BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017F03 597 bp,

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621993.1|  PREDICTED: uncharacterized protein LOC104113...    130   9e-40   Nicotiana tomentosiformis
ref|XP_009621994.1|  PREDICTED: uncharacterized protein LOC104113...    130   9e-40   Nicotiana tomentosiformis
ref|XP_009621995.1|  PREDICTED: uncharacterized protein LOC104113...    130   9e-40   Nicotiana tomentosiformis
ref|XP_009621987.1|  PREDICTED: uncharacterized protein LOC104113...    130   1e-39   Nicotiana tomentosiformis
ref|XP_006356783.1|  PREDICTED: chromatin modification-related pr...    127   2e-39   Solanum tuberosum [potatoes]
ref|XP_009791551.1|  PREDICTED: uncharacterized protein LOC104238...    129   5e-39   Nicotiana sylvestris
ref|XP_009791548.1|  PREDICTED: uncharacterized protein LOC104238...    129   5e-39   Nicotiana sylvestris
ref|XP_009791552.1|  PREDICTED: uncharacterized protein LOC104238...    129   5e-39   Nicotiana sylvestris
ref|XP_009791553.1|  PREDICTED: uncharacterized protein LOC104238...    129   6e-39   Nicotiana sylvestris
ref|XP_010326298.1|  PREDICTED: uncharacterized protein LOC101265...    124   1e-38   Solanum lycopersicum
ref|XP_004247290.1|  PREDICTED: uncharacterized protein LOC101265...    124   1e-38   Solanum lycopersicum
emb|CDP03881.1|  unnamed protein product                                133   2e-38   Coffea canephora [robusta coffee]
ref|XP_011089090.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   4e-34   Sesamum indicum [beniseed]
ref|XP_009792431.1|  PREDICTED: uncharacterized protein LOC104239...    113   6e-34   Nicotiana sylvestris
ref|XP_009792429.1|  PREDICTED: uncharacterized protein LOC104239...    113   6e-34   Nicotiana sylvestris
ref|XP_009608002.1|  PREDICTED: uncharacterized protein LOC104102...    118   1e-33   Nicotiana tomentosiformis
ref|XP_009608000.1|  PREDICTED: uncharacterized protein LOC104102...    118   1e-33   Nicotiana tomentosiformis
ref|XP_004242539.1|  PREDICTED: uncharacterized protein LOC101263128    114   9e-33   Solanum lycopersicum
ref|XP_007049768.1|  Helicase/SANT-associated, putative isoform 5       111   9e-33   Theobroma cacao [chocolate]
ref|XP_007049765.1|  Helicase/SANT-associated, putative isoform 2       110   9e-33   Theobroma cacao [chocolate]
ref|XP_007049764.1|  Helicase/SANT-associated, putative isoform 1       110   1e-32   Theobroma cacao [chocolate]
ref|XP_007049767.1|  Helicase/SANT-associated, putative isoform 4       110   1e-32   Theobroma cacao [chocolate]
ref|XP_006479271.1|  PREDICTED: uncharacterized protein LOC102614...    110   2e-32   Citrus sinensis [Valencia orange]
ref|XP_006479273.1|  PREDICTED: uncharacterized protein LOC102614...    110   2e-32   Citrus sinensis [Valencia orange]
gb|KDO65937.1|  hypothetical protein CISIN_1g000147mg                   110   2e-32   Citrus sinensis [Valencia orange]
gb|KDO65939.1|  hypothetical protein CISIN_1g000147mg                   110   2e-32   Citrus sinensis [Valencia orange]
gb|KDO65938.1|  hypothetical protein CISIN_1g000147mg                   110   2e-32   Citrus sinensis [Valencia orange]
ref|XP_006443596.1|  hypothetical protein CICLE_v10018446mg             110   2e-32   Citrus clementina
ref|XP_011089681.1|  PREDICTED: uncharacterized protein LOC105170...    106   1e-31   Sesamum indicum [beniseed]
ref|XP_011089680.1|  PREDICTED: uncharacterized protein LOC105170...    106   1e-31   Sesamum indicum [beniseed]
ref|XP_011089675.1|  PREDICTED: uncharacterized protein LOC105170...    106   1e-31   Sesamum indicum [beniseed]
ref|XP_006352690.1|  PREDICTED: uncharacterized protein LOC102597970    110   3e-31   Solanum tuberosum [potatoes]
ref|XP_009371681.1|  PREDICTED: uncharacterized protein LOC103960...    103   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_009371723.1|  PREDICTED: uncharacterized protein LOC103960...    103   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_009371717.1|  PREDICTED: uncharacterized protein LOC103960...    103   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_011458181.1|  PREDICTED: uncharacterized protein LOC101292...    100   7e-31   Fragaria vesca subsp. vesca
ref|XP_011458178.1|  PREDICTED: uncharacterized protein LOC101292...    100   8e-31   Fragaria vesca subsp. vesca
ref|XP_011458180.1|  PREDICTED: uncharacterized protein LOC101292...    100   8e-31   Fragaria vesca subsp. vesca
ref|XP_007199670.1|  hypothetical protein PRUPE_ppa000065mg             103   2e-30   Prunus persica
ref|XP_003548677.1|  PREDICTED: uncharacterized protein LOC100811365    106   2e-30   
gb|KHN13171.1|  E1A-binding protein p400                                106   2e-30   Glycine soja [wild soybean]
ref|XP_008235469.1|  PREDICTED: uncharacterized protein LOC103334305    101   4e-30   Prunus mume [ume]
ref|XP_010110064.1|  CAG repeat protein 32                            99.0    8e-30   Morus notabilis
gb|KEH22730.1|  helicase/SANT-associated, DNA-binding protein, pu...    102   9e-30   Medicago truncatula
ref|XP_004514270.1|  PREDICTED: uncharacterized protein LOC101508...    102   2e-29   Cicer arietinum [garbanzo]
ref|XP_006576615.1|  PREDICTED: uncharacterized protein LOC100814...    104   2e-29   Glycine max [soybeans]
ref|XP_006576611.1|  PREDICTED: uncharacterized protein LOC100814...    104   2e-29   Glycine max [soybeans]
