI VAETG
Sbjct  206  QTDPRPETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAKRYEDIEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVGPSV+NA AY GNL++HLRS+VGTPL+PGKSVDTY+FALYDEDLK GP S
Sbjct  266  WPSRGDSNEVGPSVENASAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKSGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DL+M+YD GL+K                  ++ +  + WC+PK GVSD QL
Sbjct  326  ERAFGLFKPDLSMSYDVGLAK------------------STHQTPAGWCIPKAGVSDTQL  367

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q+N+DYAC  QGIDC PI+PGGACFEPNT+A
Sbjct  368  QSNIDYACG-QGIDCGPIKPGGACFEPNTVA  397



>gb|AIR93908.1| glucanase [Cicer arietinum]
Length=454

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 164/211 (78%), Gaps = 19/211 (9%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q+DPRPETLAFCLFQPN GR D+G+   Y NMFDAQ+ AV +AL+A  ++ +EI VAETG
Sbjct  206  QTDPRPETLAFCLFQPNSGRVDSGNGKLYTNMFDAQVDAVHSALSAKRYEDIEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GDSNEVGPSV+NA AY GNL++HLRS+VGTPL+PGKSVDTY+FALYDEDLK GP S
Sbjct  266  WPSRGDSNEVGPSVENASAYNGNLITHLRSLVGTPLIPGKSVDTYIFALYDEDLKSGPGS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+  DL+M+YD GL+K                  ++ +  + WC+PK GVSD QL
Sbjct  326  ERAFGLFKPDLSMSYDVGLAK------------------STHQTPAGWCIPKAGVSDTQL  367

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q+N+DYAC  QGIDC PI+PGGACFEPNT+A
Sbjct  368  QSNIDYACG-QGIDCGPIKPGGACFEPNTVA  397



>ref|XP_002466692.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
 gb|EER93690.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
Length=475

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 159/210 (76%), Gaps = 0/210 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D GSKI Y NMFDAQL AV++AL   G+  V+I VAETG
Sbjct  219  QSDPRPETLAFCLFQPNAGRVDGGSKIRYTNMFDAQLDAVKSALVRAGYGSVDIVVAETG  278

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD+ E G + +NA+AYV NLV+HLRS  GTPLMPG+SV+TYLFALYDEDLKPGPTS
Sbjct  279  WPTKGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGRSVETYLFALYDEDLKPGPTS  338

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDLTM YDAGL+ SS+               A  K    WCV + G SDA L
Sbjct  339  ERSFGLYHTDLTMAYDAGLTSSSSAGAAGGGGGGGGSAAAQPKQGGGWCVARDGASDADL  398

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYAC+  G+DC  IQPGGACFEPNT+
Sbjct  399  QADLDYACSQLGVDCGAIQPGGACFEPNTV  428



>ref|NP_195174.6| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
 sp|Q9M069.2|E137_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 7; AltName: Full=(1->3)-beta-glucan 
endohydrolase 7; Short=(1->3)-beta-glucanase 
7; AltName: Full=Beta-1,3-endoglucanase 7; Short=Beta-1,3-glucanase 
7; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86384.1| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
Length=504

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 166/210 (79%), Gaps = 11/210 (5%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLF+PN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  207  QSDPRPETLAFCLFEPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNAKAY GNL++HLRSMVGTPLMPGK VDTY+FALYDE+LKPGP+S
Sbjct  267  WASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TDL+M YD GL+KSS+ + T          P+ K  SS WCVPK G ++ +L
Sbjct  327  ERAFGLFKTDLSMVYDVGLAKSSSSSQT----------PSGKVTSSGWCVPKKGATNEEL  376

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LD+AC   GIDC  IQPGGACFEPN +
Sbjct  377  QASLDWACG-HGIDCGAIQPGGACFEPNNV  405



>ref|XP_007131842.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
 gb|ESW03836.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
Length=459

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 165/212 (78%), Gaps = 8/212 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D G+   Y NM DAQ+ AV++ L++MG + +EI +AETG
Sbjct  207  QSDPRPETLAFCLFQPNSGRVDQGNGNVYSNMLDAQVDAVQSGLSSMGMEDMEIVIAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+NEVG +++NA+AY GNL++HLRSMVGTP MPGKSVDT++FALYDEDLKPGP S
Sbjct  267  WPSRGDTNEVGATLENARAYNGNLIAHLRSMVGTPSMPGKSVDTFIFALYDEDLKPGPAS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGP--PASKKNSSWWCVPKGGVSDA  535
            ER+FGL+ TDLTM+YD GL  S++         P  GP  PA K+ +  WC+PK  VS+A
Sbjct  327  ERAFGLFKTDLTMSYDVGLDNSASSHKN-----PPTGPVTPAPKRETE-WCIPKVEVSEA  380

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QLQ N+DY C  Q IDC PIQPGGAC+EPNT+
Sbjct  381  QLQTNVDYICGSQVIDCGPIQPGGACYEPNTV  412



>ref|XP_009138298.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Brassica rapa]
 ref|XP_009138299.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X3 
[Brassica rapa]
Length=505

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 165/211 (78%), Gaps = 6/211 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D  + ITYMNMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  207  QSDPRPETLAFCLFQPNAGRPDHNTGITYMNMFDAQVDAVHSALKSMGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD NEVGPSVDNAKAY GNL++HLRSMVGTPLMPGKSVDTY+FALYDE+LK GP+S
Sbjct  267  WASRGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKSVDTYIFALYDENLKSGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGL+ TD +M YD GL+KSS  + +   S    G     K S+ WCV K   +D QL
Sbjct  327  ERAFGLFKTDHSMAYDVGLAKSSGSSTSNSSSQTPSG-----KASTGWCVSKKDATDEQL  381

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q+++D+AC  QGIDC  IQPGGACFEPN +A
Sbjct  382  QSSIDWACG-QGIDCGAIQPGGACFEPNNVA  411



>gb|EAY91326.1| hypothetical protein OsI_12942 [Oryza sativa Indica Group]
Length=464

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 158/210 (75%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR DAGSKI Y NMFDAQ+ AV++AL   G+  VEI VAETG
Sbjct  211  QSDPRPETLAFCLFQPNAGRVDAGSKIKYTNMFDAQVDAVKSALGRAGYGDVEIVVAETG  270

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+ E G + DNA+AYV NLVSHLRS  GTPLMPGK VDTYLFALYDEDLKPGPTS
Sbjct  271  WPTRGDAGEPGATADNARAYVSNLVSHLRSGAGTPLMPGKPVDTYLFALYDEDLKPGPTS  330

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDLTM YDAGL+ SS    +      +   P  +     WCV   G ++A L
Sbjct  331  ERSFGLYHTDLTMAYDAGLTSSSGGAASPSNGGASQQQP--RGGGGGWCVASAGATEADL  388

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYACA  G+DC  IQ GGACFEPNT+
Sbjct  389  QADLDYACAQVGVDCGAIQAGGACFEPNTV  418



>gb|EMS60868.1| Glucan endo-1,3-beta-glucosidase 7 [Triticum urartu]
Length=351

 Score =   277 bits (709),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLF+PN GR DAGSKITY NMFDAQ+ AV++AL   G+  V+I VAETG
Sbjct  48   QSDPRPDTLAFCLFRPNAGRLDAGSKITYTNMFDAQVDAVKSALGRAGYGAVDIVVAETG  107

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD  E G +VDNA+AYV NLV+HLRS  GTPLMPG+ VDTYLFALYDEDLKPGP S
Sbjct  108  WPTKGDPTEQGATVDNARAYVSNLVAHLRSGAGTPLMPGRPVDTYLFALYDEDLKPGPAS  167

Query  362  ERSFGLYNTDLTMTYDAGL-sksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQ  538
            ER+FGLY+TDLTM YDAGL S SS     +  + P    P   K S  WCV   G +DAQ
Sbjct  168  ERAFGLYHTDLTMAYDAGLTSSSSGGGGGSTATTPTPTTPTPSKGSGGWCVASAGATDAQ  227

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            LQ +LDYAC+  G+DC  IQPGGACF+PNT+
Sbjct  228  LQTDLDYACSQVGVDCGAIQPGGACFQPNTV  258



>ref|XP_010690895.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   281 bits (720),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 172/240 (72%), Gaps = 30/240 (13%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D+GS I Y NMFDAQ+ A+ +AL AMG+K  EI VAETG
Sbjct  213  QSDPRPDTLAFCLFQPNAGRVDSGSNIKYTNMFDAQVDAIHSALKAMGYKDTEIVVAETG  272

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY G L+SHLRSM GTPLMPGKSVDTY+FALYDEDLKPG  S
Sbjct  273  WPYHGDSNEVGPSIENAKAYNGGLISHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGAAS  332

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtp------------------------ttpksAPAI  469
            ER FGLY  DL+MTYD  LSKSS+Q+P                        +   SAP +
Sbjct  333  ERYFGLYKPDLSMTYDLDLSKSSSQSPTTTPSTSPAPSTTPSAPSTTPLAPSRTPSAPVM  392

Query  470  GP-----PASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             P     P+ K +S  WCVPK GVSDAQL+ANLDYAC   G+DCS +Q GG C +P+T+A
Sbjct  393  TPTAPVTPSPKSSSGTWCVPKKGVSDAQLKANLDYACG-HGVDCSKLQAGGPCHDPDTVA  451



>ref|XP_006409465.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
 gb|ESQ50918.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
Length=526

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 164/211 (78%), Gaps = 9/211 (4%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SDPRPETL+FCLFQPN GR D+ + I YMNMFDAQ+ AV +AL +MGF+ VE+ VAETGW
Sbjct  223  SDPRPETLSFCLFQPNPGRVDSNTGIKYMNMFDAQVDAVHSALKSMGFEKVEVVVAETGW  282

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P  GD NEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKSVDTY FAL+DE+LKPGP+ E
Sbjct  283  PTSGDINEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYTFALFDENLKPGPSFE  342

Query  365  RSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSW-WCVPKGGVSDAQL  541
            RSFGL+  DL+M YD GL+K+++   +         PP  K+ +S  WCVPK   ++ QL
Sbjct  343  RSFGLFKPDLSMAYDIGLTKTTSSQASQ-------SPPLGKETTSTGWCVPKEDATEEQL  395

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QA+LD+ C  QGIDC PI PGGACFEPN IA
Sbjct  396  QASLDWVCG-QGIDCRPIMPGGACFEPNNIA  425



>ref|XP_006299612.1| hypothetical protein CARUB_v10015799mg [Capsella rubella]
 gb|EOA32510.1| hypothetical protein CARUB_v10015799mg [Capsella rubella]
Length=499

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+ + I YMNMFDAQ+ AV +AL +MGF+ VE+ VAETG
Sbjct  202  QSDPRAETLAFCLFQPNAGRVDSNTGIKYMNMFDAQVDAVHSALKSMGFEKVEVVVAETG  261

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GDSNEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKS+DTY+FAL+DE+LKPGP+ 
Sbjct  262  WPSTGDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSF  321

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+M YD GL+K+++   +         PP  +  S  WCVPK   ++ QL
Sbjct  322  ERSFGLFKPDLSMAYDIGLTKTTSSQTSQ-------SPPLGEATSMGWCVPKEDATEEQL  374

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q +LD+ C  QGIDC PI PGG CFEPN + 
Sbjct  375  QESLDWVCG-QGIDCGPIMPGGVCFEPNNLV  404



>ref|XP_002886212.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62471.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 160/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+ + I YMNMFDAQ+ AV +AL +MGF+ VE+ VAETG
Sbjct  206  QSDPRPETLAFCLFQPNPGRVDSNTGIKYMNMFDAQVDAVHSALKSMGFEKVEVLVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD+NEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKS+DTY+FAL+DE+LKPGP+ 
Sbjct  266  WPSTGDNNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSF  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+M YD GL   +  T +    +P +G    K  S  WCVPK   +  QL
Sbjct  326  ERSFGLFKPDLSMAYDIGL---TKTTSSQTSQSPQLG----KATSMGWCVPKEDATQEQL  378

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q +LD+ C  QGIDC PI PGG CFEPN + 
Sbjct  379  QDSLDWVCG-QGIDCGPIMPGGVCFEPNNLV  408



>ref|XP_010423738.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=523

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 161/210 (77%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+ + I YMNMFDAQ+ AV +AL +MGF+ VE+ VAETG
Sbjct  206  QSDPRPETLAFCLFQPNAGRVDSNTGIKYMNMFDAQVDAVHSALKSMGFEKVEVVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GDSNEVGPSV+ AKAY GNL++HLRSMVGTPLMPGKS+DTY+FAL+DE+LKPGP+ 
Sbjct  266  WPSTGDSNEVGPSVEKAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSF  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+M YD GL+K+++   +         PP  +  S  WCVPK   ++ QL
Sbjct  326  ERSFGLFKPDLSMAYDIGLTKTTSSQTSQ-------SPPLGEATSMGWCVPKDDATEEQL  378

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            Q +LD+ C  QGIDC PI PGG CFEPN +
Sbjct  379  QDSLDWVCG-QGIDCGPITPGGVCFEPNNL  407



>ref|XP_010467346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Camelina sativa]
Length=503

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 161/210 (77%), Gaps = 8/210 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ +E+ VAETG
Sbjct  206  QSDPRPETLAFCLFQPNAGRVDSNTGIKYTNMFDAQVDAVHSALKSMGFEKLEVVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GDSNEVGPSV+NAKAY GNLV+HLRSMVGTPLMPGKS+DTY+FAL+DE+LKPGP+ 
Sbjct  266  WPSTGDSNEVGPSVENAKAYNGNLVAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSF  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  DL+M YD GL+K+++   +         PP  +  S  WCVPK   ++ QL
Sbjct  326  ERSFGLFKPDLSMAYDIGLTKTTSSQTSQ-------SPPLGEATSMGWCVPKDDATEEQL  378

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            Q +LD+ C  QGIDC PI PGG CFEPN +
Sbjct  379  QDSLDWVCG-QGIDCGPIMPGGLCFEPNNL  407



>ref|XP_003561438.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Brachypodium 
distachyon]
Length=463

 Score =   278 bits (711),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 156/210 (74%), Gaps = 5/210 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D GSKI Y NMFDAQ+ AV++AL   G+  VEI VAETG
Sbjct  213  QSDPRPDTLAFCLFQPNAGRVDGGSKIKYTNMFDAQVDAVKSALGRAGYGAVEIVVAETG  272

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD  E G SVDNAKAYV NLV+HLRS  GTPLMPGK+VDTYLFALYDEDLKPGP S
Sbjct  273  WPTKGDPTEAGASVDNAKAYVANLVAHLRSGAGTPLMPGKAVDTYLFALYDEDLKPGPAS  332

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDL+M YDAGL+ S+           A+ P         WCV     +DAQL
Sbjct  333  ERSFGLYHTDLSMAYDAGLAASAASGSNGNGQGAAVQP-----TKGGWCVASVAATDAQL  387

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            Q ++DYACA  G+DC  IQPGGACFEPNT+
Sbjct  388  QTDMDYACAQVGVDCGAIQPGGACFEPNTV  417



>gb|AAD22313.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=456

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+ + I YMNMFDAQ+ AV +AL ++GF+ VE+ VAETG
Sbjct  206  QSDPRPETLAFCLFQPNPGRVDSNTGIKYMNMFDAQVDAVHSALKSIGFEKVEVLVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GDSNEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKS+DTY+FAL+DE+LKPGP+ 
Sbjct  266  WPSTGDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSF  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            E+SFGL+  DL+M YD GL   +  T +    +P +G    K  S  WCVPK   +  QL
Sbjct  326  EQSFGLFKPDLSMAYDIGL---TKTTSSQTSQSPQLG----KVTSMGWCVPKEDATQEQL  378

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q +LD+ C  QGIDC PI PGG CFEPN +A
Sbjct  379  QDSLDWVCG-QGIDCGPIMPGGVCFEPNNVA  408



>ref|XP_010690894.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 172/240 (72%), Gaps = 30/240 (13%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D+GS I Y NMFDAQ+ A+ +AL AMG+K  EI VAETG
Sbjct  213  QSDPRPDTLAFCLFQPNAGRVDSGSNIKYTNMFDAQVDAIHSALKAMGYKDTEIVVAETG  272

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY G L+SHLRSM GTPLMPGKSVDTY+FALYDEDLKPG  S
Sbjct  273  WPYHGDSNEVGPSIENAKAYNGGLISHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGAAS  332

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtp------------------------ttpksAPAI  469
            ER FGLY  DL+MTYD  LSKSS+Q+P                        +   SAP +
Sbjct  333  ERYFGLYKPDLSMTYDLDLSKSSSQSPTTTPSTSPAPSTTPSAPSTTPLAPSRTPSAPVM  392

Query  470  GP-----PASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             P     P+ K +S  WCVPK GVSDAQL+ANLDYAC   G+DCS +Q GG C +P+T+A
Sbjct  393  TPTAPVTPSPKSSSGTWCVPKKGVSDAQLKANLDYACG-HGVDCSKLQAGGPCHDPDTVA  451