gb|KHN43848.1|  E1A-binding protein p400                                104   2e-29   Glycine soja [wild soybean]
ref|XP_008372484.1|  PREDICTED: uncharacterized protein LOC103435...  96.7    4e-29   
ref|XP_008372481.1|  PREDICTED: uncharacterized protein LOC103435...  96.7    4e-29   
ref|XP_008372479.1|  PREDICTED: uncharacterized protein LOC103435...  96.7    4e-29   
ref|XP_008372483.1|  PREDICTED: uncharacterized protein LOC103435...  96.7    4e-29   
ref|XP_008372482.1|  PREDICTED: uncharacterized protein LOC103435...  96.7    4e-29   Malus domestica [apple tree]
ref|XP_002521085.1|  DNA binding protein, putative                      100   5e-29   Ricinus communis
emb|CAN78796.1|  hypothetical protein VITISV_008076                     101   6e-29   Vitis vinifera
ref|XP_007140609.1|  hypothetical protein PHAVU_008G126600g           99.8    9e-29   Phaseolus vulgaris [French bean]
ref|XP_007140610.1|  hypothetical protein PHAVU_008G126600g           99.8    9e-29   Phaseolus vulgaris [French bean]
ref|XP_007140611.1|  hypothetical protein PHAVU_008G126600g           99.8    9e-29   Phaseolus vulgaris [French bean]
ref|XP_007140608.1|  hypothetical protein PHAVU_008G126600g           99.8    9e-29   Phaseolus vulgaris [French bean]
ref|XP_002269196.2|  PREDICTED: uncharacterized protein LOC100267...    102   2e-28   Vitis vinifera
ref|XP_010652522.1|  PREDICTED: uncharacterized protein LOC100267...    102   2e-28   Vitis vinifera
gb|KJB38946.1|  hypothetical protein B456_007G155000                  99.8    2e-28   Gossypium raimondii
gb|KJB38938.1|  hypothetical protein B456_007G155000                  99.8    2e-28   Gossypium raimondii
emb|CBI37340.3|  unnamed protein product                                101   2e-28   Vitis vinifera
gb|KJB38935.1|  hypothetical protein B456_007G155000                  99.8    2e-28   Gossypium raimondii
gb|KJB38942.1|  hypothetical protein B456_007G155000                  99.8    2e-28   Gossypium raimondii
gb|KJB38936.1|  hypothetical protein B456_007G155000                  99.4    2e-28   Gossypium raimondii
gb|KJB38948.1|  hypothetical protein B456_007G155000                  99.4    2e-28   Gossypium raimondii
gb|KJB38949.1|  hypothetical protein B456_007G155000                  99.8    2e-28   Gossypium raimondii
gb|KJB38939.1|  hypothetical protein B456_007G155000                  99.4    2e-28   Gossypium raimondii
gb|KHF97607.1|  Helicase SRCAP                                        99.4    3e-28   Gossypium arboreum [tree cotton]
gb|KJB10960.1|  hypothetical protein B456_001G233800                  99.8    3e-28   Gossypium raimondii
gb|KJB10958.1|  hypothetical protein B456_001G233800                  99.8    3e-28   Gossypium raimondii
gb|KJB10957.1|  hypothetical protein B456_001G233800                  99.8    3e-28   Gossypium raimondii
gb|KJB10954.1|  hypothetical protein B456_001G233800                  99.8    4e-28   Gossypium raimondii
gb|KJB10956.1|  hypothetical protein B456_001G233800                  99.8    4e-28   Gossypium raimondii
gb|KJB10959.1|  hypothetical protein B456_001G233800                  99.8    4e-28   Gossypium raimondii
gb|KJB26103.1|  hypothetical protein B456_004G226000                  97.1    5e-28   Gossypium raimondii
gb|KJB26102.1|  hypothetical protein B456_004G226000                  96.7    6e-28   Gossypium raimondii
gb|KJB26105.1|  hypothetical protein B456_004G226000                  96.7    6e-28   Gossypium raimondii
gb|KJB26106.1|  hypothetical protein B456_004G226000                  96.7    6e-28   Gossypium raimondii
gb|KJB26101.1|  hypothetical protein B456_004G226000                  96.7    6e-28   Gossypium raimondii
gb|KJB26104.1|  hypothetical protein B456_004G226000                  96.7    6e-28   Gossypium raimondii
ref|XP_008382623.1|  PREDICTED: uncharacterized protein LOC103445...  93.6    6e-28   
ref|XP_008382616.1|  PREDICTED: uncharacterized protein LOC103445...  94.4    7e-28   Malus domestica [apple tree]
ref|XP_008382622.1|  PREDICTED: uncharacterized protein LOC103445...  94.4    7e-28   Malus domestica [apple tree]
ref|XP_008382619.1|  PREDICTED: uncharacterized protein LOC103445...  94.4    7e-28   Malus domestica [apple tree]
ref|XP_008382621.1|  PREDICTED: uncharacterized protein LOC103445...  94.4    7e-28   Malus domestica [apple tree]
ref|XP_009334923.1|  PREDICTED: uncharacterized protein LOC103927...  94.7    8e-28   Pyrus x bretschneideri [bai li]
gb|KHF98888.1|  E1A-binding p400                                      96.7    8e-28   Gossypium arboreum [tree cotton]
ref|XP_009334921.1|  PREDICTED: uncharacterized protein LOC103927...  94.4    9e-28   Pyrus x bretschneideri [bai li]
ref|XP_009334922.1|  PREDICTED: uncharacterized protein LOC103927...  94.4    9e-28   Pyrus x bretschneideri [bai li]
ref|XP_009334920.1|  PREDICTED: uncharacterized protein LOC103927...  94.4    9e-28   Pyrus x bretschneideri [bai li]
gb|KHG21869.1|  E1A-binding p400                                      97.8    1e-27   Gossypium arboreum [tree cotton]
ref|XP_007134093.1|  hypothetical protein PHAVU_010G018800g           98.6    1e-27   Phaseolus vulgaris [French bean]
ref|XP_007134092.1|  hypothetical protein PHAVU_010G018800g           98.6    1e-27   Phaseolus vulgaris [French bean]
ref|XP_007134096.1|  hypothetical protein PHAVU_010G018800g           98.6    1e-27   Phaseolus vulgaris [French bean]
ref|XP_007134095.1|  hypothetical protein PHAVU_010G018800g           98.6    1e-27   Phaseolus vulgaris [French bean]
gb|KCW58061.1|  hypothetical protein EUGRSUZ_H00795                   94.4    4e-27   Eucalyptus grandis [rose gum]
gb|KDP26381.1|  hypothetical protein JCGZ_17539                       96.7    9e-27   Jatropha curcas
ref|XP_010069648.1|  PREDICTED: uncharacterized protein LOC104456...  94.4    1e-26   Eucalyptus grandis [rose gum]
ref|XP_010069646.1|  PREDICTED: uncharacterized protein LOC104456...  94.4    1e-26   Eucalyptus grandis [rose gum]
ref|XP_011024663.1|  PREDICTED: uncharacterized protein LOC105125...  95.9    3e-26   Populus euphratica
ref|XP_011024664.1|  PREDICTED: uncharacterized protein LOC105125...  95.9    3e-26   Populus euphratica
ref|XP_011024662.1|  PREDICTED: uncharacterized protein LOC105125...  95.9    3e-26   Populus euphratica
ref|XP_011024665.1|  PREDICTED: uncharacterized protein LOC105125...  95.5    3e-26   Populus euphratica
ref|XP_011024666.1|  PREDICTED: uncharacterized protein LOC105125...  95.5    3e-26   Populus euphratica
ref|XP_011024667.1|  PREDICTED: uncharacterized protein LOC105125...  95.5    3e-26   Populus euphratica
ref|XP_002303042.2|  hypothetical protein POPTR_0002s24490g           96.3    4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010241374.1|  PREDICTED: uncharacterized protein LOC104585...  98.6    4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010241375.1|  PREDICTED: uncharacterized protein LOC104585...  98.6    4e-26   Nelumbo nucifera [Indian lotus]
ref|NP_001189965.1|  Helicase/SANT-associated, DNA binding protein    90.5    2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321281.2|  hypothetical protein POPTR_0014s19020g           92.0    2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008382620.1|  PREDICTED: uncharacterized protein LOC103445...  92.8    4e-25   Malus domestica [apple tree]
ref|XP_010685017.1|  PREDICTED: uncharacterized protein LOC104899514  89.4    4e-25   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KHG16179.1|  E1A-binding p400                                      91.3    2e-24   Gossypium arboreum [tree cotton]
gb|KJB10168.1|  hypothetical protein B456_001G187100                  90.1    5e-24   Gossypium raimondii
ref|XP_010468476.1|  PREDICTED: uncharacterized protein LOC104748554  91.3    5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_011011420.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  87.8    6e-24   Populus euphratica
ref|NP_189131.5|  Helicase/SANT-associated, DNA binding protein       90.9    9e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02897.1|  unnamed protein product                              90.9    9e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02898.1|  unnamed protein product                              90.9    9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004154474.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.9    1e-23   
gb|KGN44605.1|  hypothetical protein Csa_7G341250                     95.9    1e-23   Cucumis sativus [cucumbers]
ref|NP_189132.2|  Helicase/SANT-associated, DNA binding protein       90.5    1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885676.1|  hypothetical protein ARALYDRAFT_480005           91.3    1e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_004150965.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.1    1e-23   
ref|XP_008458010.1|  PREDICTED: uncharacterized protein LOC103497550  95.9    1e-23   Cucumis melo [Oriental melon]
ref|XP_010550893.1|  PREDICTED: uncharacterized protein LOC104821...  89.7    1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010550887.1|  PREDICTED: uncharacterized protein LOC104821...  89.7    1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010550892.1|  PREDICTED: uncharacterized protein LOC104821...  89.7    1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010550890.1|  PREDICTED: uncharacterized protein LOC104821...  89.7    1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010550891.1|  PREDICTED: uncharacterized protein LOC104821...  89.7    1e-23   Tarenaya hassleriana [spider flower]
ref|XP_010488606.1|  PREDICTED: uncharacterized protein LOC104766...  87.8    5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010488603.1|  PREDICTED: uncharacterized protein LOC104766...  87.8    5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010488604.1|  PREDICTED: uncharacterized protein LOC104766...  87.8    5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010488609.1|  PREDICTED: uncharacterized protein LOC104766...  87.8    6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010488605.1|  PREDICTED: uncharacterized protein LOC104766...  87.8    6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010488607.1|  PREDICTED: uncharacterized protein LOC104766...  87.8    6e-23   Camelina sativa [gold-of-pleasure]
gb|KHN11006.1|  E1A-binding protein p400                                107   9e-23   Glycine soja [wild soybean]
ref|XP_006299676.1|  hypothetical protein CARUB_v10015863mg           87.0    9e-23   Capsella rubella
ref|XP_006586244.1|  PREDICTED: uncharacterized protein LOC100779...    107   9e-23   Glycine max [soybeans]
ref|XP_006586240.1|  PREDICTED: uncharacterized protein LOC100779...    107   1e-22   Glycine max [soybeans]