>dbj|BAJ87172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 161/210 (77%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR DAGS+I Y NMFDAQ+ AV++AL   G+  V+I VAETG
Sbjct  210  QSDPRPDTLAFCLFQPNAGRVDAGSRIRYANMFDAQVDAVKSALGRAGYGAVDIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD  E G +VDNA+AYV NLV+HL S  GTPLMPG+ VDTYLFALYDEDLKPGP S
Sbjct  270  WPTKGDPAEAGATVDNARAYVSNLVAHLGSGAGTPLMPGRPVDTYLFALYDEDLKPGPAS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY+TDLTM YDAGL+ S +   TTP +        SK + S WCV   G ++AQL
Sbjct  330  ERAFGLYHTDLTMAYDAGLTSSGSGAATTPTTPTT----PSKGSGSGWCVASAGATEAQL  385

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            Q ++DYAC+  G+DC  IQPGGACFEPNT+
Sbjct  386  QTDMDYACSQVGVDCGAIQPGGACFEPNTV  415



>ref|NP_179219.4| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEC06477.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=503

 Score =   277 bits (708),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 161/211 (76%), Gaps = 8/211 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+ + I YMNMFDAQ+ AV +AL ++GF+ VE+ VAETG
Sbjct  206  QSDPRPETLAFCLFQPNPGRVDSNTGIKYMNMFDAQVDAVHSALKSIGFEKVEVLVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GDSNEVGPSV+NAKAY GNL++HLRSMVGTPLMPGKS+DTY+FAL+DE+LKPGP+ 
Sbjct  266  WPSTGDSNEVGPSVENAKAYNGNLIAHLRSMVGTPLMPGKSIDTYIFALFDENLKPGPSF  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            E+SFGL+  DL+M YD GL   +  T +    +P +G    K  S  WCVPK   +  QL
Sbjct  326  EQSFGLFKPDLSMAYDIGL---TKTTSSQTSQSPQLG----KVTSMGWCVPKEDATQEQL  378

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            Q +LD+ C  QGIDC PI PGG CFEPN +A
Sbjct  379  QDSLDWVCG-QGIDCGPIMPGGVCFEPNNVA  408



>gb|EMT27870.1| Glucan endo-1,3-beta-glucosidase 7 [Aegilops tauschii]
Length=339

 Score =   271 bits (694),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLF PN GR DAGSKITY NMFDAQ+ AV++AL   G+  V+I VAETG
Sbjct  78   QSDPRPDTLAFCLFHPNAGRLDAGSKITYTNMFDAQVDAVKSALGRAGYGAVDIVVAETG  137

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD  E G +VDNA+AYV NLV+HLRS  GTPLMPGK VDTYLFALYDEDLKPGP S
Sbjct  138  WPTRGDPTEQGATVDNARAYVSNLVAHLRSGAGTPLMPGKPVDTYLFALYDEDLKPGPAS  197

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER+FGLY+TDLTM YDAGL+ SS  +     +        +    S WCV   G +DAQL
Sbjct  198  ERAFGLYHTDLTMAYDAGLTSSSPGSGGGSTATTPT---TTPSKGSGWCVASAGATDAQL  254

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            Q +LDYAC+  G+DC  IQPGGACF+PNT+
Sbjct  255  QTDLDYACSQVGVDCGAIQPGGACFQPNTV  284



>ref|XP_004982218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Setaria italica]
Length=469

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 160/210 (76%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR DAGSKI Y NMFDAQL AV++A+   G+  V+I VAETG
Sbjct  219  QSDPRAETLAFCLFQPNAGRVDAGSKIKYTNMFDAQLDAVKSAMVRAGYGNVDIVVAETG  278

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD+ E G +V+NA+AYV NLVSHLRS  GTPL+PGK V+TYLFALYDEDLKPGP S
Sbjct  279  WPTKGDAGEPGATVENARAYVSNLVSHLRSGAGTPLVPGKPVETYLFALYDEDLKPGPES  338

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDL+  YDAGL+ S     +      A G PA  K S  WCV + G +DA L
Sbjct  339  ERSFGLYHTDLSAAYDAGLTSSGAAAGSPS----AGGGPA--KASGGWCVARDGATDADL  392

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYACA  G+DC  IQPGGACFEPNT+
Sbjct  393  QADLDYACAQVGVDCGAIQPGGACFEPNTV  422



>ref|XP_004982217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Setaria italica]
Length=483

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 160/210 (76%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR DAGSKI Y NMFDAQL AV++A+   G+  V+I VAETG
Sbjct  219  QSDPRAETLAFCLFQPNAGRVDAGSKIKYTNMFDAQLDAVKSAMVRAGYGNVDIVVAETG  278

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD+ E G +V+NA+AYV NLVSHLRS  GTPL+PGK V+TYLFALYDEDLKPGP S
Sbjct  279  WPTKGDAGEPGATVENARAYVSNLVSHLRSGAGTPLVPGKPVETYLFALYDEDLKPGPES  338

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDL+  YDAGL+ S     +      A G PA  K S  WCV + G +DA L
Sbjct  339  ERSFGLYHTDLSAAYDAGLTSSGAAAGSPS----AGGGPA--KASGGWCVARDGATDADL  392

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYACA  G+DC  IQPGGACFEPNT+
Sbjct  393  QADLDYACAQVGVDCGAIQPGGACFEPNTV  422



>ref|NP_001141090.1| uncharacterized protein LOC100273173 [Zea mays]
 gb|ACF85381.1| unknown [Zea mays]
 gb|AFW68016.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=324

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D GSKI Y NMFDAQL AV++AL   G+  V++ VAETG
Sbjct  73   QSDPRPDTLAFCLFQPNAGRVDGGSKIRYTNMFDAQLDAVKSALVRAGYGDVDVVVAETG  132

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+ E G + +NA+AYV NLV+HLRS  GTPLMPGK+V+TYLFALYDEDLKPGPTS
Sbjct  133  WPTRGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFALYDEDLKPGPTS  192

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDL+M YDAGL+ S+                A++     WCV + G SDA+L
Sbjct  193  ERSFGLYHTDLSMAYDAGLASSAAAGGRGGGGG-----GAAQPRGGGWCVARAGASDAEL  247

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYAC+  G+DCS IQPGGACFEPNT+
Sbjct  248  QADLDYACSQVGVDCSAIQPGGACFEPNTV  277



>ref|XP_008681421.1| PREDICTED: uncharacterized protein LOC100273173 isoform X1 [Zea 
mays]
Length=465

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D GSKI Y NMFDAQL AV++AL   G+  V++ VAETG
Sbjct  212  QSDPRPDTLAFCLFQPNAGRVDGGSKIRYTNMFDAQLDAVKSALVRAGYGDVDVVVAETG  271

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+ E G + +NA+AYV NLV+HLRS  GTPLMPGK+V+TYLFALYDEDLKPGPTS
Sbjct  272  WPTRGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFALYDEDLKPGPTS  331

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDL+M YDAGL+ S+                A++     WCV + G SDA+L
Sbjct  332  ERSFGLYHTDLSMAYDAGLASSAAAGGRGGGGG-----GAAQPRGGGWCVARAGASDAEL  386

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYAC+  G+DCS IQPGGACFEPNT+
Sbjct  387  QADLDYACSQVGVDCSAIQPGGACFEPNTV  416



>ref|XP_008681422.1| PREDICTED: uncharacterized protein LOC100273173 isoform X2 [Zea 
mays]
Length=463

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D GSKI Y NMFDAQL AV++AL   G+  V++ VAETG
Sbjct  212  QSDPRPDTLAFCLFQPNAGRVDGGSKIRYTNMFDAQLDAVKSALVRAGYGDVDVVVAETG  271

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP +GD+ E G + +NA+AYV NLV+HLRS  GTPLMPGK+V+TYLFALYDEDLKPGPTS
Sbjct  272  WPTRGDAGEPGATAENARAYVSNLVAHLRSGAGTPLMPGKAVETYLFALYDEDLKPGPTS  331

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY+TDL+M YDAGL+ S+                A++     WCV + G SDA+L
Sbjct  332  ERSFGLYHTDLSMAYDAGLASSAAAGGRGGGGG-----GAAQPRGGGWCVARAGASDAEL  386

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA+LDYAC+  G+DCS IQPGGACFEPNT+
Sbjct  387  QADLDYACSQVGVDCSAIQPGGACFEPNTV  416



>ref|XP_009138297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Brassica rapa]
Length=528

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 165/234 (71%), Gaps = 29/234 (12%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET-  178
            QSDPRPETLAFCLFQPN GR D  + ITYMNMFDAQ+ AV +AL +MGF+ VEI VAET 
Sbjct  207  QSDPRPETLAFCLFQPNAGRPDHNTGITYMNMFDAQVDAVHSALKSMGFEKVEIVVAETV  266

Query  179  ----------------------GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLM  292
                                  GW  +GD NEVGPSVDNAKAY GNL++HLRSMVGTPLM
Sbjct  267  DAVHSALKSMGFEKVEIVVAETGWASRGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLM  326

Query  293  PGKSVDTYLFALYDEDLKPGPTSERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIG  472
            PGKSVDTY+FALYDE+LK GP+SER+FGL+ TD +M YD GL+KSS  + +   S    G
Sbjct  327  PGKSVDTYIFALYDENLKSGPSSERAFGLFKTDHSMAYDVGLAKSSGSSTSNSSSQTPSG  386

Query  473  PPASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
                 K S+ WCV K   +D QLQ+++D+AC  QGIDC  IQPGGACFEPN +A
Sbjct  387  -----KASTGWCVSKKDATDEQLQSSIDWACG-QGIDCGAIQPGGACFEPNNVA  434



>sp|Q94G86.1|ALL9_OLEEU RecName: Full=Glucan endo-1,3-beta-D-glucosidase; AltName: Full=Major 
pollen allergen Ole e 9; AltName: Allergen=Ole e 9; 
Flags: Precursor [Olea europaea]
 gb|AAK58515.1|AF249675_1 beta-1,3-glucanase-like protein [Olea europaea]
Length=460

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 158/210 (75%), Gaps = 7/210 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            ++ P P+TLAFCLFQPN G+ D+G+   Y NMFDAQ+ AV +ALNAMGFK +EI VAETG
Sbjct  211  KNQPTPDTLAFCLFQPNAGQVDSGNGHKYTNMFDAQVDAVHSALNAMGFKDIEIVVAETG  270

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+ GDSNEVGPS+DNAKAYVGNL++HL+S VGTPLMPGKS+DTYLF+LYDED K G +S
Sbjct  271  WPHGGDSNEVGPSLDNAKAYVGNLINHLKSKVGTPLMPGKSIDTYLFSLYDEDKKTGASS  330

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            E+ FGL+  D + TYD GL K++    T     P      S      WCVPK GVSD QL
Sbjct  331  EKYFGLFKPDGSTTYDVGLLKNTQNPTTPATPTPTPKAAGS------WCVPKPGVSDDQL  384

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
              N++YAC  QGIDC PIQPGGACFEPNT+
Sbjct  385  TGNINYACG-QGIDCGPIQPGGACFEPNTV  413



>emb|CDO97058.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 155/199 (78%), Gaps = 7/199 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPR ETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AV +ALNA+GFK VEI VAETG
Sbjct  216  QSDPRAETLAFCLFQPNAGRVDSGTSIKYMNMFDAQVDAVHSALNALGFKDVEIVVAETG  275

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD  EVGPS+DNAKA+ GNL+SHLRS+VGTPLMPGKSVDTY+FAL+DEDLKPGP+S
Sbjct  276  WPYKGDPTEVGPSLDNAKAFNGNLISHLRSLVGTPLMPGKSVDTYIFALFDEDLKPGPSS  335

Query  362  ERSFGLYNTDLTMTYDAGLsksst------qtpttpksAPAIGPPASKKNSSWWCVPKGG  523
            ERSFGL+  DL++TYD  LSK+S              + P        K ++ WCVPK G
Sbjct  336  ERSFGLFKPDLSVTYDVDLSKNSQTPATPATPAPVSPTTPITPITPVPKPAAGWCVPKPG  395

Query  524  VSDAQLQANLDYACALQGI  580
            VSDAQLQ+NLDYAC  QGI
Sbjct  396  VSDAQLQSNLDYACG-QGI  413



>emb|CDX72483.1| BnaC07g45050D [Brassica napus]
Length=885

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 166/227 (73%), Gaps = 23/227 (10%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQ----------------LGAVRTAL  133
            QSDPRPETLAFCLFQPN GR D+ + ITYMNMFDAQ                + AV +AL
Sbjct  207  QSDPRPETLAFCLFQPNAGRPDSNTGITYMNMFDAQYKRQLFTLDTAPYMRAVDAVHSAL  266

Query  134  NAMGFKGVEIAVAETGWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDT  313
             +MGF+ VEI VAETGW  +GD NEVGPSVDNAKAY GNL++HLRSMVGTPLMPGKSVDT
Sbjct  267  KSMGFEKVEIVVAETGWASRGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKSVDT  326

Query  314  YLFALYDEDLKPGPTSERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKN  493
            Y+FALYDE+LK GP+SER+FGL+ TD +M YD GL+KSS  +  +    P      S K 
Sbjct  327  YIFALYDENLKTGPSSERAFGLFKTDHSMAYDVGLAKSSGSSSNSSCQTP------SGKA  380

Query  494  SSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            S+ WCV K   +D QLQ+++D+AC  QGIDC  IQPGGACFEPN +A
Sbjct  381  STGWCVSKKDATDKQLQSSIDWACG-QGIDCGAIQPGGACFEPNNVA  426



>ref|XP_009758633.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Nicotiana sylvestris]
Length=437

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 159/208 (76%), Gaps = 20/208 (10%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR+DAG+ I Y +MFDAQ+ AVR+ALNA+GFK VEI +AETG
Sbjct  209  QSDPRPDTLAFCLFQPNSGRFDAGTNIKYTSMFDAQVDAVRSALNALGFKEVEIVIAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL+SHLRSMVGTPLMPG SVDTYLFALYDE+LKPGPTS
Sbjct  269  WPYKGDSNEVGPSIENAKAYNGNLISHLRSMVGTPLMPGISVDTYLFALYDENLKPGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqt-pttpksAPAI----GPPASKKNSSWWCVP----  514
            ERSFGL+  DLTMTYDAGLSK+++Q         P++     PP+S +  +   +P    
Sbjct  329  ERSFGLFKPDLTMTYDAGLSKANSQDPMPKTPVTPSLPKTSMPPSSPETPATSSLPKTPV  388

Query  515  -----------KGGVSDAQLQANLDYAC  565
                       K  VSDAQLQ+N+DYA 
Sbjct  389  PSSSPKTKSVSKADVSDAQLQSNIDYAV  416



>ref|XP_009123249.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
 emb|CDY37244.1| BnaA09g08650D [Brassica napus]
Length=512

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 158/209 (76%), Gaps = 7/209 (3%)
 Frame = +2

Query  8    DPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWP  187
            D RPETL+FCLFQPN GR D+ + I YMNMFDAQ+ AV +AL +MGF+ VE+ VAETGWP
Sbjct  209  DQRPETLSFCLFQPNPGRVDSNTGIKYMNMFDAQVDAVHSALKSMGFENVEVVVAETGWP  268

Query  188  YKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSER  367
              GDSN VGPSV+NA+ Y GNL++HLRSMVGTPL PGK +DTY+FAL+DE+LKPGP+ ER
Sbjct  269  TSGDSNVVGPSVENAQTYNGNLIAHLRSMVGTPLRPGKPIDTYIFALFDENLKPGPSFER  328

Query  368  SFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSW-WCVPKGGVSDAQLQ  544
            SFGL+  DLTM YD GL+K+S+    T     +  PP  K  +S  WCVPK   ++ QLQ
Sbjct  329  SFGLFKRDLTMAYDIGLTKTSSSGSQT-----SQSPPLGKSATSVGWCVPKEDATEEQLQ  383

Query  545  ANLDYACALQGIDCSPIQPGGACFEPNTI  631
            A+LD+ C  QGIDC PI PGG CFEPN +
Sbjct  384  ASLDWVCG-QGIDCGPITPGGVCFEPNNV  411



>ref|XP_009804917.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Nicotiana 
sylvestris]
Length=451

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 150/207 (72%), Gaps = 14/207 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+GS I YMNMFDAQ+ A+ +ALNA GFK V+I VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGSGIKYMNMFDAQVDAIHSALNAWGFKEVQIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSVDNAKAY GNL++HLRSMVGTPLMPG SVDTY+FALYDEDLKPGP S
Sbjct  270  WPYKGDPNEVGPSVDNAKAYNGNLINHLRSMVGTPLMPGISVDTYIFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNS--------------S  499
            ERSFGL+  DL++TYD GLSK++                     +              +
Sbjct  330  ERSFGLFKPDLSVTYDVGLSKNAQTPTAPVTPVSPAPATTPTTPTTPVTPVTPTPKPTGA  389

Query  500  WWCVPKGGVSDAQLQANLDYACALQGI  580
             WC+PK G  DA+LQANLDYAC+  GI
Sbjct  390  AWCMPKPGTPDAELQANLDYACSQAGI  416



>emb|CDY45313.1| BnaA03g52860D [Brassica napus]
Length=892

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 165/228 (72%), Gaps = 23/228 (10%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQ-----------------LGAVRTA  130
            QSDPRPETLAFCLFQPN GR D  + ITYMNMFDAQ                 + AV +A
Sbjct  207  QSDPRPETLAFCLFQPNAGRPDHNTGITYMNMFDAQYKRQLFTLDDAAAYIRAVDAVHSA  266