ref|XP_006586242.1|  PREDICTED: uncharacterized protein LOC100779...    106   1e-22   Glycine max [soybeans]
ref|XP_006586245.1|  PREDICTED: uncharacterized protein LOC100779...    106   1e-22   Glycine max [soybeans]
ref|XP_006586241.1|  PREDICTED: uncharacterized protein LOC100779...    106   1e-22   Glycine max [soybeans]
gb|EYU39228.1|  hypothetical protein MIMGU_mgv1a000074mg                106   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_006418678.1|  hypothetical protein EUTSA_v10002368mg           87.0    1e-22   Eutrema salsugineum
gb|EYU40613.1|  hypothetical protein MIMGU_mgv1a0000831mg             96.3    2e-22   Erythranthe guttata [common monkey flower]
ref|XP_010527244.1|  PREDICTED: uncharacterized protein LOC104804...  83.6    3e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527245.1|  PREDICTED: uncharacterized protein LOC104804...  83.6    3e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527243.1|  PREDICTED: uncharacterized protein LOC104804...  83.6    3e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527240.1|  PREDICTED: uncharacterized protein LOC104804...  83.6    3e-22   Tarenaya hassleriana [spider flower]
ref|XP_010422465.1|  PREDICTED: uncharacterized protein LOC104707737  87.4    3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006299914.1|  hypothetical protein CARUB_v10016123mg           85.1    4e-22   Capsella rubella
ref|XP_008346247.1|  PREDICTED: uncharacterized protein LOC103409211  73.6    4e-22   
gb|KHN23706.1|  E1A-binding protein p400                                104   5e-22   Glycine soja [wild soybean]
ref|XP_006602523.1|  PREDICTED: uncharacterized protein LOC100819...    104   5e-22   Glycine max [soybeans]
ref|XP_006602522.1|  PREDICTED: uncharacterized protein LOC100819...    104   5e-22   Glycine max [soybeans]
ref|XP_006602521.1|  PREDICTED: uncharacterized protein LOC100819...    104   5e-22   Glycine max [soybeans]
ref|XP_006602517.1|  PREDICTED: uncharacterized protein LOC100819...    104   5e-22   Glycine max [soybeans]
ref|XP_008790654.1|  PREDICTED: uncharacterized protein LOC103707...  83.2    5e-22   Phoenix dactylifera
ref|XP_008790635.1|  PREDICTED: uncharacterized protein LOC103707...  83.2    6e-22   Phoenix dactylifera
ref|XP_008790645.1|  PREDICTED: uncharacterized protein LOC103707...  83.2    6e-22   Phoenix dactylifera
ref|XP_004969428.1|  PREDICTED: uncharacterized protein LOC101768814  85.5    1e-21   Setaria italica
ref|XP_009383644.1|  PREDICTED: uncharacterized protein LOC103971...  85.9    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383645.1|  PREDICTED: uncharacterized protein LOC103971...  85.9    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH22725.1|  helicase/SANT-associated, DNA-binding protein, pu...    103   2e-21   Medicago truncatula
gb|KEH22728.1|  helicase/SANT-associated, DNA-binding protein, pu...    103   2e-21   Medicago truncatula
ref|XP_009383643.1|  PREDICTED: uncharacterized protein LOC103971...  85.9    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH22727.1|  helicase/SANT-associated, DNA-binding protein, pu...    103   2e-21   Medicago truncatula
gb|KEH22724.1|  helicase/SANT-associated, DNA-binding protein, pu...    103   2e-21   Medicago truncatula
gb|KEH22723.1|  helicase/SANT-associated, DNA-binding protein, pu...    103   2e-21   Medicago truncatula
gb|KEH22729.1|  helicase/SANT-associated, DNA-binding protein, pu...    103   2e-21   Medicago truncatula
ref|XP_009383641.1|  PREDICTED: uncharacterized protein LOC103971...  85.9    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004514269.1|  PREDICTED: uncharacterized protein LOC101508...    102   4e-21   Cicer arietinum [garbanzo]
ref|XP_003569253.2|  PREDICTED: uncharacterized protein LOC100846...  82.4    4e-21   Brachypodium distachyon [annual false brome]
ref|XP_010932960.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  83.2    5e-21   Elaeis guineensis
ref|XP_010231947.1|  PREDICTED: uncharacterized protein LOC100846...  82.4    6e-21   Brachypodium distachyon [annual false brome]
ref|XP_006644307.1|  PREDICTED: uncharacterized protein LOC102716...  86.3    1e-20   Oryza brachyantha
ref|XP_006644308.1|  PREDICTED: uncharacterized protein LOC102716...  86.3    2e-20   Oryza brachyantha
ref|NP_001061122.1|  Os08g0177300                                     86.3    2e-20   
ref|XP_002455831.1|  hypothetical protein SORBIDRAFT_03g025920        84.3    2e-20   Sorghum bicolor [broomcorn]
gb|EEC82989.1|  hypothetical protein OsI_28025                        85.9    3e-20   Oryza sativa Indica Group [Indian rice]
gb|EEE68140.1|  hypothetical protein OsJ_26241                        85.9    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010917964.1|  PREDICTED: uncharacterized protein LOC105042...  78.2    4e-20   Elaeis guineensis
ref|XP_010917963.1|  PREDICTED: uncharacterized protein LOC105042...  78.2    4e-20   Elaeis guineensis
ref|XP_010917965.1|  PREDICTED: uncharacterized protein LOC105042...  77.8    5e-20   Elaeis guineensis
ref|XP_009102451.1|  PREDICTED: uncharacterized protein LOC103828...  76.6    1e-19   Brassica rapa
ref|XP_009102452.1|  PREDICTED: uncharacterized protein LOC103828...  76.6    1e-19   Brassica rapa
emb|CDX93040.1|  BnaA03g37620D                                        81.3    3e-19   Brassica napus [oilseed rape]
emb|CDY15112.1|  BnaC03g44730D                                        80.9    3e-19   Brassica napus [oilseed rape]
gb|EMT21406.1|  E1A-binding protein p400                              78.2    4e-19   Aegilops tauschii
emb|CDY52088.1|  BnaCnng21890D                                        76.6    8e-19   Brassica napus [oilseed rape]
ref|XP_006654876.1|  PREDICTED: uncharacterized protein LOC102700...  77.4    1e-18   Oryza brachyantha
ref|XP_006654875.1|  PREDICTED: uncharacterized protein LOC102700...  77.4    1e-18   Oryza brachyantha
emb|CDX77380.1|  BnaA07g05180D                                        76.3    1e-18   Brassica napus [oilseed rape]
ref|XP_009136094.1|  PREDICTED: uncharacterized protein LOC103860...  77.8    3e-18   Brassica rapa
ref|XP_009136096.1|  PREDICTED: uncharacterized protein LOC103860...  77.8    3e-18   Brassica rapa
gb|EEE64905.1|  hypothetical protein OsJ_19765                        78.6    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79795.1|  hypothetical protein OsI_21223                        78.6    3e-18   Oryza sativa Indica Group [Indian rice]
gb|ACU01769.1|  hypothetical protein                                  75.9    6e-18   Brachypodium distachyon [annual false brome]
ref|XP_010230951.1|  PREDICTED: uncharacterized protein LOC100845890  75.5    8e-18   Brachypodium distachyon [annual false brome]
tpg|DAA58666.1|  TPA: putative homeodomain-like transcription fac...  72.4    6e-17   Zea mays [maize]
ref|XP_008675390.1|  PREDICTED: uncharacterized protein LOC103651...  72.4    9e-17   Zea mays [maize]
ref|XP_008675386.1|  PREDICTED: uncharacterized protein LOC103651...  72.4    9e-17   Zea mays [maize]
gb|ACT34068.1|  hypothetical protein                                  77.8    3e-16   Aegilops tauschii
gb|EMT31460.1|  hypothetical protein F775_01577                       77.4    3e-16   Aegilops tauschii
tpg|DAA58669.1|  TPA: putative homeodomain-like transcription fac...  69.3    4e-16   Zea mays [maize]
ref|XP_008676365.1|  PREDICTED: uncharacterized protein LOC103652593  68.9    5e-16   Zea mays [maize]
ref|XP_009409891.1|  PREDICTED: uncharacterized protein LOC103992...  64.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409885.1|  PREDICTED: uncharacterized protein LOC103992...  64.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409867.1|  PREDICTED: uncharacterized protein LOC103992...  64.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409876.1|  PREDICTED: uncharacterized protein LOC103992...  64.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409845.1|  PREDICTED: uncharacterized protein LOC103992...  64.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006576616.1|  PREDICTED: uncharacterized protein LOC100814...  85.1    2e-15   
ref|XP_010036817.1|  PREDICTED: uncharacterized protein LOC104425...  62.4    3e-15   Eucalyptus grandis [rose gum]
ref|XP_004961001.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    7e-15   Setaria italica
emb|CDY47335.1|  BnaCnng14720D                                        65.5    8e-15   Brassica napus [oilseed rape]
ref|XP_004961004.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    8e-15   
ref|XP_004960999.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    8e-15   Setaria italica
ref|XP_004960998.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    8e-15   Setaria italica
ref|XP_004961003.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    8e-15   
ref|XP_004960997.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    8e-15   Setaria italica
ref|XP_004961002.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    8e-15   Setaria italica
ref|XP_004961000.1|  PREDICTED: uncharacterized protein LOC101757...  74.3    8e-15   Setaria italica
ref|XP_006840249.1|  hypothetical protein AMTR_s00045p00023420        62.4    1e-14   
ref|XP_010036816.1|  PREDICTED: uncharacterized protein LOC104425...  62.8    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010036814.1|  PREDICTED: uncharacterized protein LOC104425...  62.4    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010036815.1|  PREDICTED: uncharacterized protein LOC104425...  62.4    1e-14   Eucalyptus grandis [rose gum]
ref|XP_006586243.1|  PREDICTED: uncharacterized protein LOC100779...  79.7    1e-13   Glycine max [soybeans]
ref|XP_006602524.1|  PREDICTED: uncharacterized protein LOC100819...  77.8    6e-13   Glycine max [soybeans]
ref|XP_006848239.1|  hypothetical protein AMTR_s00029p00248620        58.5    1e-12   
gb|KEH22726.1|  helicase/SANT-associated, DNA-binding protein, pu...  76.3    2e-12   Medicago truncatula
gb|AFW81334.1|  hypothetical protein ZEAMMB73_834326                  64.7    8e-12   Zea mays [maize]
ref|XP_008657537.1|  PREDICTED: uncharacterized protein LOC103637041  64.7    2e-11   Zea mays [maize]
gb|KEH16078.1|  DNA-binding protein, putative                         70.9    4e-11   Medicago truncatula
gb|EPS63531.1|  hypothetical protein M569_11253                       64.7    1e-09   Genlisea aurea
emb|CAN70776.1|  hypothetical protein VITISV_018341                   60.8    1e-07   Vitis vinifera
ref|XP_009139650.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.2    1e-06   Brassica rapa
emb|CDY01111.1|  BnaA04g07080D                                        58.2    1e-06   Brassica napus [oilseed rape]