Query  131  LNAMGFKGVEIAVAETGWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVD  310
            L +MGF+ VEI VAETGW  +GD NEVGPSVDNAKAY GNL++HLRSMVGTPLMPGK VD
Sbjct  267  LKSMGFEKVEIVVAETGWASRGDPNEVGPSVDNAKAYNGNLIAHLRSMVGTPLMPGKPVD  326

Query  311  TYLFALYDEDLKPGPTSERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKK  490
            TY+FALYDE+LK GP+SER+FGL+ TD +M YD GL+KSS  + +   S    G     K
Sbjct  327  TYIFALYDENLKSGPSSERAFGLFKTDHSMAYDVGLAKSSGSSSSNSSSQTPSG-----K  381

Query  491  NSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             S+ WCV K   +D QLQ+++D+AC  QGIDC PIQPGGACFEPN +A
Sbjct  382  ASTGWCVSKKDATDEQLQSSIDWACG-QGIDCGPIQPGGACFEPNNVA  428



>ref|XP_009605960.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 150/207 (72%), Gaps = 14/207 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AV +ALNA GFK V+I VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDAVHSALNAWGFKEVQIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPSVDNAKAY GNL++HLRSMVGTP+MPG SVDTY+FALYDEDLKPGP S
Sbjct  270  WPYKGDPNEVGPSVDNAKAYNGNLINHLRSMVGTPVMPGISVDTYIFALYDEDLKPGPGS  329

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNS--------------S  499
            ERSFGL+  DL++TYD GLSK++                     +              S
Sbjct  330  ERSFGLFKPDLSVTYDVGLSKNAQTPTAPVTPVSPAPATTPTTPTTPVTPVTPTPKPTGS  389

Query  500  WWCVPKGGVSDAQLQANLDYACALQGI  580
             WC+PK G  DA+LQANLDYAC+  GI
Sbjct  390  AWCMPKPGTPDAELQANLDYACSQAGI  416



>ref|XP_006856026.1| hypothetical protein AMTR_s00059p00061500 [Amborella trichopoda]
 gb|ERN17493.1| hypothetical protein AMTR_s00059p00061500 [Amborella trichopoda]
Length=457

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 154/210 (73%), Gaps = 6/210 (3%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQ N GR+D  +KITY NMFDAQ+ A+ +AL A GF  +E+  AETG
Sbjct  208  QSDPRPETLAFCLFQQNAGRFDPATKITYYNMFDAQMDAIYSALAAQGFGDMEVVNAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W Y+GD NEVG +++NAKAY GNL+ HLRS VGTPL P  S DTY+FAL+DEDLK GP+S
Sbjct  268  WAYEGDPNEVGANLENAKAYNGNLIKHLRSRVGTPLRPNTSPDTYIFALFDEDLKGGPSS  327

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER FGLY  DL+MTYD GL K +   P+   +       A       WC+PK GVS++ L
Sbjct  328  ERHFGLYKPDLSMTYDIGLEKGTQVNPSPSVNPSPSAGKAGT-----WCMPKAGVSESDL  382

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QANLDYAC  QGIDCS +QPGGACF PNT+
Sbjct  383  QANLDYACG-QGIDCSALQPGGACFLPNTV  411



>emb|CDY26761.1| BnaC09g08880D [Brassica napus]
Length=512

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 157/209 (75%), Gaps = 7/209 (3%)
 Frame = +2

Query  8    DPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWP  187
            D RPETL+FCLFQPN GR D+ + I YMNMFDAQ+ AV +AL +MGF+ VE+ VAETGWP
Sbjct  209  DQRPETLSFCLFQPNPGRVDSNTGIKYMNMFDAQVDAVHSALKSMGFENVEVVVAETGWP  268

Query  188  YKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSER  367
              GDSN VGPSV+NA+ Y GNL++HLRSMVGTPL PGK +DTY+FAL+DE+LKPGP+ ER
Sbjct  269  TSGDSNVVGPSVENAQTYNGNLIAHLRSMVGTPLRPGKPIDTYIFALFDENLKPGPSFER  328

Query  368  SFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSW-WCVPKGGVSDAQLQ  544
            SFGL+  DLTM YD GL+K+S+    T     +  PP  K  +S  WCVP    ++ QLQ
Sbjct  329  SFGLFKPDLTMAYDIGLTKTSSSGSQT-----SQSPPLGKSATSVGWCVPMEDATEEQLQ  383

Query  545  ANLDYACALQGIDCSPIQPGGACFEPNTI  631
            A+LD+ C  QGIDC PI PGG CFEPN +
Sbjct  384  ASLDWVCG-QGIDCGPITPGGVCFEPNNV  411



>ref|XP_006341928.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Solanum tuberosum]
Length=441

 Score =   254 bits (650),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR DAG+KI Y NMFDAQ+ A+R ALNAMGFK VEI +AETG
Sbjct  210  QSDPRPDTLAFCLFQPNAGRVDAGTKIKYTNMFDAQVDAIRAALNAMGFKEVEIVIAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFA+YDEDLKPGPTS
Sbjct  270  WPYKGDSNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFAMYDEDLKPGPTS  329

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+  DLTM+YD GL
Sbjct  330  ERSFGLFKPDLTMSYDVGL  348



>ref|XP_004238250.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Solanum lycopersicum]
Length=471

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR DAG+KI Y NMFDAQ+ A+R ALNAMGFK VEI +AETG
Sbjct  240  QSDPRPDTLAFCLFQPNAGRVDAGTKIKYTNMFDAQVDAIRAALNAMGFKEVEIVIAETG  299

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFA+YDEDLKPGPTS
Sbjct  300  WPYKGDSNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFAIYDEDLKPGPTS  359

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+  DLTM+YD GL
Sbjct  360  ERSFGLFKPDLTMSYDIGL  378



>ref|XP_009758632.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Nicotiana sylvestris]
Length=462

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 160/233 (69%), Gaps = 45/233 (19%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR+DAG+ I Y +MFDAQ+ AVR+ALNA+GFK VEI +AETG
Sbjct  209  QSDPRPDTLAFCLFQPNSGRFDAGTNIKYTSMFDAQVDAVRSALNALGFKEVEIVIAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS++NAKAY GNL+SHLRSMVGTPLMPG SVDTYLFALYDE+LKPGPTS
Sbjct  269  WPYKGDSNEVGPSIENAKAYNGNLISHLRSMVGTPLMPGISVDTYLFALYDENLKPGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstq-----------------tpttpksAPAIG------  472
            ERSFGL+  DLTMTYDAGLSK+++Q                 +       P++       
Sbjct  329  ERSFGLFKPDLTMTYDAGLSKANSQDPMPKTPVTPSNTSMPPSSPKTPVTPSLPETPVTP  388

Query  473  -------PPASKKNSSWWCVP---------------KGGVSDAQLQANLDYAC  565
                   PP+S +  +   +P               K  VSDAQLQ+N+DYA 
Sbjct  389  SLPKTSMPPSSPETPATSSLPKTPVPSSSPKTKSVSKADVSDAQLQSNIDYAV  441



>ref|XP_006372050.1| hypothetical protein POPTR_0018s08730g [Populus trichocarpa]
 gb|ERP49847.1| hypothetical protein POPTR_0018s08730g [Populus trichocarpa]
Length=256

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  87   RSDPRPETLAFCLFQPNAGRMDGNTKIKYMNMFDAQVDAVFSALNSMGFKNVEIMVAETG  146

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPS++NAKAY GNL++HLRS+VGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  147  WPYKGDDNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGKSVDTYLFALYDEDLKPGPGS  206

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLTM YD GL
Sbjct  207  ERSFGLFKTDLTMVYDVGL  225



>ref|XP_002313051.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE87006.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=372

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ + YMNMFDAQ+ AVR+ALNAMGF  +EI VAETG
Sbjct  204  QSDPRPETLAFCLFQPNSGRVDSGNGMKYMNMFDAQVDAVRSALNAMGFNDIEILVAETG  263

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPSV+NA+AY GNL+S LRSMVGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  264  WPYKGDSNEVGPSVENARAYNGNLISRLRSMVGTPLMPGKSVDTYIFALYDEDLKPGPAS  323

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+  DL+MTYD GL
Sbjct  324  ERSFGLFKPDLSMTYDIGL  342



>ref|XP_002306099.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
 gb|EEE86610.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
Length=373

 Score =   244 bits (624),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AVR+ALNAMGF  VEI VAETG
Sbjct  205  QSDPRPETLAFCLFQPNSGRVDSGNGIKYMNMFDAQVDAVRSALNAMGFIDVEIVVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGP ++NA+AY GNLV+HLRSMVGTPLMPGKSVDTY+FALYDEDLK GP S
Sbjct  265  WPYKGDSNEVGPGIENARAYNGNLVAHLRSMVGTPLMPGKSVDTYIFALYDEDLKSGPAS  324

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+  DL+MTYD GL
Sbjct  325  ERSFGLFKPDLSMTYDIGL  343



>ref|XP_009411141.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like, partial [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 152/212 (72%), Gaps = 11/212 (5%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR DAGSK+TY NMFDAQ+ AVR+AL+A+GF  VEI VAETG
Sbjct  190  RSDPRPETLAFCLFQPNSGRLDAGSKLTYTNMFDAQVDAVRSALDALGFPEVEIVVAETG  249

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD +EVG SVDNAKA+ GNLV+HLRS+VGTPLMPG+SVDTY+FALYDEDLKPGP S
Sbjct  250  WPYQGDPDEVGASVDNAKAFNGNLVAHLRSLVGTPLMPGRSVDTYIFALYDEDLKPGPAS  309

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY  D TM YDAGL        +T  S+P   P ++  ++     P  GV+    
Sbjct  310  ERSFGLYRADQTMNYDAGL------AKSTSSSSPITAPASTSTDAG---PPPAGVTGLTQ  360

Query  542  QAN-LDYACALQG-IDCSPIQPGGACFEPNTI  631
             A   +    LQG  D  P Q G  C+ PN +
Sbjct  361  PAGWCESGATLQGSADGRPTQAGAQCYIPNAV  392



>ref|XP_006434974.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
 gb|ESR48214.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
Length=436

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 149/211 (71%), Gaps = 14/211 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
             SDPRP  LA+CLFQ N GR D  + I YMNMFDAQ+ A R+ALN++G+  VEI V ETG
Sbjct  184  NSDPRPGYLAYCLFQVNAGRVDPNNNIKYMNMFDAQVDAARSALNSLGYNNVEIVVTETG  243

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD  E   ++D AK Y   L++HLRS  GTPLMPGK+ DTYLFALYDE+LK GP S
Sbjct  244  WPSKGDDKEPWATIDKAKDYYSGLITHLRSKAGTPLMPGKTTDTYLFALYDENLKQGPIS  303

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  D T  +D GL K++ + P         G P    N + WCVPK GV++ QL
Sbjct  304  ERSFGLFKPDRTANFDVGLLKNNKENP---------GAP----NKAMWCVPKEGVTNKQL  350

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC  +GIDCSPI PGGACFEP+T+A
Sbjct  351  QANIDYACG-RGIDCSPIAPGGACFEPDTLA  380



>gb|KDO84535.1| hypothetical protein CISIN_1g040787mg, partial [Citrus sinensis]
Length=436

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 149/211 (71%), Gaps = 14/211 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
             SDPRP  LA+CLFQ N GR D  + I YMNMFDAQ+ A R+ALN++G+  VEI V ETG
Sbjct  184  NSDPRPGYLAYCLFQVNAGRVDPNNNIKYMNMFDAQVDAARSALNSLGYNNVEIVVTETG  243

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD  E   ++D AK Y   L++HLRS  GTPLMPGK+ DTYLFALYDE+LK GP S
Sbjct  244  WPSKGDDKEPWATIDKAKDYYSGLITHLRSKAGTPLMPGKTTDTYLFALYDENLKQGPIS  303

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGL+  D T  +D GL K++ + P         G P    N + WCVPK GV++ QL
Sbjct  304  ERSFGLFKPDRTANFDVGLLKNNKENP---------GAP----NKAMWCVPKEGVTNKQL  350

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTIA  634
            QAN+DYAC  +GIDCSPI PGGACFEP+T+A
Sbjct  351  QANIDYACG-RGIDCSPIAPGGACFEPDTLA  380



>ref|XP_006423252.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
 gb|ESR36492.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
Length=379

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ AV +ALNAMGFK VEI VAETG
Sbjct  210  QSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETG  269

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD NEVGPSV+NAKAY GNL++HLRSM GTPLMPGKSVDTY+FALYDEDLKPGPTS
Sbjct  270  WPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTS  329

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+  DL+  YD G+
Sbjct  330  ERSFGLFKPDLSAAYDVGI  348



>ref|XP_011088386.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Sesamum 
indicum]
Length=457

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR D+GS I YMNMFDAQ+ AV +AL  MGFK VEI VAETG
Sbjct  215  QSDPRPDTLAFCLFQPNAGRVDSGSGIKYMNMFDAQVDAVHSALKGMGFKDVEIVVAETG  274

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD+NEVGPS+DNAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  275  WPYKGDANEVGPSLDNAKAYNGNLINHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  334

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+  DL+MTYD GL
Sbjct  335  ERSFGLFKPDLSMTYDVGL  353



>gb|KJB32497.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=362

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSD RPETLAFCLFQPN GR D+G+ I YMNMFDAQ+ +V +AL+AMGFK VEI VAETG
Sbjct  205  QSDSRPETLAFCLFQPNAGRVDSGNGIKYMNMFDAQVDSVHSALSAMGFKDVEIMVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY GDSNEVGPS++NAKAY GNL++HL+SMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  265  WPYSGDSNEVGPSIENAKAYNGNLIAHLKSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  324

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGLY +DL+MTYD G+
Sbjct  325  ERAFGLYKSDLSMTYDVGI  343



>gb|KDO49091.1| hypothetical protein CISIN_1g0122621mg, partial [Citrus sinensis]
 gb|KDO49092.1| hypothetical protein CISIN_1g0122621mg, partial [Citrus sinensis]
Length=222

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 142/176 (81%), Gaps = 3/176 (2%)
 Frame = +2

Query  110  LGAVRTALNAMGFKGVEIAVAETGWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPL  289
            + AV +ALNAMGFK VEI VAETGWPY+GD NEVGPSV+NAKAY GNL++HLRSM GTPL
Sbjct  1    VDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPL  60

Query  290  MPGKSVDTYLFALYDEDLKPGPTSERSFGLYNTDLTMTYDAGLsksstqtpt--tpksAP  463
            MPGKSVDTY+FALYDEDLKPGP  ERSFGL+  DL+  YD G+SKSS       TP +  
Sbjct  61   MPGKSVDTYIFALYDEDLKPGPAFERSFGLFKPDLSAAYDVGISKSSQTPSAPVTPSTPK  120

Query  464  AIGPPASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
                P+ K  ++ WCVPK G+SDAQLQA+LDYAC+ QGIDCSPIQPGGACFEPNT+
Sbjct  121  TPTTPSPKPTAAGWCVPKAGISDAQLQASLDYACS-QGIDCSPIQPGGACFEPNTV  175



>ref|XP_006375635.1| hypothetical protein POPTR_0014s18270g [Populus trichocarpa]
 gb|ERP53432.1| hypothetical protein POPTR_0014s18270g [Populus trichocarpa]
Length=375

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPETLAFCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+KGD N+VGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPFKGDDNDVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLTM YD GL
Sbjct  329  ERSFGLFKTDLTMVYDFGL  347



>ref|XP_002321274.1| hypothetical protein POPTR_0014s18110g [Populus trichocarpa]
 gb|EEE99589.1| hypothetical protein POPTR_0014s18110g [Populus trichocarpa]
Length=374

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR D   KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPETLAFCLFQPNAGRTDGNIKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+KGD N+VGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPFKGDDNDVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLTM YD GL
Sbjct  329  ERSFGLFKTDLTMVYDVGL  347



>ref|XP_006375633.1| hypothetical protein POPTR_0014s18250g [Populus trichocarpa]
 gb|ERP53430.1| hypothetical protein POPTR_0014s18250g [Populus trichocarpa]
Length=378

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPETLAFCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+KGD N+VGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPFKGDDNDVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLTM YD GL
Sbjct  329  ERSFGLFKTDLTMVYDIGL  347



>ref|XP_011012794.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Populus euphratica]
Length=417

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPETLAFCLFQPNAGRVDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD NEVGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFAL+DED+KPGP S
Sbjct  269  WPYKGDDNEVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALFDEDVKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLTM YD GL
Sbjct  329  ERSFGLFKTDLTMVYDVGL  347



>ref|XP_006375631.1| hypothetical protein POPTR_0014s18230g [Populus trichocarpa]
 gb|ERP53428.1| hypothetical protein POPTR_0014s18230g [Populus trichocarpa]
Length=432

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPETLAFCLFQPNAGRTDGNTKIKYMNMFDAQVDAVFSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+KGD N+VGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPFKGDDNDVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLTM YD GL
Sbjct  329  ERSFGLFKTDLTMVYDVGL  347



>gb|EYU37792.1| hypothetical protein MIMGU_mgv1a006258mg [Erythranthe guttata]
Length=450

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR D+GS I YMNMFDAQ+ +V +AL  MGFK VEI VAETG
Sbjct  213  QSDPRPETLAFCLFQPNAGRVDSGSGIKYMNMFDAQVDSVHSALKGMGFKDVEIVVAETG  272

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGDSNEVGPS+D+AKAY GNL++HLRSMVGTPLMPGKSVDTY+FALYDEDLKPGP S
Sbjct  273  WPYKGDSNEVGPSLDSAKAYNGNLINHLRSMVGTPLMPGKSVDTYIFALYDEDLKPGPGS  332