>ref|XP_009621993.1| PREDICTED: uncharacterized protein LOC104113512 isoform X2 [Nicotiana 
tomentosiformis]
Length=1901

 Score =   130 bits (328),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENE+ EG+ R SR+  R
Sbjct  99   SEAKGSFAITASPHGDSVESSGRLGAPQLCEPNSADNLMLFDGENEFTEGD-RSSRHPGR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +     EQS ++D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SKLTPSEQSFKLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 59.7 bits (143),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQHPDQLVT  98



>ref|XP_009621994.1| PREDICTED: uncharacterized protein LOC104113512 isoform X3 [Nicotiana 
tomentosiformis]
Length=1900

 Score =   130 bits (328),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENE+ EG+ R SR+  R
Sbjct  99   SEAKGSFAITASPHGDSVESSGRLGAPQLCEPNSADNLMLFDGENEFTEGD-RSSRHPGR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +     EQS ++D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SKLTPSEQSFKLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 59.7 bits (143),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQHPDQLVT  98



>ref|XP_009621995.1| PREDICTED: uncharacterized protein LOC104113512 isoform X4 [Nicotiana 
tomentosiformis]
Length=1888

 Score =   130 bits (328),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENE+ EG+ R SR+  R
Sbjct  99   SEAKGSFAITASPHGDSVESSGRLGAPQLCEPNSADNLMLFDGENEFTEGD-RSSRHPGR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +     EQS ++D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SKLTPSEQSFKLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 59.7 bits (143),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQHPDQLVT  98



>ref|XP_009621987.1| PREDICTED: uncharacterized protein LOC104113512 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009621988.1| PREDICTED: uncharacterized protein LOC104113512 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009621990.1| PREDICTED: uncharacterized protein LOC104113512 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009621991.1| PREDICTED: uncharacterized protein LOC104113512 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009621992.1| PREDICTED: uncharacterized protein LOC104113512 isoform X1 [Nicotiana 
tomentosiformis]
Length=1903

 Score =   130 bits (327),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENE+ EG+ R SR+  R
Sbjct  99   SEAKGSFAITASPHGDSVESSGRLGAPQLCEPNSADNLMLFDGENEFTEGD-RSSRHPGR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +     EQS ++D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SKLTPSEQSFKLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 59.7 bits (143),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQHPDQLVT  98



>ref|XP_006356783.1| PREDICTED: chromatin modification-related protein EAF1-like [Solanum 
tuberosum]
Length=1955

 Score =   127 bits (319),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENE++EG  R  R+ SR
Sbjct  99   SEAKGSFAITASPHGDSVESSGRLGAPQLCEPNSADNLMLFDGENEFIEGV-RSCRHPSR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS+++D +++AKELG SAAF VPRKAYKRR R
Sbjct  158  SNLTPSEQSSKLDRSRNAKELGVSAAFGVPRKAYKRRHR  196


 Score = 62.4 bits (150),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  QGGDPL+FK+GNA S+SVQSTS TDQ PDQFVT
Sbjct  63   FLAQGGDPLDFKFGNATSLSVQSTSLTDQHPDQFVT  98



>ref|XP_009791551.1| PREDICTED: uncharacterized protein LOC104238776 isoform X2 [Nicotiana 
sylvestris]
Length=1935

 Score =   129 bits (323),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENEY EG+ R SR+   
Sbjct  99   SEAKGSFAITASPHGDSVESSDRLGAPQLCEPNSADNLMLFDGENEYTEGD-RSSRHPGT  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS  +D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SNLTPSEQSFNLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 58.9 bits (141),  Expect(2) = 5e-39, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQPPDQLVT  98



>ref|XP_009791548.1| PREDICTED: uncharacterized protein LOC104238776 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009791549.1| PREDICTED: uncharacterized protein LOC104238776 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009791550.1| PREDICTED: uncharacterized protein LOC104238776 isoform X1 [Nicotiana 
sylvestris]
Length=1937