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGLY  DL+  YD  L
Sbjct  333  ERSFGLYKPDLSPIYDVSL  351



>ref|XP_006375618.1| hypothetical protein POPTR_0014s18040g, partial [Populus trichocarpa]
 gb|ERP53415.1| hypothetical protein POPTR_0014s18040g, partial [Populus trichocarpa]
Length=348

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLA CLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  164  RSDTRPETLALCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  223

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+KGD N+VGPS++NAKAY GNL++HLRSMVGTP+MPGKSVDTYLFALYDE+LKPGP S
Sbjct  224  WPFKGDDNDVGPSIENAKAYNGNLIAHLRSMVGTPVMPGKSVDTYLFALYDEELKPGPGS  283

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLT+ YD GL
Sbjct  284  ERSFGLFKTDLTVVYDVGL  302



>ref|XP_002321266.1| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
 gb|EEE99581.1| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
Length=374

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPE LAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPEILAFCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+KGD N+VGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPFKGDDNDVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERS G++ TDLTM YD GL
Sbjct  329  ERSPGIFKTDLTMVYDVGL  347



>ref|XP_009394306.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 146/210 (70%), Gaps = 14/210 (7%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR+DAGSK+ Y NMFDAQ+ AVR+AL+ +GF GVEI VAETG
Sbjct  203  RSDPRPETLAFCLFQPNPGRFDAGSKLMYTNMFDAQVDAVRSALDGLGFPGVEIVVAETG  262

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD +EVG +V+NA+A+ GNLV+HLRS+VGTPLMPG+SVDTY+FALYDEDLKPGP S
Sbjct  263  WPYRGDPDEVGTTVENARAFTGNLVAHLRSLVGTPLMPGRSVDTYIFALYDEDLKPGPAS  322

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ER FGLY  D TM YDAGL KS++ + T+P    A         ++  CVP         
Sbjct  323  ERFFGLYRADQTMNYDAGLVKSASSSYTSPSPPAATTGSTPPAATTGRCVPG--------  374

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
                  A      D  P QP   C  P+ +
Sbjct  375  ------ATPHTSADGGPTQPEEQCHSPDAV  398



>ref|XP_002321268.2| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
 gb|EEE99583.2| hypothetical protein POPTR_0014s18060g [Populus trichocarpa]
Length=454

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPE LAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPEILAFCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+KGD N+VGPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  269  WPFKGDDNDVGPSIENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPGS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERS G++ TDLTM YD GL
Sbjct  329  ERSPGIFKTDLTMVYDVGL  347



>ref|XP_006595937.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Glycine max]
Length=431

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR D+ + + YMNMFDAQ+ AVR+AL+AMGFK VEI VAET
Sbjct  214  RSDPGRADNLAFCLFQPNAGRVDSNTNLKYMNMFDAQVDAVRSALDAMGFKNVEIVVAET  273

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGDSNE GPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPGP 
Sbjct  274  GWPYKGDSNEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPA  333

Query  359  SERSFGLYNTDLTMTYDAGL  418
            SER+FGLYN D +M YDAGL
Sbjct  334  SERAFGLYNPDQSMIYDAGL  353



>ref|XP_008785661.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Phoenix dactylifera]
 ref|XP_008785662.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Phoenix dactylifera]
 ref|XP_008785663.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Phoenix dactylifera]
Length=415

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GR DAGSKITY NMFDAQ+ A+ +ALNA GF  VEI VAETG
Sbjct  176  RDDPRPETLAFCLFQPNPGRLDAGSKITYTNMFDAQVDAIHSALNAAGFPDVEIVVAETG  235

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD  E G +VDNAKA+ GNLV+HLRSM GTPLMPG+ V+TY+FALYDEDLKPGPTS
Sbjct  236  WPYRGDPGEAGTTVDNAKAFNGNLVAHLRSMAGTPLMPGRPVETYIFALYDEDLKPGPTS  295

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+ TDLTM YDAGL
Sbjct  296  ERSFGLFRTDLTMIYDAGL  314



>ref|XP_004173544.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
Length=293

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 6/176 (3%)
 Frame = +2

Query  107  QLGAVRTALNAMG-FKGVEIAVAETGWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGT  283
            QL AVR+ALNA+G FK VEI VAETGW Y+GDSNEVG SV+NA+AY GNL++HLRSMVGT
Sbjct  76   QLDAVRSALNALGGFKDVEIMVAETGWAYRGDSNEVGTSVENARAYNGNLIAHLRSMVGT  135

Query  284  PLMPGKSVDTYLFALYDEDLKPGPTSERSFGLYNTDLTMTYDAGLsksstqtpttpksAP  463
            PLMPGKSVDTY+FALYDE+LKPGPTSER+FGL+  +LTMTYD GLSK+S    T      
Sbjct  136  PLMPGKSVDTYIFALYDENLKPGPTSERAFGLFYPNLTMTYDVGLSKNSQTPTTPTTPTT  195

Query  464  AIGPPASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
                 +SK  +  WC+PK  + D QLQ+NLDYAC   GIDC PIQPGGACFEPNTI
Sbjct  196  P----SSKPTAPVWCLPKADIPDDQLQSNLDYACG-HGIDCGPIQPGGACFEPNTI  246



>ref|XP_010939269.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Elaeis guineensis]
Length=456

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRPETLAFCLFQPN GR+DAGSKITY NMFDAQ+ A+ +ALNA GF  V+I VAETG
Sbjct  209  RDDPRPETLAFCLFQPNSGRFDAGSKITYTNMFDAQVDAIHSALNAAGFPDVDIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD  E G +VDNAKA+ GNLV+HLRSM GTPLMPG+ V+TY+FALYDEDLK GPTS
Sbjct  269  WPYRGDPGEAGTTVDNAKAFNGNLVAHLRSMAGTPLMPGRPVETYIFALYDEDLKSGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGLY TDLTM YDAGL
Sbjct  329  ERSFGLYRTDLTMNYDAGL  347



>ref|XP_009394780.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=415

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 148/210 (70%), Gaps = 20/210 (10%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR DAGSK+TY NMFDAQ+ AVR+AL+ +GF  VEI VAETG
Sbjct  206  RSDPRPETLAFCLFQPNPGRLDAGSKLTYTNMFDAQVDAVRSALDGLGFPEVEIVVAETG  265

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD +EVG +V+NA A+ GNLV+HLRS+ GTPLMPG+SV+TY+FALYDEDLK GPTS
Sbjct  266  WPYRGDPDEVGTTVENAMAFNGNLVAHLRSLAGTPLMPGRSVETYIFALYDEDLKSGPTS  325

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY  D TM YDAGL+K S+    T  ++P          S+  CVP        +
Sbjct  326  ERSFGLYRADQTMNYDAGLAKPSSSISNTASASPG------WTQSAETCVPV-----VTV  374

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA          ++  P+Q G  C+ P+ +
Sbjct  375  QAR---------VEGRPMQSGERCYLPSAV  395



>ref|XP_009394779.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=418

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 148/210 (70%), Gaps = 20/210 (10%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDPRPETLAFCLFQPN GR DAGSK+TY NMFDAQ+ AVR+AL+ +GF  VEI VAETG
Sbjct  209  RSDPRPETLAFCLFQPNPGRLDAGSKLTYTNMFDAQVDAVRSALDGLGFPEVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD +EVG +V+NA A+ GNLV+HLRS+ GTPLMPG+SV+TY+FALYDEDLK GPTS
Sbjct  269  WPYRGDPDEVGTTVENAMAFNGNLVAHLRSLAGTPLMPGRSVETYIFALYDEDLKSGPTS  328

Query  362  ERSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQL  541
            ERSFGLY  D TM YDAGL+K S+    T  ++P          S+  CVP        +
Sbjct  329  ERSFGLYRADQTMNYDAGLAKPSSSISNTASASPG------WTQSAETCVPV-----VTV  377

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QA          ++  P+Q G  C+ P+ +
Sbjct  378  QAR---------VEGRPMQSGERCYLPSAV  398



>ref|XP_006372047.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
 gb|ERP49844.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
Length=363

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPETLAFCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDL-KPGPT  358
            WPYKGD NEVGPS++NAKAY GNL++HLRS+VGTPLMPG+SVDTYLFA YDEDL KPGP 
Sbjct  269  WPYKGDDNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGESVDTYLFAFYDEDLIKPGPG  328

Query  359  SERSFGLYNTDLTMTYDAGL  418
            SERS GL+ T +TM YD GL
Sbjct  329  SERSSGLFKTGVTMVYDVGL  348



>ref|XP_002867117.1| hypothetical protein ARALYDRAFT_491210 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43376.1| hypothetical protein ARALYDRAFT_491210 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETL+FCLFQPN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  207  QSDPRPETLSFCLFQPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNAKAY GNL++HLRSMVGTPLMPGK VDTYLFALYDE+LKPGP+S
Sbjct  267  WASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYLFALYDENLKPGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+ TDL+M YD GL
Sbjct  327  ERAFGLFKTDLSMVYDVGL  345



>ref|XP_006372048.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
 gb|ERP49845.1| hypothetical protein POPTR_0018s08710g [Populus trichocarpa]
Length=375

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SD RPETLAFCLFQPN GR D  +KI YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  209  RSDTRPETLAFCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDL-KPGPT  358
            WPYKGD NEVGPS++NAKAY GNL++HLRS+VGTPLMPG+SVDTYLFA YDEDL KPGP 
Sbjct  269  WPYKGDDNEVGPSIENAKAYNGNLIAHLRSLVGTPLMPGESVDTYLFAFYDEDLIKPGPG  328

Query  359  SERSFGLYNTDLTMTYDAGL  418
            SERS GL+ T +TM YD GL
Sbjct  329  SERSSGLFKTGVTMVYDVGL  348



>emb|CAA18827.1| putative protein (fragment) [Arabidopsis thaliana]
Length=335

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLF+PN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  186  QSDPRPETLAFCLFEPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  245

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNAKAY GNL++HLRSMVGTPLMPGK VDTY+FALYDE+LKPGP+S
Sbjct  246  WASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSS  305

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+ TDL+M YD GL
Sbjct  306  ERAFGLFKTDLSMVYDVGL  324



>emb|CAB80165.1| putative protein (fragment) [Arabidopsis thaliana]
Length=356

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLF+PN GR D+ + I Y NMFDAQ+ AV +AL +MGF+ VEI VAETG
Sbjct  207  QSDPRPETLAFCLFEPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W  +GD+NEVG SVDNAKAY GNL++HLRSMVGTPLMPGK VDTY+FALYDE+LKPGP+S
Sbjct  267  WASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSS  326

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+ TDL+M YD GL
Sbjct  327  ERAFGLFKTDLSMVYDVGL  345



>gb|KEH40122.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=417

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR DA +K+ YMNMFDAQ+ AVR+AL++MGFK VEI VAET
Sbjct  205  KSDPGRADNLAFCLFQPNAGRVDANTKLNYMNMFDAQVDAVRSALDSMGFKDVEIVVAET  264

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL+ HLRS VGTPLMPGKSVDTY+FALYDEDLKPG  
Sbjct  265  GWPYKGDNDEAGPSIENAKAYNGNLIKHLRSKVGTPLMPGKSVDTYIFALYDEDLKPGAG  324

Query  359  SERSFGLYNTDLTMTYDAGL  418
            SE++FGLYNTD +M YDAGL
Sbjct  325  SEKAFGLYNTDQSMIYDAGL  344



>ref|XP_009101841.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
Length=432

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR DA SKI YMNMFDAQ+ AV +AL++ GFK VEI VAETG
Sbjct  207  QSDPRPETLAFCLFQPNPGRVDANSKIKYMNMFDAQVDAVYSALSSFGFKDVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD +EVG +++NAKAY  NL++HL+SM GTPLMPGK ++TYLFALYDE+LKPG  S
Sbjct  267  WPYKGDPDEVGTTIENAKAYNKNLIAHLKSMAGTPLMPGKVIETYLFALYDENLKPGKGS  326

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  327  ERAFGLFKPDLTMTYDIGL  345



>ref|NP_001049445.2| Os03g0227400 [Oryza sativa Japonica Group]
 dbj|BAF11359.2| Os03g0227400, partial [Oryza sativa Japonica Group]
Length=235

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DAGS +TY NMFDAQL A+R AL+A G+ GV+I +AETGW
Sbjct  56   SDTRPETLAFCLFQPNPGRVDAGSGLTYTNMFDAQLDAIRAALDAKGYSGVDIVIAETGW  115

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNA+AY GNLV+HL+S VGTP  PGKSVDTYLFALYDEDLK GP SE
Sbjct  116  PYKGDADEGGATVDNARAYNGNLVAHLKSQVGTPRTPGKSVDTYLFALYDEDLKGGPESE  175

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YD GL
Sbjct  176  RSFGLYRTDLTANYDIGL  193



>gb|ADE76367.1| unknown [Picea sitchensis]
Length=472

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 142/214 (66%), Gaps = 8/214 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +SDP   TLA+ LF+PN G YDA + + Y NMFDAQL AV +A+  +G+  ++I VAETG
Sbjct  218  KSDPTDRTLAYALFEPNQGSYDANTGLKYSNMFDAQLDAVYSAMKYLGYTDIDIVVAETG  277

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD +E G S+ NA AY GNL+ H+ SM GTP+MP +SV+ Y+F L++EDLKPGPTS
Sbjct  278  WPSVGDPSEAGVSLQNAIAYNGNLIKHVTSMAGTPMMPNRSVEIYIFGLFNEDLKPGPTS  337

Query  362  ERSFGLYNTDLTMTYDAGLsksst---qtpttpksAPAIGPPASKKNSSWWCVPKGGVSD  532
            ER+FGL+  D+TM YD GL +S +    T       P I PP  K     WCV K    +
Sbjct  338  ERNFGLFKADMTMAYDVGLLRSQSAGPSTAAPRTDGPVIAPPTGK----VWCVAKPSADE  393

Query  533  AQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
              L+ NLDYAC  Q IDC PIQ GG C+ PNT+A
Sbjct  394  NSLKENLDYACG-QSIDCKPIQQGGPCYLPNTMA  426



>ref|XP_007160761.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
 gb|ESW32755.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
Length=425

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 1/140 (1%)
 Frame = +2

Query  2    QSDP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAET  178
            +SDP R + LAFCLFQPN GR D  + + YMNMFDAQ+ AVR+AL+++GFK VEI VAET
Sbjct  208  RSDPGRADNLAFCLFQPNAGRVDPNTNLKYMNMFDAQVDAVRSALDSLGFKNVEIVVAET  267

Query  179  GWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPT  358
            GWPYKGD++E GPS++NAKAY GNL++HLRSMVGTPLMPGKSVDTYLFALYDEDLKPG  
Sbjct  268  GWPYKGDTSEAGPSLENAKAYNGNLIAHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGDA  327

Query  359  SERSFGLYNTDLTMTYDAGL  418
            SER+FGL+N D +M YDAGL
Sbjct  328  SERAFGLFNPDQSMIYDAGL  347



>emb|CDY22386.1| BnaA06g37080D [Brassica napus]
Length=432

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFC FQPN GR DA SKI YMNMFDAQ+ AV +AL++ GFK VEI VAETG
Sbjct  207  QSDPRPETLAFCSFQPNPGRVDANSKIKYMNMFDAQVDAVYSALSSFGFKDVEIVVAETG  266

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD +EVG +++NAKAY  NL++HL+SM GTPLMPGK ++TYLFALYDE+LKPG  S
Sbjct  267  WPYKGDPDEVGTTIENAKAYNKNLIAHLKSMAGTPLMPGKVIETYLFALYDENLKPGKGS  326

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  327  ERAFGLFKPDLTMTYDIGL  345



>gb|EPS70348.1| hypothetical protein M569_04409 [Genlisea aurea]
Length=448

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQ N GR D+G+ I YMNMFDAQ+ AV +AL +MG   VEI VAETG
Sbjct  218  QSDPRPETLAFCLFQLNPGRVDSGTGIKYMNMFDAQVDAVHSALKSMGHGDVEIVVAETG  277

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPY+GD  E G SVD AKAY GNL++HLRSMVGTPL+PGKSVDTYLFALYDEDLKPGP S
Sbjct  278  WPYRGDPIEKGTSVDVAKAYNGNLITHLRSMVGTPLLPGKSVDTYLFALYDEDLKPGPLS  337

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ERSFGL+N D +MTY+ GL
Sbjct  338  ERSFGLFNPDFSMTYNVGL  356



>gb|EEC74801.1| hypothetical protein OsI_10603 [Oryza sativa Indica Group]
Length=439

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DAGS +TY NMFDAQL A+R AL+A G+ GV+I +AETGW
Sbjct  215  SDTRPETLAFCLFQPNPGRVDAGSGLTYTNMFDAQLDAIRAALDAKGYSGVDIVIAETGW  274

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNA+AY GNLV+HL+S VGTP  PGKSVDTYLFALYDEDLK GP SE
Sbjct  275  PYKGDADEGGATVDNARAYNGNLVAHLKSQVGTPRTPGKSVDTYLFALYDEDLKGGPESE  334

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YD GL
Sbjct  335  RSFGLYRTDLTANYDIGL  352



>gb|ABF94756.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=426

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DAGS +TY NMFDAQL A+R AL+A G+ GV+I +AETGW
Sbjct  206  SDTRPETLAFCLFQPNPGRVDAGSGLTYTNMFDAQLDAIRAALDAKGYSGVDIVIAETGW  265

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNA+AY GNLV+HL+S VGTP  PGKSVDTYLFALYDEDLK GP SE
Sbjct  266  PYKGDADEGGATVDNARAYNGNLVAHLKSQVGTPRTPGKSVDTYLFALYDEDLKGGPESE  325

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YD GL
Sbjct  326  RSFGLYRTDLTANYDIGL  343



>gb|AAN60993.1| Putative glycosyl hydrolase [Oryza sativa Japonica Group]
Length=455

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DAGS +TY NMFDAQL A+R AL+A G+ GV+I +AETGW
Sbjct  231  SDTRPETLAFCLFQPNPGRVDAGSGLTYTNMFDAQLDAIRAALDAKGYSGVDIVIAETGW  290

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNA+AY GNLV+HL+S VGTP  PGKSVDTYLFALYDEDLK GP SE
Sbjct  291  PYKGDADEGGATVDNARAYNGNLVAHLKSQVGTPRTPGKSVDTYLFALYDEDLKGGPESE  350

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YD GL
Sbjct  351  RSFGLYRTDLTANYDIGL  368



>ref|XP_006403361.1| hypothetical protein EUTSA_v10003213mg [Eutrema salsugineum]
 gb|ESQ44814.1| hypothetical protein EUTSA_v10003213mg [Eutrema salsugineum]
Length=433

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLA+CLF+PN GR D+ SKI YMNMFDAQ+ AV +AL+ MGFK VEI VAETG
Sbjct  208  QSDPRPDTLAYCLFEPNPGRVDSNSKIKYMNMFDAQVDAVYSALSKMGFKDVEIVVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD  E G +++NA+AY  NL+ HL+SM GTPLMPGK +DTYLFALYDE+LKPG  S
Sbjct  268  WPYKGDPTEAGATIENARAYNKNLIGHLKSMAGTPLMPGKVIDTYLFALYDENLKPGKGS  327

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  328  ERAFGLFKPDLTMTYDIGL  346



>dbj|BAK02637.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 135/202 (67%), Gaps = 6/202 (3%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD R ETLAFCLFQPN GR DA S +TYMNMFDAQL AVR AL+  G  GV+I VAETGW
Sbjct  208  SDTRDETLAFCLFQPNPGRVDAASGLTYMNMFDAQLDAVRAALDGKGCAGVDIVVAETGW  267

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD+ E G + DNA+AY GNLV+HLRS VGTP  PGKSVDTY+FALYDEDLKPGP SE
Sbjct  268  PYKGDAGEAGATPDNARAYNGNLVAHLRSQVGTPRTPGKSVDTYIFALYDEDLKPGPVSE  327

Query  365  RSFGLYNTDLTMTYDAGLsksstqtptt----pksAPAIGPPASKK--NSSWWCVPKGGV  526
            RSFGLY  DLT  YD GL+K S    T+      +APA G P   +    + +CV  G V
Sbjct  328  RSFGLYQADLTANYDIGLAKGSAAPSTSGQIGVTAAPAQGAPQGGRGITPAGFCVTTGSV  387

Query  527  SDAQLQANLDYACALQGIDCSP  592
                       +C + G   SP
Sbjct  388  PGNTQPQQQSSSCYVPGTAASP  409



>gb|ABK25242.1| unknown [Picea sitchensis]
Length=491

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 146/235 (62%), Gaps = 29/235 (12%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +S+P  +TLA+ LF+PN G YD  + +TY NMFDAQL AV +A+  +G+ G++I VAETG
Sbjct  218  KSNPTDQTLAYSLFKPNPGFYDTNTGLTYTNMFDAQLDAVYSAMKYLGYTGIDIVVAETG  277

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD  E G S+ NA AY GNL+ H+ SM GTPL P + + TY+F+L++EDLKPGPTS
Sbjct  278  WPSVGDPTEAGASLQNAIAYNGNLIKHVTSMAGTPLRPNRYIHTYIFSLFNEDLKPGPTS  337

Query  362  ERSFGLYNTDLTMTYDAGLsks------------------------stqtpttpksAPAI  469
            ER++GL+  D+TM YD GL +S                        S   P T    P  
Sbjct  338  ERNYGLFKADMTMAYDVGLLQSPSAGPSPAPRTGGPVTATPPRAGGSVTAPPTRTGGPVT  397

Query  470  GPPASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             PP  K     WC+ K G  +  L+ANL+YAC  QGIDC PIQPGG C+ PNT+A
Sbjct  398  APPTGKV----WCITKPGADEKTLEANLNYACG-QGIDCRPIQPGGPCYSPNTVA  447



>ref|XP_006649666.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Oryza brachyantha]
Length=426

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 128/174 (74%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DA S ++Y NMFDAQL A+R AL+A G+ GV+I +AETGW
Sbjct  206  SDTRPETLAFCLFQPNPGRVDAASGLSYTNMFDAQLDAIRAALDAKGYSGVDIVIAETGW  265

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNAKAY GNLV+HL+S VGTP  PGKSVDTY+FALYDEDLK GP SE
Sbjct  266  PYKGDADEAGATVDNAKAYNGNLVAHLKSQVGTPRTPGKSVDTYIFALYDEDLKGGPESE  325

Query  365  RSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGV  526
            RSFGLY +DLT  YD GL  ++  T       P+   P+     + +CV   GV
Sbjct  326  RSFGLYRSDLTANYDIGL-AAAPGTAAPATITPSTPQPSRGMTPTGFCVTAAGV  378



>ref|XP_004978983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Setaria italica]
Length=444

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DA S +TY NMFDAQL A+R AL+A G+  V+I +AETGW
Sbjct  221  SDTRPETLAFCLFQPNAGRVDAASGLTYTNMFDAQLDAIRAALDAKGYTDVDIVIAETGW  280

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNA+AY GNLV+HL+S  GTP  PGKSVDTY+FALYDEDLK GP SE
Sbjct  281  PYKGDADEAGATVDNARAYNGNLVAHLKSQAGTPRTPGKSVDTYIFALYDEDLKGGPESE  340

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YDAGL
Sbjct  341  RSFGLYKTDLTANYDAGL  358



>ref|XP_004978982.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Setaria italica]
Length=439

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DA S +TY NMFDAQL A+R AL+A G+  V+I +AETGW
Sbjct  212  SDTRPETLAFCLFQPNAGRVDAASGLTYTNMFDAQLDAIRAALDAKGYTDVDIVIAETGW  271

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNA+AY GNLV+HL+S  GTP  PGKSVDTY+FALYDEDLK GP SE
Sbjct  272  PYKGDADEAGATVDNARAYNGNLVAHLKSQAGTPRTPGKSVDTYIFALYDEDLKGGPESE  331

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YDAGL
Sbjct  332  RSFGLYKTDLTANYDAGL  349



>ref|NP_001147326.1| LOC100280934 precursor [Zea mays]
 gb|ACF87237.1| unknown [Zea mays]
 gb|ACG26810.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACN31798.1| unknown [Zea mays]
 tpg|DAA44251.2| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=427

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DA S +TY NMFDAQL A+R AL+A G+  VEI +AETGW
Sbjct  206  SDTRPETLAFCLFQPNAGRVDAVSGLTYTNMFDAQLDAIRAALDAKGYSDVEIVIAETGW  265

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNAKAY  NLV+HL+S VGTP  PGKSVDTY+FALYDEDLK GP SE
Sbjct  266  PYKGDADEAGATVDNAKAYNSNLVAHLKSQVGTPRTPGKSVDTYIFALYDEDLKGGPESE  325

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YD GL
Sbjct  326  RSFGLYKTDLTANYDVGL  343



>ref|XP_002468213.1| hypothetical protein SORBIDRAFT_01g041880 [Sorghum bicolor]
 gb|EER95211.1| hypothetical protein SORBIDRAFT_01g041880 [Sorghum bicolor]
Length=432

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD RPETLAFCLFQPN GR DA S +TY NMFDAQL A+R AL+A G+  VEI +AETGW
Sbjct  208  SDTRPETLAFCLFQPNAGRVDAVSGLTYTNMFDAQLDAIRAALDAKGYSDVEIVIAETGW  267

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD++E G +VDNAKAY  NLV+HL+S VGTP  PGKSVDTY+FALYDEDLK GP SE
Sbjct  268  PYKGDADEAGATVDNAKAYNTNLVAHLKSQVGTPRTPGKSVDTYIFALYDEDLKGGPESE  327

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY TDLT  YD GL
Sbjct  328  RSFGLYKTDLTANYDVGL  345



>gb|EMT19757.1| Glucan endo-1,3-beta-glucosidase 7 [Aegilops tauschii]
Length=452

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD R ETLAFCLFQPN GR DA S +TYMNMFDAQL AVR AL+  G+ GV+I +AETGW
Sbjct  289  SDTRDETLAFCLFQPNPGRVDAASGLTYMNMFDAQLDAVRAALDGKGYAGVDIVIAETGW  348

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PY+GD++E G + DNA+AY GNLV+HLRS VGTP  PG+SVDTYLFALYDEDLKPGP SE
Sbjct  349  PYRGDADEAGATPDNARAYNGNLVAHLRSQVGTPRTPGRSVDTYLFALYDEDLKPGPVSE  408

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY  DLT  YD GL
Sbjct  409  RSFGLYQADLTANYDIGL  426



>emb|CDX71547.1| BnaC04g17820D [Brassica napus]
Length=436

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = +2

Query  2    QSDPRPE----TLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAV  169
            QSDPRP     TLAFCLFQPN GR DA SKI YMNMFDAQ+ AV +AL++ GFK VEI V
Sbjct  207  QSDPRPRAGFRTLAFCLFQPNPGRVDANSKIKYMNMFDAQVDAVYSALSSFGFKDVEIVV  266

Query  170  AETGWPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKP  349
            AETGWPYKGD +EVG +++NAKAY  NL++HL+SM GTPLMPGK ++TYLFALYDE+LKP
Sbjct  267  AETGWPYKGDPDEVGTTIENAKAYNKNLIAHLKSMAGTPLMPGKVIETYLFALYDENLKP  326

Query  350  GPTSERSFGLYNTDLTMTYDAGL  418
            G  SER+FGL+  D+TMTYD GL
Sbjct  327  GKGSERAFGLFKPDVTMTYDIGL  349



>dbj|BAJ95272.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q DPRP+TLAFCLFQPN GR DAGS +TY +MFDAQ+ AVR AL+A G+K VE+ VAETG
Sbjct  205  QDDPRPDTLAFCLFQPNAGRPDAGSGLTYTSMFDAQVDAVRAALDAKGYKDVEVVVAETG  264

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+ G ++E G SV+NA A+V NLVSHLRSMVGTP MPGKSVDTYLFA+YDEDLKPG  S
Sbjct  265  WPHSGGTDEAGASVENAHAFVSNLVSHLRSMVGTPRMPGKSVDTYLFAVYDEDLKPGKAS  324

Query  362  ERSFGLYNTDLTMTYDAGL  418
            E+SFGL+ T LT TY  GL
Sbjct  325  EKSFGLFQTTLTETYPTGL  343



>gb|ABK24319.1| unknown [Picea sitchensis]
 gb|ACN40930.1| unknown [Picea sitchensis]
Length=491

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 146/235 (62%), Gaps = 29/235 (12%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +S+P  +TLA+ LF+PN G YD  + +TY NMFDAQL AV +A+  +G+ G++I VAETG
Sbjct  218  KSNPTDQTLAYSLFKPNPGFYDTNTGLTYTNMFDAQLDAVYSAMKYLGYTGIDIVVAETG  277

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP  GD  E G S+ NA AY GNL+ H+ SM GTPL P + + TY+F+L++EDLK GPTS
Sbjct  278  WPSVGDPTEAGASLQNAIAYNGNLIKHVTSMAGTPLRPNRYIHTYIFSLFNEDLKSGPTS  337

Query  362  ERSFGLYNTDLTMTYDAGLsks------------------------stqtpttpksAPAI  469
            ER++GL+  D+TM YD GL +S                        S  +P T    P  
Sbjct  338  ERNYGLFKADMTMAYDVGLLQSPSAGPSPAPRTGGPVTATPPLAGGSVTSPPTRTGGPVT  397

Query  470  GPPASKKNSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTIA  634
             PP  K     WC+ K G  +  L+ANL+YAC  QGIDC PIQPGG C+ PNT+A
Sbjct  398  APPTGKV----WCITKPGADEKTLEANLNYACG-QGIDCRPIQPGGPCYSPNTVA  447



>emb|CAN83700.1| hypothetical protein VITISV_027546 [Vitis vinifera]
Length=325

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 137/205 (67%), Gaps = 11/205 (5%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P  L +C+F+PN G +D  + ITY NMFDAQ+ AV +A+  +G+  VEI VAETGWP  G
Sbjct  88   PNMLNYCIFKPNRGVHDKFTGITYTNMFDAQMDAVYSAMKVLGYGDVEIMVAETGWPSLG  147

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            D N+VG +++NA  Y GNL+ H+ S  GTPLMP +   TYLF+L++E+LKPG T+ER+FG
Sbjct  148  DPNQVGVNLENAATYNGNLLKHISSGKGTPLMPNRRFQTYLFSLFNENLKPGSTAERNFG  207

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLD  556
            L+  D T  YD G+         +   AP    P+ KK    WCVPK   +D  LQ+N++
Sbjct  208  LFRPDFTPVYDIGI------LKQSAGGAPTPTVPSGKK----WCVPKPDATDEALQSNIN  257

Query  557  YACALQGIDCSPIQPGGACFEPNTI  631
            Y C+  G+DC PIQPGGAC++PNTI
Sbjct  258  YVCS-TGVDCKPIQPGGACYDPNTI  281



>ref|XP_002283647.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=447

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 138/205 (67%), Gaps = 11/205 (5%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P  L +C+F+PN G +D  + ITY NMFDAQ+ AV +A+  +G+  VEI VAETGWP  G
Sbjct  210  PNMLNYCIFKPNRGVHDKFTGITYTNMFDAQMDAVYSAMKVLGYGDVEIMVAETGWPSLG  269

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            D N+VG +++NA +Y GNL+ H+ S  GTPLMP +   TYLF+L++E+LKPG T+ER+FG
Sbjct  270  DPNQVGVNLENAASYNGNLLKHISSGKGTPLMPNRRFQTYLFSLFNENLKPGSTAERNFG  329

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLD  556
            L+  D T  YD G+         +   AP    P+ KK    WCVPK   +D  LQ+N++
Sbjct  330  LFRPDFTPVYDIGI------LKQSAGGAPTPTVPSGKK----WCVPKPDATDEALQSNIN  379

Query  557  YACALQGIDCSPIQPGGACFEPNTI  631
            Y C+  G+DC PIQPGGAC++PNTI
Sbjct  380  YVCS-TGVDCKPIQPGGACYDPNTI  403



>gb|KFK31822.1| hypothetical protein AALP_AA6G162900 [Arabis alpina]
Length=435

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            + DPRP+TLAFCLFQPN GR D  + I YMNMFDAQ+ AV +AL+AMGFK VEI VAETG
Sbjct  209  KDDPRPDTLAFCLFQPNPGRPDPNTNIKYMNMFDAQVDAVHSALSAMGFKDVEIMVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            W YKGD +E G +++NA AY  NL++HL+SM GTPLMPGK +DTYLFALYDE+LK G +S
Sbjct  269  WAYKGDPDEAGATIENAHAYNKNLIAHLKSMAGTPLMPGKVIDTYLFALYDENLKFGKSS  328

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  329  ERAFGLFKPDLTMTYDVGL  347



>ref|XP_006350772.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=448

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 139/204 (68%), Gaps = 11/204 (5%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            ETL + LF+PN G YD  + + Y NMFDAQL AV +A+ A+G+  V+I VAETGWP  GD
Sbjct  212  ETLDYALFKPNNGVYDEATGMNYTNMFDAQLDAVYSAMKALGYADVDIVVAETGWPSAGD  271

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
             N++G S++NA +Y  NLV H+ S VGTPLMP ++ +TY+FAL++EDLKP  TSER+FGL
Sbjct  272  PNQLGVSLENAISYNVNLVKHVNSGVGTPLMPNRTFETYVFALFNEDLKPS-TSERNFGL  330

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDY  559
            +  D +  YD G+        T   S PA+ P  SKK    WCVP    SDA LQ+N+D+
Sbjct  331  FRPDFSPVYDVGI-----LRNTQASSPPAMAPEVSKK----WCVPTTDASDAALQSNIDF  381

Query  560  ACALQGIDCSPIQPGGACFEPNTI  631
             C+  GIDC PI+ GG C+EPNTI
Sbjct  382  VCS-SGIDCQPIKDGGPCYEPNTI  404



>ref|XP_002865493.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41752.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q D RPETLA+CLFQPN GR D  S + YMNMFDAQ+ AV +ALN++GFK VEI VAETG
Sbjct  208  QDDRRPETLAYCLFQPNPGRVDPKSNLKYMNMFDAQVDAVYSALNSIGFKDVEIVVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD +E G +V+NA+AY  NL++HL+S  GTPLMPG+ +DTYLFALYDE+LKPG  S
Sbjct  268  WPYKGDPDEAGATVENARAYNKNLIAHLKSGSGTPLMPGRVIDTYLFALYDENLKPGKGS  327