 Score =   129 bits (323),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENEY EG+ R SR+   
Sbjct  99   SEAKGSFAITASPHGDSVESSDRLGAPQLCEPNSADNLMLFDGENEYTEGD-RSSRHPGT  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS  +D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SNLTPSEQSFNLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 58.9 bits (141),  Expect(2) = 5e-39, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQPPDQLVT  98



>ref|XP_009791552.1| PREDICTED: uncharacterized protein LOC104238776 isoform X3 [Nicotiana 
sylvestris]
Length=1934

 Score =   129 bits (323),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENEY EG+ R SR+   
Sbjct  99   SEAKGSFAITASPHGDSVESSDRLGAPQLCEPNSADNLMLFDGENEYTEGD-RSSRHPGT  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS  +D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SNLTPSEQSFNLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 58.9 bits (141),  Expect(2) = 5e-39, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQPPDQLVT  98



>ref|XP_009791553.1| PREDICTED: uncharacterized protein LOC104238776 isoform X4 [Nicotiana 
sylvestris]
Length=1922

 Score =   129 bits (323),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R GA  +CEPNSADNLMLFDGENEY EG+ R SR+   
Sbjct  99   SEAKGSFAITASPHGDSVESSDRLGAPQLCEPNSADNLMLFDGENEYTEGD-RSSRHPGT  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS  +D +++AKELGDSAAF VPRKAYKRR R
Sbjct  158  SNLTPSEQSFNLDRSRNAKELGDSAAFGVPRKAYKRRYR  196


 Score = 58.9 bits (141),  Expect(2) = 6e-39, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAAS+SVQSTS TDQ PDQ VT
Sbjct  63   FLEKGGDPLDFKFGNAASLSVQSTSLTDQPPDQLVT  98



>ref|XP_010326298.1| PREDICTED: uncharacterized protein LOC101265768 isoform X2 [Solanum 
lycopersicum]
Length=1746

 Score =   124 bits (311),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA  ASPH DSVES  R GA  +CEPNSADNLMLFDGENE++EG  R  R+ S
Sbjct  98   TSEAKGSFAINASPHGDSVESSGRLGAPQLCEPNSADNLMLFDGENEFIEGV-RSCRHPS  156

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +++    EQS+++D +++AKELG SAAF VPRKAYKRR R
Sbjct  157  KSNLTPSEQSSKLDRSRNAKELGVSAAFGVPRKAYKRRHR  196


 Score = 62.4 bits (150),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  QGGDPL+FK+GNA S+SVQSTS TDQ PDQFVT
Sbjct  63   FLAQGGDPLDFKFGNATSLSVQSTSLTDQHPDQFVT  98



>ref|XP_004247290.1| PREDICTED: uncharacterized protein LOC101265768 isoform X1 [Solanum 
lycopersicum]
Length=1954

 Score =   124 bits (311),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA  ASPH DSVES  R GA  +CEPNSADNLMLFDGENE++EG  R  R+ S+
Sbjct  99   SEAKGSFAINASPHGDSVESSGRLGAPQLCEPNSADNLMLFDGENEFIEGV-RSCRHPSK  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS+++D +++AKELG SAAF VPRKAYKRR R
Sbjct  158  SNLTPSEQSSKLDRSRNAKELGVSAAFGVPRKAYKRRHR  196


 Score = 62.0 bits (149),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  QGGDPL+FK+GNA S+SVQSTS TDQ PDQFVT
Sbjct  63   FLAQGGDPLDFKFGNATSLSVQSTSLTDQHPDQFVT  98



>emb|CDP03881.1| unnamed protein product [Coffea canephora]
Length=1652

 Score =   133 bits (335),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFAFTASPH DSVES  RP A   CEPNSADNLMLFDGEN+++EG+ R++   +R
Sbjct  101  SEAKGSFAFTASPHGDSVESSGRPRAHSTCEPNSADNLMLFDGENDFIEGD-RVAAQPNR  159

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            T+  + E  ++ DGN +AKELGDSAAF +PRKAYKRR R
Sbjct  160  TNVVSTEHLSQRDGNSNAKELGDSAAFSLPRKAYKRRTR  198


 Score = 52.4 bits (124),  Expect(2) = 2e-38, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+F  G AASVSVQSTS TDQQP+ FVT
Sbjct  68   KGGNPLDFNCGKAASVSVQSTSQTDQQPELFVT  100



>ref|XP_011089090.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105170153 
[Sesamum indicum]
Length=1951

 Score =   119 bits (299),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFAFTASPH DSVES  RPGAT  CEPNSADNLMLFD E E+ EG +       R
Sbjct  99   SEAKGSFAFTASPHGDSVESSDRPGAT-PCEPNSADNLMLFDAEQEFSEGGRSFLH--PR  155

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             ST  P +QS  +DGN+  +E GDSAAF +PRKAYKRR R
Sbjct  156  RSTVVPSDQSFHIDGNRKTQEHGDSAAFGLPRKAYKRRYR  195


 Score = 52.0 bits (123),  Expect(2) = 4e-34, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TD  PDQ VT
Sbjct  63   FLERGGNPLDFKLGNGASVSVQSTSITDLHPDQIVT  98



>ref|XP_009792431.1| PREDICTED: uncharacterized protein LOC104239487 isoform X2 [Nicotiana 
sylvestris]
Length=1925