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  328  ERAFGLFRPDLTMTYDIGL  346



>ref|XP_006827757.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
 gb|ERM95173.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
Length=468

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 132/205 (64%), Gaps = 1/205 (0%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P TL F LF+PN G +D  + +TY NM DAQL A+ +A+  +GF  VEI +AETGWP  G
Sbjct  216  PNTLDFALFRPNKGVFDVNTHLTYTNMLDAQLDAIYSAMKRLGFTDVEIVIAETGWPSIG  275

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            D  ++G SV NA AY GNL+ H+ S +GTPLMP ++ +TY+F+L++E+LK GPT+ER+FG
Sbjct  276  DPGQIGVSVANAAAYNGNLIRHVNSGIGTPLMPNQTFETYIFSLFNENLKLGPTAERNFG  335

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLD  556
            L+  D    YD G+ +S  + P      P         N   WC+PK       LQ N+D
Sbjct  336  LFRPDFVPAYDIGILRSEARMPAPINPTPLAPINQVPTNMKQWCLPKANADPRALQENID  395

Query  557  YACALQGIDCSPIQPGGACFEPNTI  631
            YAC  QG+DC PIQ GGACF PNTI
Sbjct  396  YACG-QGLDCRPIQIGGACFLPNTI  419



>ref|XP_010494214.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=435

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q D RPETLA+CLFQ N GR D  SK+ YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  208  QEDRRPETLAYCLFQTNPGRVDPNSKLKYMNMFDAQVDAVYSALNSMGFKDVEIMVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD  E G +V+NA+AY  NL++HL+S  GTPLMPGK ++TYLFALYDE+LKPG  S
Sbjct  268  WPYKGDPEEAGATVENARAYNKNLIAHLKSGSGTPLMPGKVIETYLFALYDENLKPGKGS  327

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  328  ERAFGLFKPDLTMTYDIGL  346



>ref|XP_008802734.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=451

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 142/205 (69%), Gaps = 6/205 (3%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P TL + LF+PN G +D  +KI Y NMFDAQL AV TA+  +G+  VEIAV ETGWP   
Sbjct  209  PRTLNYALFKPNAGVFDPVTKINYTNMFDAQLDAVYTAMKKLGYGDVEIAVGETGWPSAA  268

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            +  + G SV++A  + GNL+ ++ S  GTPLMP ++ +TY+FAL++E+LKPGP +ER++G
Sbjct  269  EPGQAGVSVEDAATFNGNLIRNVNSGKGTPLMPHRTFETYIFALFNENLKPGPIAERNWG  328

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLD  556
            L+  DLT  Y+ GL+K+ +        AP++G  +S+K    WCVPK G S+A LQA+++
Sbjct  329  LFQPDLTPVYNVGLTKTPSGGRGGAAPAPSVG--SSRK----WCVPKSGASEAALQADIN  382

Query  557  YACALQGIDCSPIQPGGACFEPNTI  631
            Y C+   +DC PIQ GGACF PNTI
Sbjct  383  YVCSSGIVDCKPIQEGGACFLPNTI  407



>gb|AFW67776.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=386

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SDPRPETLAFCLFQPN GR DAGS +TY NMFDAQ+ AVR AL+A G+K V+I VAETGW
Sbjct  207  SDPRPETLAFCLFQPNAGRPDAGSSLTYTNMFDAQVDAVRAALDAKGYKDVDIVVAETGW  266

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P+KGD +E G +V+NA+A+V  LVSHLRS+ GTP  PGKSV+TY+FA+YDEDLKPG  SE
Sbjct  267  PHKGDPDEAGATVENARAFVSGLVSHLRSLSGTPRAPGKSVETYIFAMYDEDLKPGKASE  326

Query  365  RSFGLYNTDLTMTYDAGL  418
            R FGL+ T L  TY  GL
Sbjct  327  RYFGLFQTSLAETYPTGL  344



>ref|XP_004986270.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Setaria italica]
Length=420

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SDPRPETLAFCLFQPN GR DAGS +TY NMFDA + AVR AL+A G+K VEI VAETGW
Sbjct  205  SDPRPETLAFCLFQPNAGRPDAGSGLTYTNMFDAMVDAVRAALDAKGYKDVEIVVAETGW  264

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P+KGD++E G +V+NA+A+V  LVSHLRS+ GTP  PGKSV+TY+FA+YDEDLKPG  SE
Sbjct  265  PHKGDTDEAGATVENARAFVSGLVSHLRSLAGTPRAPGKSVETYIFAVYDEDLKPGKASE  324

Query  365  RSFGLYNTDLTMTYDAGL  418
            R FGL+ T LT TY  GL
Sbjct  325  RYFGLFQTSLTETYPTGL  342



>gb|AFW67777.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=442

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SDPRPETLAFCLFQPN GR DAGS +TY NMFDAQ+ AVR AL+A G+K V+I VAETGW
Sbjct  207  SDPRPETLAFCLFQPNAGRPDAGSSLTYTNMFDAQVDAVRAALDAKGYKDVDIVVAETGW  266

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P+KGD +E G +V+NA+A+V  LVSHLRS+ GTP  PGKSV+TY+FA+YDEDLKPG  SE
Sbjct  267  PHKGDPDEAGATVENARAFVSGLVSHLRSLSGTPRAPGKSVETYIFAMYDEDLKPGKASE  326

Query  365  RSFGLYNTDLTMTYDAGL  418
            R FGL+ T L  TY  GL
Sbjct  327  RYFGLFQTSLAETYPTGL  344



>ref|XP_002466550.1| hypothetical protein SORBIDRAFT_01g009770 [Sorghum bicolor]
 gb|EER93548.1| hypothetical protein SORBIDRAFT_01g009770 [Sorghum bicolor]
Length=445

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SDPRPETLAFCLFQPN GR DAGS +TY NMFDAQ+ AVR AL+A G+K VEI VAETGW
Sbjct  208  SDPRPETLAFCLFQPNAGRPDAGSGLTYTNMFDAQVDAVRAALDAKGYKDVEIVVAETGW  267

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P+KGD++E G + +NA+A+V  LVSHL S+ GTP  PGKSV+TY+FALYDEDLKPG  SE
Sbjct  268  PHKGDTDEAGATAENARAFVSGLVSHLSSLAGTPRAPGKSVETYIFALYDEDLKPGKASE  327

Query  365  RSFGLYNTDLTMTYDAGL  418
            R FGL+ T LT TY  GL
Sbjct  328  RYFGLFQTSLTETYPTGL  345



>ref|XP_010228925.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Brachypodium distachyon]
Length=426

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD R ETLAFCLFQPN GR DAGS +TY+NMFDAQL AVR AL+A G+ G++I +AETGW
Sbjct  200  SDTRAETLAFCLFQPNPGRVDAGSGLTYLNMFDAQLDAVRAALDAKGYGGLDIVIAETGW  259

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD+ E G + +NA+AY GNLV+HL++  GTP  PGKSVDTYLFALYDEDLKPG  SE
Sbjct  260  PYKGDAGEAGATPENARAYNGNLVAHLKAGTGTPRTPGKSVDTYLFALYDEDLKPGAASE  319

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY  DLT  YD GL
Sbjct  320  RSFGLYKADLTPNYDIGL  337



>ref|XP_006375634.1| hypothetical protein POPTR_0014s18260g, partial [Populus trichocarpa]
 gb|ERP53431.1| hypothetical protein POPTR_0014s18260g, partial [Populus trichocarpa]
Length=352

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 112/139 (81%), Gaps = 5/139 (4%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            +S  RP+TLAFCLFQP  GR D  +KI YMNMFDAQ  AV +ALN+MGFK VEI VAETG
Sbjct  171  RSHTRPDTLAFCLFQPIAGRMDGNTKIKYMNMFDAQ-DAVYSALNSMGFKNVEIVVAETG  229

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD N+VGPS++NAKAY GNL++HL+SMVGTPLMPGKS DTYLFALYDEDLKP P S
Sbjct  230  WPYKGDDNQVGPSIENAKAYNGNLIAHLQSMVGTPLMPGKSFDTYLFALYDEDLKPRPGS  289

Query  362  ERSFGLYNTDLTMTYDAGL  418
            E +     T LTM YD GL
Sbjct  290  EHN----RTGLTMVYDVGL  304



>ref|XP_006651673.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Oryza brachyantha]
Length=343

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRPETLAFCLFQPN GR DAGSKI Y NMFDAQL AV++AL  +G+  VEI VAETG
Sbjct  211  QSDPRPETLAFCLFQPNAGRVDAGSKIKYTNMFDAQLDAVKSALGRVGYGDVEIVVAETG  270

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP KGD+ E G + DNA+AYV NLV+HLRS  GTPLMPGKSVDTYLFALYDEDLKPGP S
Sbjct  271  WPTKGDAGEAGATADNARAYVSNLVAHLRSGAGTPLMPGKSVDTYLFALYDEDLKPGPMS  330

Query  362  ERSF  373
            ERS+
Sbjct  331  ERSY  334



>ref|NP_001150853.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACG40661.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
Length=442

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SDPRPETLAFCLFQPN GR DAGS +TY NMFDAQ+ AVR AL+A G+K V+I VAETGW
Sbjct  207  SDPRPETLAFCLFQPNAGRPDAGSGLTYTNMFDAQVDAVRAALDAKGYKDVDIVVAETGW  266

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P+KGD +E G +V+NA+A+V  LVSHLRS+ GTP  PGKSV+TY+FA+YDEDLKPG  SE
Sbjct  267  PHKGDPDEAGATVENARAFVSGLVSHLRSLSGTPRAPGKSVETYIFAMYDEDLKPGKASE  326

Query  365  RSFGLYNTDLTMTYDAGL  418
            R FGL+ T L  TY  GL
Sbjct  327  RYFGLFQTSLAETYPTGL  344



>ref|NP_199086.2| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AAL66985.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAN12906.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AED94854.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
Length=438

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q D RPETLA+CLFQ N GR D  S + YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  208  QDDRRPETLAYCLFQANPGRVDPNSNLKYMNMFDAQVDAVYSALNSMGFKDVEIMVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD  E G +V+NA+AY  NL++HL+S  GTPLMPG+ +DTYLFALYDE+LKPG  S
Sbjct  268  WPYKGDPEEAGATVENARAYNKNLIAHLKSGSGTPLMPGRVIDTYLFALYDENLKPGKGS  327

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  328  ERAFGLFRPDLTMTYDIGL  346



>ref|XP_003561857.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Brachypodium distachyon]
Length=442

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SD R ETLAFCLFQPN GR DAGS +TY+NMFDAQL AVR AL+A G+ G++I +AETGW
Sbjct  216  SDTRAETLAFCLFQPNPGRVDAGSGLTYLNMFDAQLDAVRAALDAKGYGGLDIVIAETGW  275

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            PYKGD+ E G + +NA+AY GNLV+HL++  GTP  PGKSVDTYLFALYDEDLKPG  SE
Sbjct  276  PYKGDAGEAGATPENARAYNGNLVAHLKAGTGTPRTPGKSVDTYLFALYDEDLKPGAASE  335

Query  365  RSFGLYNTDLTMTYDAGL  418
            RSFGLY  DLT  YD GL
Sbjct  336  RSFGLYKADLTPNYDIGL  353



>ref|XP_010481959.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=435

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q D RPETLA+CLFQ N GR D  S + YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  208  QEDRRPETLAYCLFQTNPGRVDPNSNLKYMNMFDAQVDAVYSALNSMGFKDVEIMVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD  E G +V+NA+AY  NL++HL+S  GTPLMPGK ++TYLFALYDE+LKPG  S
Sbjct  268  WPYKGDPEEAGATVENARAYNKNLIAHLKSGSGTPLMPGKVIETYLFALYDENLKPGKGS  327

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  328  ERAFGLFKPDLTMTYDIGL  346



>ref|XP_004241225.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=449

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 137/203 (67%), Gaps = 10/203 (5%)
 Frame = +2

Query  23   TLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGDS  202
            TL + LF+PN G YD  + + Y NMFDAQ+ AV +A+ A+G+  V+I VAETGWP  GD 
Sbjct  213  TLDYALFKPNNGVYDKATGMNYTNMFDAQIDAVYSAMKALGYADVDIVVAETGWPSAGDP  272

Query  203  NEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGLY  382
            N+ G S++NA +Y  NLV H+ S VGTPLMP ++ +TY+F+L++EDLKP  TSER+FGL+
Sbjct  273  NQPGVSLENAISYNVNLVKHVNSGVGTPLMPNRTFETYVFSLFNEDLKPS-TSERNFGLF  331

Query  383  NTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDYA  562
              D +  YD G+        T   S PA+ P  SKK    WCVPK   SDA LQ+NLD+ 
Sbjct  332  RPDFSPVYDVGI-----LRNTQALSPPAMAPEVSKK----WCVPKTDASDAALQSNLDFV  382

Query  563  CALQGIDCSPIQPGGACFEPNTI  631
            C+   +DC PI+ GG CFEPNT+
Sbjct  383  CSSGIVDCQPIKDGGPCFEPNTV  405



>ref|XP_010256938.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=455

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 137/204 (67%), Gaps = 8/204 (4%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+PN G+YD  ++ITY NMFDAQL AV +A+  +G+  V+I V ETGWP  GD
Sbjct  216  KTLNYALFKPNRGKYDKFTRITYTNMFDAQLDAVYSAMKKLGYGDVDIVVGETGWPSLGD  275

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            +N+   ++ NA +Y GNL+ H+ S  GTPLMP +S +T++FAL++E+LKPGPT ER+FGL
Sbjct  276  ANQPDVNIQNAISYNGNLIKHVNSGKGTPLMPNRSFETFIFALFNENLKPGPTPERNFGL  335

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDY  559
            +  D T  YD+G+ +   +     +   A   PA K     WCVPK   SD  LQAN++Y
Sbjct  336  FQPDFTPVYDSGVMRGQMRGRRRRRRRGA---PAGK----VWCVPKAEASDEALQANINY  388

Query  560  ACALQGIDCSPIQPGGACFEPNTI  631
             C   G+DC  IQPGG CF+PNTI
Sbjct  389  VCG-TGVDCKLIQPGGNCFDPNTI  411



>gb|KFK27709.1| hypothetical protein AALP_AA8G419000, partial [Arabis alpina]
Length=441

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 132/204 (65%), Gaps = 6/204 (3%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            ETL F LF+PN G YD  SKI Y NMFDAQ+ +V +A++ +GF  VEI V E GWP +GD
Sbjct  196  ETLDFALFRPNHGLYDQQSKILYTNMFDAQIDSVYSAMDRLGFSDVEIVVGEIGWPSEGD  255

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
             +++G  VD A  +  N+V  + S +GTPLMP ++ +TY+FAL++E+LKPGPTSER+FG+
Sbjct  256  IDQIGVDVDTAAEFNKNIVDRVNSGIGTPLMPNRTFETYIFALFNENLKPGPTSERNFGI  315

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDY  559
            + +DLT  YD G+ + +      P+      PP    +   WCV K G     LQ N+DY
Sbjct  316  FRSDLTPVYDIGILRPTANPENNPR-----SPPVRGSSEKRWCVTKSGAETVDLQRNIDY  370

Query  560  ACALQGIDCSPIQPGGACFEPNTI  631
             C L G+DC PI+  G CF PNT+
Sbjct  371  VCGL-GLDCRPIKENGPCFLPNTV  393



>ref|XP_010230690.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brachypodium distachyon]
Length=433

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            QSDPRP+TLAFCLFQPN GR DAGS +TY +MFDAQ+ AVR AL+A G+K VE+ VAETG
Sbjct  209  QSDPRPDTLAFCLFQPNAGRPDAGSGLTYTSMFDAQVDAVRAALDAKGYKDVEVVVAETG  268

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WP+ G ++E G SV+NA+A+VGNLVSHLRSMVGTP MPGKSV+TYLFA+YDE+LKPG  S
Sbjct  269  WPHAGGADEAGASVENARAFVGNLVSHLRSMVGTPRMPGKSVETYLFAVYDENLKPGKPS  328

Query  362  ERSFGLYNTD-LTMTYDAGL  418
            E+SFGL+ T  L   Y  GL
Sbjct  329  EQSFGLFQTTALAEMYPTGL  348



>emb|CDP05033.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 131/208 (63%), Gaps = 5/208 (2%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            ETL + LF+PN G +D  +K TY NM D QL AV +AL  + F  +EI +AETGWP KGD
Sbjct  211  ETLDYALFRPNSGAFDDDTKFTYTNMLDGQLDAVFSALKLLDFSDLEIVIAETGWPSKGD  270

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            + +VG   D A  Y   L+ H+ S VGTPLMP ++ +TY+FAL++EDLKPGPT ER+FGL
Sbjct  271  AGQVGVDADTAAEYNRKLMQHVTSGVGTPLMPNRTFETYIFALFNEDLKPGPTCERNFGL  330

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGP----PASKKNSSWWCVPKGGVSDAQLQA  547
            +  D+T  YD G+ + + +        P   P    P     +  WC+PK G  +  LQ 
Sbjct  331  FQPDMTPVYDIGILRPTAKANFPSYPTPQAVPVNPSPIPASGAKRWCLPKTGAKEDTLQK  390

Query  548  NLDYACALQGIDCSPIQPGGACFEPNTI  631
            NLDY C L G+DC PIQ GGAC+ PNT+
Sbjct  391  NLDYVCGL-GMDCKPIQEGGACYLPNTV  417



>ref|XP_006280516.1| hypothetical protein CARUB_v10026453mg [Capsella rubella]
 gb|EOA13414.1| hypothetical protein CARUB_v10026453mg [Capsella rubella]
Length=429

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q D RPETLA+CLFQ N GR D  S + YMNMFDAQ+ AV +AL +MGFK VEI VAETG
Sbjct  208  QDDRRPETLAYCLFQTNPGRVDPNSNLKYMNMFDAQVDAVYSALRSMGFKDVEIMVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD  E G +V+NA+AY  NL++HL+S  GTPLMPG+ +DTYLFALYDE+LKPG  S
Sbjct  268  WPYKGDPEEGGATVENARAYNKNLIAHLKSGTGTPLMPGRVIDTYLFALYDENLKPGKGS  327

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  328  ERAFGLFKPDLTMTYDIGL  346



>ref|XP_010442129.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=435

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    QSDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETG  181
            Q D RPETLA+CLFQ   GR D  S + YMNMFDAQ+ AV +ALN+MGFK VEI VAETG
Sbjct  208  QEDRRPETLAYCLFQTYPGRVDPNSNLKYMNMFDAQVDAVYSALNSMGFKDVEIMVAETG  267

Query  182  WPYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTS  361
            WPYKGD  E G +V+NA+AY  NL++HL+S  GTPLMPGK ++TYLFALYDE+LKPG  S
Sbjct  268  WPYKGDPEEAGATVENARAYNKNLIAHLKSGSGTPLMPGKVIETYLFALYDENLKPGKGS  327

Query  362  ERSFGLYNTDLTMTYDAGL  418
            ER+FGL+  DLTMTYD GL
Sbjct  328  ERAFGLFKPDLTMTYDIGL  346



>gb|KHG22731.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=465

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 134/211 (64%), Gaps = 8/211 (4%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P+TL + LF+PN G  D  + + Y NM DAQL AV +A+  +GF  +EI +AETGWP  G
Sbjct  215  PDTLDYALFRPNAGVLDENTGLLYTNMLDAQLDAVFSAMKVLGFDDLEIVIAETGWPSMG  274

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            DS +VG   + A  Y GNL  H+ S  GTPLMP ++ +TY+FAL++EDLKPGPTSER+FG
Sbjct  275  DSPQVGVDANVASEYNGNLKRHVSSGAGTPLMPNRTFETYIFALFNEDLKPGPTSERNFG  334

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAPA--IGP----PASKKNSSWWCVPKGGVSDAQ  538
            L+  D+T  YD G+ + + ++       P   + P    P S K    WC+PK G  D  
Sbjct  335  LFQPDMTPVYDIGILRPTARSSIPNNPTPVPRVAPSNPTPRSSKRKQ-WCLPKTGADDNA  393

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            LQ N+DY C L G+DC PIQ  GACF PNT+
Sbjct  394  LQRNIDYVCGL-GLDCGPIQQHGACFLPNTV  423



>gb|KHG05533.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=443

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 136/202 (67%), Gaps = 8/202 (4%)
 Frame = +2

Query  26   LAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGDSN  205
            L + LF+PN G YD  SK  Y NMFD+ + +  TA+ A+G+  VEIA+ ETGWP +GD+ 
Sbjct  207  LNYALFKPNSGIYDKYSKKNYTNMFDSIMDSTYTAMKALGYGNVEIAIGETGWPTQGDAT  266

Query  206  EVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGLYN  385
                +++NA +Y G+++  + S  GTPLMP ++ +TY+FAL++E+ KPGP  E+ +G++N
Sbjct  267  SPFATMENAISYNGHVIKEIVSGKGTPLMPNRTFETYMFALFNENQKPGPLVEKYWGMFN  326

Query  386  TDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDYAC  565
             DLT  YD GL              PA   P+S KN   +CVPK  VS+ QLQ+NLDYAC
Sbjct  327  PDLTPIYDVGL-----LRRGQSAPTPATPAPSSSKN---FCVPKVDVSNTQLQSNLDYAC  378

Query  566  ALQGIDCSPIQPGGACFEPNTI  631
              +GIDC+PIQPGGAC+EPNT+
Sbjct  379  GQEGIDCTPIQPGGACYEPNTL  400



>gb|KJB37375.1| hypothetical protein B456_006G202300 [Gossypium raimondii]
Length=509

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 137/211 (65%), Gaps = 8/211 (4%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P+TL + LF+PN G  D  + + Y NM DAQL AV +A+  +GF  +EI +AETGWP  G
Sbjct  259  PDTLDYALFRPNAGVLDENTGLLYTNMLDAQLDAVFSAMKVLGFDDLEIVIAETGWPSMG  318

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            DS +VG   + A  Y GNL  H+ S  GTPLMP ++ +TY+FAL++EDLKPGPTSER+FG
Sbjct  319  DSTQVGVDANVASEYNGNLKRHVSSGAGTPLMPNRTFETYIFALFNEDLKPGPTSERNFG  378

Query  377  LYNTDLTMTYDAGLsksstqtpt------tpksAPAIGPPASKKNSSWWCVPKGGVSDAQ  538
            L+  D+T  YD G+ + + ++         P++AP+   P S K    WC+PK G  D  
Sbjct  379  LFQPDMTPVYDIGILRPTARSSIPNNPTPVPRAAPSNPTPRSSKGKQ-WCLPKTGADDNA  437

Query  539  LQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            LQ N+DY C L G+DC PIQ  GACF PNT+
Sbjct  438  LQRNIDYVCGL-GLDCGPIQQHGACFLPNTV  467



>gb|KJB53907.1| hypothetical protein B456_009G010800 [Gossypium raimondii]
Length=443

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 136/202 (67%), Gaps = 8/202 (4%)
 Frame = +2

Query  26   LAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGDSN  205
            L + LF+PN G YD  +K  Y NMFD+ L +  TA+ A+G+  VEIA+ ETGWP +GD+ 
Sbjct  207  LNYALFKPNSGIYDKYTKKNYTNMFDSILDSTYTAMKALGYGNVEIAIGETGWPTQGDAT  266

Query  206  EVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGLYN  385
                +++NA +Y G+++  + S  GTPLMP ++ +TY+FAL++E+ KPGP  E+ +G++N
Sbjct  267  SPFATMENAISYNGHVIKEIVSGKGTPLMPNRTFETYMFALFNENQKPGPLVEKYWGMFN  326

Query  386  TDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDYAC  565
             DLT  YD GL              PA   P+S KN   +CVPK  VS+ QLQ+NLDYAC
Sbjct  327  PDLTPIYDVGL-----LRRGQSAPTPATPAPSSSKN---FCVPKVDVSNTQLQSNLDYAC  378

Query  566  ALQGIDCSPIQPGGACFEPNTI  631
              +GIDC+PIQPGGAC+EPNT+
Sbjct  379  GQEGIDCTPIQPGGACYEPNTL  400



>ref|XP_007039107.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY23608.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=482

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 135/209 (65%), Gaps = 5/209 (2%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P+TL + LF+PN G +D  +++ Y NM DAQL AV +A+  +GF  +EI +AETGWP  G
Sbjct  233  PDTLDYALFRPNAGVFDENTELHYTNMLDAQLDAVFSAMKFVGFDDLEIVIAETGWPSMG  292

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            DS +VG   ++A  Y GNL+ H+ S  GTPLMP ++ +TY+FAL++E+LKPGPT ER+FG
Sbjct  293  DSTQVGVDAESAAEYNGNLMRHVASGAGTPLMPNRTFETYIFALFNENLKPGPTCERNFG  352

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAP----AIGPPASKKNSSWWCVPKGGVSDAQLQ  544
            L+  D+T  YD G+ + + ++       P    A   P  +     WC+PK G  +  LQ
Sbjct  353  LFQPDMTPVYDVGILRPTARSSIPNNPTPVPTAAPVNPTPRSEGKQWCLPKTGADENALQ  412

Query  545  ANLDYACALQGIDCSPIQPGGACFEPNTI  631
             N+DY C L G+DC PIQ  GACF PNT+
Sbjct  413  RNIDYVCGL-GLDCGPIQEDGACFLPNTV  440



>ref|XP_004505326.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Cicer 
arietinum]
Length=495

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 141/210 (67%), Gaps = 8/210 (4%)
 Frame = +2

Query  8    DP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            DP RPETL + LF+PNGG +D  + + Y NMFDAQ+ AV TA+  +G+  VE+ VAETGW
Sbjct  205  DPTRPETLNYALFKPNGGVFDKMTGLNYTNMFDAQMDAVFTAMKKLGYDDVELVVAETGW  264

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P  GD N+ G  ++NA +Y GNL+ H+ S  GTPLMP ++ +TY+F+L++E+LKP   SE
Sbjct  265  PSAGDPNQPGVGIENAVSYNGNLIKHVNSGKGTPLMPNRTFETYIFSLFNENLKPT-VSE  323

Query  365  RSFGLYNTDLTMTYDAGLsksstqtpttpksAP-AIGPPASKKNSSWWCVPKGGVSDAQL  541
            R++GL+  +L   YD G+          P S P A+ P  SKK    WCVPK   S+  L
Sbjct  324  RNYGLFKPNLAPVYDVGVFTQQVPQAMGPASGPTAMVPLGSKK----WCVPKANASEKAL  379

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QAN+DY C+ +GI+C PI+ GG CF+PNT+
Sbjct  380  QANIDYVCS-RGINCGPIKDGGPCFKPNTL  408



>ref|XP_010940752.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=462

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 136/204 (67%), Gaps = 5/204 (2%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+ N G  D  + +TY NM DAQL A+ +A+  MGF  V+I VAETGWP  GD
Sbjct  218  DTLDYALFRLNSGVVDDNTGLTYTNMLDAQLDAIFSAMKLMGFTDVDIVVAETGWPSMGD  277

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            + EVG  +D+A+ Y  NL+ H+ S +GTPLMP ++ +TY+F+L++EDLKPGP SER+FGL
Sbjct  278  AGEVGVDMDSARDYNKNLMRHVASGMGTPLMPNRTFETYIFSLFNEDLKPGPMSERNFGL  337

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGP-PASKKNSSWWCVPKGGVSDAQLQANLD  556
            ++ ++   YD G+  +  +    P   PA  P P+  K    WCVPK       LQ N++
Sbjct  338  FHPNMMPVYDIGILTTEVRKQVNPVVTPANIPMPSDVKR---WCVPKPNADVMALQENIE  394

Query  557  YACALQGIDCSPIQPGGACFEPNT  628
            Y CA QGIDC+PIQPGGAC+ PNT
Sbjct  395  YGCA-QGIDCNPIQPGGACYHPNT  417



>ref|XP_010922329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=447

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 134/205 (65%), Gaps = 9/205 (4%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P TL + LF+PN G +D  +KI Y NMFDAQL AV TA+  +G+  VEIAV ETGWP   
Sbjct  208  PRTLNYALFKPNRGVFDPVTKINYTNMFDAQLDAVYTAMKKLGYGDVEIAVGETGWPTAA  267

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            +  + G SV++A  + GNL+ ++ S  GTPLMP +  +TY+FAL++E+LKPGP +ER++G
Sbjct  268  EPGQAGVSVEDAATFNGNLIRNVNSGEGTPLMPHRMFETYIFALFNENLKPGPIAERNWG  327

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLD  556
            L+  DLT  Y+ GL K+ +        AP+            WCVPK   SDA LQAN++
Sbjct  328  LFRPDLTPVYNVGLMKTPSGGGGGATPAPS---------GRKWCVPKSDASDAALQANIN  378

Query  557  YACALQGIDCSPIQPGGACFEPNTI  631
            YAC+   +DC PIQ GGACF PN++
Sbjct  379  YACSSGIVDCKPIQEGGACFLPNSL  403



>ref|XP_006491986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
 gb|KDO59627.1| hypothetical protein CISIN_1g043079mg [Citrus sinensis]
Length=460

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 131/206 (64%), Gaps = 2/206 (1%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            PETL + LF+PN G +D  +KI Y NM D QL AV +A+  +GF  VEI +AETGWP KG
Sbjct  214  PETLDYALFRPNSGVFDENTKIVYTNMLDGQLDAVFSAMKLLGFDDVEIVIAETGWPSKG  273

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            DS++VG    +A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++EDLK GPT ER+FG
Sbjct  274  DSSQVGVDSQSAADYNMNLMRHVTSGNGTPLMPNRTFETYIFALFNEDLKQGPTCERNFG  333

Query  377  LYNTDLTMTYDAG-LsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANL  553
            L++ ++T  YD G L  ++  +  T    P +  P        WCVPK G     LQ N+
Sbjct  334  LFHPNMTPVYDVGILRSTARSSIPTSNPTPKVETPQRAPEGKRWCVPKTGADIEALQRNI  393

Query  554  DYACALQGIDCSPIQPGGACFEPNTI  631
            DY C + G +C  IQ GG+CF PNT+
Sbjct  394  DYVCGM-GFNCEAIQEGGSCFLPNTV  418



>ref|XP_004505325.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Cicer 
arietinum]
Length=492

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 139/210 (66%), Gaps = 11/210 (5%)
 Frame = +2

Query  8    DP-RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            DP RPETL + LF+PNGG +D  + + Y NMFDAQ+ AV TA+  +G+  VE+ VAETGW
Sbjct  205  DPTRPETLNYALFKPNGGVFDKMTGLNYTNMFDAQMDAVFTAMKKLGYDDVELVVAETGW  264

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P  GD N+ G  ++NA +Y GNL+ H+ S  GTPLMP ++ +TY+F+L++E+LKP   SE
Sbjct  265  PSAGDPNQPGVGIENAVSYNGNLIKHVNSGKGTPLMPNRTFETYIFSLFNENLKPT-VSE  323

Query  365  RSFGLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKK-NSSWWCVPKGGVSDAQL  541
            R++GL+  +L   YD G+        T     PA GP A     S  WCVPK   S+  L
Sbjct  324  RNYGLFKPNLAPVYDVGV-------FTQQAMGPASGPTAMVPLGSKKWCVPKANASEKAL  376

Query  542  QANLDYACALQGIDCSPIQPGGACFEPNTI  631
            QAN+DY C+ +GI+C PI+ GG CF+PNT+
Sbjct  377  QANIDYVCS-RGINCGPIKDGGPCFKPNTL  405



>ref|NP_001051111.1| Os03g0722500 [Oryza sativa Japonica Group]
 gb|AAX95694.1| Glycosyl hydrolases family 17, putative [Oryza sativa Japonica 
Group]
 gb|ABF98599.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF98600.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13025.1| Os03g0722500 [Oryza sativa Japonica Group]
 gb|EAY91695.1| hypothetical protein OsI_13336 [Oryza sativa Indica Group]
 dbj|BAG94451.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +2

Query  5    SDPRPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGW  184
            SDPRPETLAFCLFQPN GR DAGS +TY NMFDAQ+ AVR AL+A G+K VEI VAETGW
Sbjct  208  SDPRPETLAFCLFQPNAGRPDAGSGLTYTNMFDAQVDAVRAALDAKGYKDVEIVVAETGW  267

Query  185  PYKGDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSE  364
            P+ G ++E G +V NA+A+V  LVSHLRSM GTP  PGK VDTYLFA+YDEDLKPG  SE
Sbjct  268  PHSGGADEAGATVGNARAFVSGLVSHLRSMAGTPRAPGKPVDTYLFAVYDEDLKPGKPSE  327

Query  365  RSFGLYN-TDLTMTYDAGL  418
            +SFGL+  T L  TY  GL
Sbjct  328  KSFGLFQTTTLAETYPTGL  346



>ref|XP_002532848.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF29526.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=488

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 138/209 (66%), Gaps = 15/209 (7%)
 Frame = +2

Query  14   RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYK  193
            R ETL + LF+PNGG +D+ +   Y NMFDAQL AV +A+  +G++ V+I VAETGWP  
Sbjct  206  RSETLNYALFKPNGGVFDSATGKNYTNMFDAQLDAVFSAMKRLGYEDVDIVVAETGWPSA  265

Query  194  GDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSF  373
            GD N+ G S++NA +Y GNLV H+ S +GTPLMP ++ +TYLFAL++E+LKP   SE++F
Sbjct  266  GDPNQPGVSLENALSYNGNLVKHVNSGIGTPLMPNRTFETYLFALFNENLKPT-VSEQNF  324

Query  374  GLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSW---WCVPKGGVSDAQLQ  544
            GL+  D T  YD G+ ++            A GP A   +SS    WCVPK   S+  LQ
Sbjct  325  GLFKPDFTPVYDVGVLRNPR----------AKGPTAPAPSSSQGKKWCVPKSDASEDALQ  374

Query  545  ANLDYACALQGIDCSPIQPGGACFEPNTI  631
             N+DY C+  G+DC  IQ GG CF+PNT+
Sbjct  375  KNIDYVCS-TGVDCRAIQAGGPCFDPNTV  402



>ref|XP_010264453.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=454

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 138/206 (67%), Gaps = 14/206 (7%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+PN G +D  + ITY NMFDAQ+ AV +A+  +G+  V+I VAETGWP  GD
Sbjct  217  KTLNYALFKPNPGIHDNFTGITYTNMFDAQMDAVYSAMKRLGYGDVDIVVAETGWPSLGD  276

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            +N+   +++NA +Y GNL+ H+ +  GTPLMP ++ +TY+F+L++E+LKPG T+ER+FGL
Sbjct  277  TNQPDVNLENAISYNGNLIKHVNTGKGTPLMPNRNFETYIFSLFNENLKPGSTAERNFGL  336

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSS--WWCVPKGGVSDAQLQANL  553
            +  DLT  Y+ G+ +  +            GP  +  + S   WCVPK   SD  LQAN+
Sbjct  337  FRPDLTPVYNVGIMRGQSG-----------GPTPTTPSGSGKKWCVPKADASDGALQANI  385

Query  554  DYACALQGIDCSPIQPGGACFEPNTI  631
            DY C+L G+DC PIQ GG CF PNTI
Sbjct  386  DYVCSL-GVDCRPIQAGGDCFNPNTI  410



>ref|XP_006441150.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
 gb|ESR54390.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
Length=460

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 130/206 (63%), Gaps = 2/206 (1%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            PETL + LF+PN G +D  +KI Y NM D QL AV +A+  +GF  VEI +AETGWP KG
Sbjct  214  PETLDYALFRPNSGVFDENTKIVYTNMLDGQLDAVFSAMKLLGFDDVEIVIAETGWPSKG  273

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            DS++VG    +A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++EDLK GPT ER+FG
Sbjct  274  DSSQVGVDSQSAADYNMNLMRHVTSCNGTPLMPNRTFETYIFALFNEDLKQGPTCERNFG  333

Query  377  LYNTDLTMTYDAG-LsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANL  553
            L++ ++T  YD G L  ++  +  T    P +  P        WCVPK       LQ N+
Sbjct  334  LFHPNMTPVYDVGILRSTARSSIPTSNPTPKVETPQRAPEGKRWCVPKTRADIEALQRNI  393

Query  554  DYACALQGIDCSPIQPGGACFEPNTI  631
            DY C + G +C  IQ GG+CF PNT+
Sbjct  394  DYVCGM-GFNCEAIQEGGSCFLPNTV  418



>dbj|BAF02203.1| hypothetical protein [Arabidopsis thaliana]
Length=251

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 131/206 (64%), Gaps = 8/206 (4%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            ETL F LF+PN G +D  +K+ Y NM DAQL +V +A++ +GF  VEI   E GWP +GD
Sbjct  7    ETLDFALFRPNPGLFDQHTKLLYTNMLDAQLDSVYSAMDKLGFSDVEIVTGEIGWPSEGD  66

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
             +++G  VD A  +  NL++ + S  GTPLMP ++ +TY+FAL++E+LK GPTSER+FG+
Sbjct  67   IDQIGVDVDTAAEFNKNLIARVDSGTGTPLMPNRTFETYIFALFNENLKSGPTSERNFGI  126

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGP--PASKKNSSWWCVPKGGVSDAQLQANL  553
            + +DLT  YD G+ + + ++       P   P  P    +S  WCV K G     LQ N+
Sbjct  127  FRSDLTPIYDIGILRPTFRSSD-----PVYNPRSPVRGSSSKRWCVTKAGAETVALQRNI  181

Query  554  DYACALQGIDCSPIQPGGACFEPNTI  631
            DY C L G+DC PI  GG C+ PNT+
Sbjct  182  DYVCGL-GLDCRPINEGGLCYLPNTV  206



>ref|XP_002526252.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36121.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=476

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 131/217 (60%), Gaps = 12/217 (6%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P+TL + LF+PN G  D  +K+ Y NM D QL AV +A+  +GF  ++I +AETGWP KG
Sbjct  214  PDTLDYALFRPNAGVMDDNTKLMYTNMLDGQLDAVFSAIKLLGFTDIDIVIAETGWPSKG  273

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            DS ++G   D+A  Y GNL+ H+ S  GTPLMP ++ +TY+FAL++E+LKPGPT ER+FG
Sbjct  274  DSLQLGVDADSAAHYNGNLMKHVTSGSGTPLMPNRTFETYIFALFNENLKPGPTCERNFG  333

Query  377  LYNTDLTMTYDAGLsksstqtpttpksA-----------PAIGPPASKK-NSSWWCVPKG  520
            L+  D+T  YD G+ + +       + A           P + PPAS       WC+PK 
Sbjct  334  LFQPDMTPVYDIGILRPTVAAAANNQHASSSIPKNPTPVPMVAPPASSDPEGKRWCLPKT  393

Query  521  GVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            G     LQ N+DY C L    C PIQ  G CF PNT+
Sbjct  394  GADTEALQRNIDYVCGLGAEYCEPIQDNGKCFLPNTV  430



>emb|CDP21469.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 133/204 (65%), Gaps = 9/204 (4%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+PN G +D  + + Y NMFDAQ+ AV +A+  +G+  V+I VAETGWP  GD
Sbjct  220  KTLDYALFKPNDGIFDNVTGVNYTNMFDAQMDAVFSAMKRLGYDDVDIVVAETGWPSAGD  279

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
             N+ G S+DNA +Y  NLV H+ S +GTPLMP ++ DTY+F+L++EDLKPG  SE++FGL
Sbjct  280  PNQPGVSLDNAISYNANLVRHVNSGLGTPLMPNRTFDTYIFSLFNEDLKPG-ISEQNFGL  338

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDY  559
            +  D +  YD G+              PA   PA+  +   WCVPK   SD  LQ+N+DY
Sbjct  339  FRPDFSPVYDVGI------LRNQQGVGPAPVTPAAPDDKK-WCVPKDDASDGALQSNIDY  391

Query  560  ACALQGIDCSPIQPGGACFEPNTI  631
             C   G+DC PIQ GG CFEPNT+
Sbjct  392  VCG-SGVDCQPIQNGGPCFEPNTV  414



>gb|KDO69312.1| hypothetical protein CISIN_1g0384522mg, partial [Citrus sinensis]
Length=382

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 129/200 (65%), Gaps = 10/200 (5%)
 Frame = +2

Query  32   FCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGDSNEV  211
            + LF+PN G YD  ++ITY NMFDAQ+ AV +A+ A+G+  V I VAETGWP  GD  E 
Sbjct  149  YILFKPNKGVYDPNTRITYSNMFDAQMDAVYSAMRALGYSDVPIVVAETGWPSAGDPRES  208

Query  212  GPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGLYNTD  391
              +VDNA ++  NL+  + S  GTPLMP K  +TY+FAL++E+ KPG TSER+FGL+  D
Sbjct  209  SATVDNAASFNWNLIQKVNSGKGTPLMPNKQFETYIFALFNENKKPGATSERNFGLFKQD  268

Query  392  LTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDYACAL  571
             T  YDAG+             A A   P  +     +CVP+   +   LQ NLD+ C+ 
Sbjct  269  FTPVYDAGV---------MLNGAGAKTQPQPQPTDKKFCVPRPNTNPQSLQGNLDWVCS-  318

Query  572  QGIDCSPIQPGGACFEPNTI  631
            QGIDC+PIQPGG+CFEPNT+
Sbjct  319  QGIDCAPIQPGGSCFEPNTL  338



>ref|XP_002318439.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
 gb|EEE96659.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
Length=460

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 131/204 (64%), Gaps = 1/204 (0%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+PN G +D  +K++Y NM D QL AV +A+  +GF  +EI +AETGWP +G+
Sbjct  216  DTLDYALFRPNSGVFDENTKLSYTNMLDGQLDAVFSAMKLLGFSDIEIVIAETGWPSQGE  275

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            S+++G   ++A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++EDLKPGP SER+FGL
Sbjct  276  SSQLGVDAESAAQYNRNLMQHVTSGAGTPLMPNRTFETYIFALFNEDLKPGPPSERNFGL  335

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDY  559
            +  D+T  Y+ G+ +   ++      AP    P   K    WC+PK G     LQ N+DY
Sbjct  336  FQPDMTPVYNIGILRPKAKSSIPTSPAPVSPGPGGPK-EKIWCLPKPGADVEALQRNIDY  394

Query  560  ACALQGIDCSPIQPGGACFEPNTI  631
             C L+   C PIQ GG CF PNT+
Sbjct  395  VCGLEAEYCKPIQEGGECFMPNTV  418



>ref|XP_006846179.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
 gb|ERN07854.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
Length=481

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 141/227 (62%), Gaps = 22/227 (10%)
 Frame = +2

Query  14   RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYK  193
            +P+TL + LF+PN G++D  +   Y NMFDAQ+ A+ +A   +GF  V++ VAETGWP  
Sbjct  212  KPDTLDYALFKPNPGKFDPVTGKNYTNMFDAQMDAIYSAAKKLGFDDVDMVVAETGWPSI  271

Query  194  GDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSF  373
            GD NE   ++ NA +Y GNL+ H+ S VGTP+MP K  +TY+F+L++E+LKPG T+ER+F
Sbjct  272  GDPNEPAVNMANAVSYNGNLIRHVSSWVGTPMMPRKKFETYIFSLFNENLKPGSTAERNF  331

Query  374  GLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKK---------------------  490
            GL+  DLT  YD G+ K  +  PT    +P    P +                       
Sbjct  332  GLFKADLTPVYDVGVMKGQSGAPTPANPSPVTPAPTNPSPVNPAPQLPSPAPENPAPGAP  391

Query  491  NSSWWCVPKGGVSDAQLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
            +   WCVPK  V D +LQAN+DY C+ QG+DC+PIQ GGAC+ P+T+
Sbjct  392  SEKLWCVPKPEVEDVKLQANIDYVCS-QGVDCTPIQAGGACYLPDTL  437



>ref|XP_002530862.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31536.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=447

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 134/205 (65%), Gaps = 11/205 (5%)
 Frame = +2

Query  17   PETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKG  196
            P+   + LF+PN G +D  + ITY NMFDA + AV +A+ AMG+  V+I VAETGWP  G
Sbjct  210  PKVDKYILFKPNRGIHDRYTNITYTNMFDAMMDAVYSAIKAMGYPDVDILVAETGWPSLG  269

Query  197  DSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFG  376
            D N+   +V+NA AY GNL+ H+ S  GTPLMP +  +TY+FAL++E+LKPG T+ER++G
Sbjct  270  DPNQPACTVENAVAYNGNLIKHVTSGKGTPLMPNRRFETYIFALFNENLKPGSTAERNWG  329

Query  377  LYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLD  556
            L+  D +  Y+ G+ ++       P           KK    WCVPK   +D QLQAN+D
Sbjct  330  LFRPDFSPVYNVGVLRNEQTNTPNPNPT------TGKK----WCVPKAEANDQQLQANID  379

Query  557  YACALQGIDCSPIQPGGACFEPNTI  631
            Y C+ QG+DC PIQ GGACF+PN I
Sbjct  380  YVCS-QGVDCKPIQAGGACFDPNNI  403



>ref|XP_004151673.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 ref|XP_004168987.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 gb|KGN65723.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=489

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 135/212 (64%), Gaps = 18/212 (8%)
 Frame = +2

Query  14   RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYK  193
            RP TL + LF+PN G +D  +   Y NMFDAQL AV +A+  +G+  V+I VAETGWP  
Sbjct  205  RPATLDYALFKPNPGVFDNATGKHYTNMFDAQLDAVYSAMKKVGYGDVDIVVAETGWPSA  264

Query  194  GDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSF  373
            GD N+ G S++NA +Y  NLV H+ S  GTPLMP ++ +TY+F+L++E+LKP  TSER++
Sbjct  265  GDPNQAGVSMENAISYNRNLVKHVNSGKGTPLMPNRTFETYIFSLFNENLKPS-TSERNY  323

Query  374  GLYNTDLTMTYDAGLsksstqtpttpksAPAIGP------PASKKNSSWWCVPKGGVSDA  535
            GL+  D T  YD G+           ++ PA+GP      P        WCVPK   SD 
Sbjct  324  GLFQPDFTPVYDVGI----------LQNPPAMGPTSPVGGPKPSDEEREWCVPKTDASDE  373

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
             LQ N+DY C+  G+DC PIQ GGAC++PNT+
Sbjct  374  ALQKNIDYVCS-SGVDCGPIQEGGACYDPNTV  404



>ref|XP_011025078.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=491

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 130/204 (64%), Gaps = 1/204 (0%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+PN G  D  +K++Y NM D QL AV +A+  +GF  +EI +AETGWP +G+
Sbjct  247  DTLDYALFKPNSGVLDENTKLSYTNMLDGQLDAVFSAMKLLGFSDIEIVIAETGWPSQGE  306

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            S+++G   ++A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++EDLKPGP SER+FGL
Sbjct  307  SSQLGVDAESAAHYNRNLMQHVTSGAGTPLMPNRTFETYIFALFNEDLKPGPPSERNFGL  366

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDY  559
            +  D+T  YD G+ +   ++      AP    P   K    WC+PK G     LQ N+DY
Sbjct  367  FQPDMTPVYDIGILRPKAKSSIPTNPAPVSPGPGGPK-EKIWCLPKTGADVEALQRNIDY  425

Query  560  ACALQGIDCSPIQPGGACFEPNTI  631
             C L+   C PIQ GG CF PNT+
Sbjct  426  VCGLKAEYCKPIQEGGECFLPNTV  449



>ref|XP_008778544.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=455

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 136/203 (67%), Gaps = 11/203 (5%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+ N G  D  + +TY NM DAQL A+ +A+  +GF  VEI VAETGWP  GD
Sbjct  219  DTLDYALFRLNSGVVDDNTGLTYTNMLDAQLDAIFSAMKLLGFTDVEIVVAETGWPSMGD  278

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            + EVG  +D+A+ Y  NLV H  S +GTPLMP ++ DTY+F+L++E+LKPGPTSER+FGL
Sbjct  279  AWEVGADMDSARDYNKNLVRHAASGIGTPLMPNRTFDTYIFSLFNENLKPGPTSERNFGL  338

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSSWWCVPKGGVSDAQLQANLDY  559
            +  ++T  YD G+ ++  +          + P AS  ++  WCVPK       LQ N++Y
Sbjct  339  FYPNMTPVYDIGILRTEAREQ--------VKPMAS--DAKRWCVPKPNADVMSLQENIEY  388

Query  560  ACALQGIDCSPIQPGGACFEPNT  628
             CA QGIDC+PI+PGGAC+ P+T
Sbjct  389  VCA-QGIDCNPIRPGGACYRPDT  410



>ref|XP_007016411.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY34030.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=497

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 135/209 (65%), Gaps = 11/209 (5%)
 Frame = +2

Query  14   RPETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYK  193
            +P+TL + LF+PN G +DA + I Y NMFDAQL AV +AL  +G+  VEI VAETGWP  
Sbjct  211  KPQTLNYALFKPNAGVFDAVTGINYTNMFDAQLDAVYSALKRVGYGDVEIVVAETGWPSV  270

Query  194  GDSNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSF  373
            GD  + G S++NA ++ GNLV H+ S  GTPLMP ++ +TY+F+L++E+LK    SER+F
Sbjct  271  GDPGQPGVSLENALSFNGNLVKHVNSGKGTPLMPNRTFETYIFSLFNENLKES-VSERNF  329

Query  374  GLYNTDLTMTYDAGLsksstqtpttpksAPAIGPPASKKNSS---WWCVPKGGVSDAQLQ  544
            GL+  DLT  Y+ G+              PA  PP +   SS    WCVPK   + A LQ
Sbjct  330  GLFKPDLTPVYNVGV------LRNEQGLGPASAPPTATAPSSGSGKWCVPKSDATVAALQ  383

Query  545  ANLDYACALQGIDCSPIQPGGACFEPNTI  631
            AN+DY C+  G+DC PIQ GGACF PN +
Sbjct  384  ANIDYVCS-TGLDCRPIQAGGACFNPNNV  411



>ref|XP_010048931.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW89128.1| hypothetical protein EUGRSUZ_A01445 [Eucalyptus grandis]
Length=476

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 133/212 (63%), Gaps = 9/212 (4%)
 Frame = +2

Query  20   ETLAFCLFQPNGGRYDAGSKITYMNMFDAQLGAVRTALNAMGFKGVEIAVAETGWPYKGD  199
            +TL + LF+PN G  D  SK+ Y NM D QL AV +A+  +GF  +EI +AETGWP   D
Sbjct  222  DTLDYALFRPNAGVMDENSKLVYTNMLDGQLDAVYSAMKVLGFTDIEIVIAETGWPSLCD  281

Query  200  SNEVGPSVDNAKAYVGNLVSHLRSMVGTPLMPGKSVDTYLFALYDEDLKPGPTSERSFGL  379
            S +VG     A  Y  NL+ H+ S  GTPLMP ++ +TY+FAL++E+LKPGPT ER+FGL
Sbjct  282  STQVGVDAKTAAEYNSNLIRHVSSGAGTPLMPKRTFETYIFALFNENLKPGPTCERNFGL  341

Query  380  YNTDLTMTYDAGLsksstqtpttpksAPA---IGPPASKKNSS-----WWCVPKGGVSDA  535
            +  D+T  YDAG+ + + ++       PA   + PP S  + S      WC+PK G    
Sbjct  342  FRPDMTPVYDAGILRPTARSSVPIDPIPAPSSVTPPTSPVSMSPPKGTQWCLPKTGADPD  401

Query  536  QLQANLDYACALQGIDCSPIQPGGACFEPNTI  631
             LQ N+DY C L G++C PI+ GGACF PNT+
Sbjct  402  ALQRNIDYVCGL-GLECRPIEEGGACFLPNTV  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125