 Score =   113 bits (282),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S  KGS A TASPH DS ES  RPGA  +CEPNSADNLMLFDGEN++V G  R  R+ SR
Sbjct  99   SVVKGSRAITASPHGDSAESSGRPGAPQLCEPNSADNLMLFDGENKFV-GSDRGCRHPSR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++     QS++ + +Q+AKEL ++ AF++PRKAYKRR R
Sbjct  158  SNVTPSGQSSKFNESQNAKELSNATAFDIPRKAYKRRYR  196


 Score = 57.8 bits (138),  Expect(2) = 6e-34, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPLEFK+G+AAS+SVQSTS  D+ PDQFVT
Sbjct  63   FLEEGGDPLEFKFGDAASLSVQSTSLPDKHPDQFVT  98



>ref|XP_009792429.1| PREDICTED: uncharacterized protein LOC104239487 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009792430.1| PREDICTED: uncharacterized protein LOC104239487 isoform X1 [Nicotiana 
sylvestris]
Length=1927

 Score =   113 bits (282),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S  KGS A TASPH DS ES  RPGA  +CEPNSADNLMLFDGEN++V G  R  R+ SR
Sbjct  99   SVVKGSRAITASPHGDSAESSGRPGAPQLCEPNSADNLMLFDGENKFV-GSDRGCRHPSR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++     QS++ + +Q+AKEL ++ AF++PRKAYKRR R
Sbjct  158  SNVTPSGQSSKFNESQNAKELSNATAFDIPRKAYKRRYR  196


 Score = 57.8 bits (138),  Expect(2) = 6e-34, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPLEFK+G+AAS+SVQSTS  D+ PDQFVT
Sbjct  63   FLEEGGDPLEFKFGDAASLSVQSTSLPDKHPDQFVT  98



>ref|XP_009608002.1| PREDICTED: uncharacterized protein LOC104102087 isoform X2 [Nicotiana 
tomentosiformis]
Length=1001

 Score =   118 bits (295),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE KGS A TASPH DS ES  RPGA  +CEPNSADNLMLFDGEN++V G  R  R+ SR
Sbjct  99   SEVKGSRAITASPHGDSAESSGRPGAPQLCEPNSADNLMLFDGENKFV-GSDRGCRHPSR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++     QS++ + +Q+AKELG++ AF++PRKAYKRR R
Sbjct  158  SNVTPSGQSSKFNESQNAKELGNATAFDIPRKAYKRRYR  196


 Score = 52.0 bits (123),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPLEFK G+A S SVQSTS  D+ PD FVT
Sbjct  63   FLEEGGDPLEFKLGDAVSPSVQSTSLPDKHPDHFVT  98



>ref|XP_009608000.1| PREDICTED: uncharacterized protein LOC104102087 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608001.1| PREDICTED: uncharacterized protein LOC104102087 isoform X1 [Nicotiana 
tomentosiformis]
Length=1004

 Score =   118 bits (295),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE KGS A TASPH DS ES  RPGA  +CEPNSADNLMLFDGEN++V G  R  R+ SR
Sbjct  99   SEVKGSRAITASPHGDSAESSGRPGAPQLCEPNSADNLMLFDGENKFV-GSDRGCRHPSR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++     QS++ + +Q+AKELG++ AF++PRKAYKRR R
Sbjct  158  SNVTPSGQSSKFNESQNAKELGNATAFDIPRKAYKRRYR  196


 Score = 52.0 bits (123),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPLEFK G+A S SVQSTS  D+ PD FVT
Sbjct  63   FLEEGGDPLEFKLGDAVSPSVQSTSLPDKHPDHFVT  98



>ref|XP_004242539.1| PREDICTED: uncharacterized protein LOC101263128 [Solanum lycopersicum]
Length=1927

 Score =   114 bits (285),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE KGSFA T S H DSVES  RP A  +CEPNSADNLMLFDGEN++V G  R  R+ SR
Sbjct  99   SEIKGSFAITTSAHGDSVESSGRPAAPQLCEPNSADNLMLFDGENKFV-GNDRGYRHPSR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++     QS++ + +Q+AKELG S AF +P+KAYKRR R
Sbjct  158  SNVTPSGQSSKFEESQNAKELGKSTAFGIPKKAYKRRYR  196


 Score = 52.8 bits (125),  Expect(2) = 9e-33, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL FK  +AAS+SVQSTS TD+ PDQFVT
Sbjct  63   FLEEGGDPLNFKIVDAASLSVQSTSLTDKHPDQFVT  98



>ref|XP_007049768.1| Helicase/SANT-associated, putative isoform 5 [Theobroma cacao]
 gb|EOX93925.1| Helicase/SANT-associated, putative isoform 5 [Theobroma cacao]
Length=2013

 Score =   111 bits (277),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGE+E  EGE++      
Sbjct  98   TSEAKGSFALTASPHGDSVESSGRPGVRAVCEPNSADNLLLFDGESELPEGERKSMHPRK  157

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R + A  EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  158  RNTVAPSEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 9e-33, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>ref|XP_007049765.1| Helicase/SANT-associated, putative isoform 2 [Theobroma cacao]
 gb|EOX93922.1| Helicase/SANT-associated, putative isoform 2 [Theobroma cacao]
Length=2041

 Score =   110 bits (276),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGE+E  EGE++      
Sbjct  98   TSEAKGSFALTASPHGDSVESSGRPGVRAVCEPNSADNLLLFDGESELPEGERKSMHPRK  157

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R + A  EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  158  RNTVAPSEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 9e-33, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>ref|XP_007049764.1| Helicase/SANT-associated, putative isoform 1 [Theobroma cacao]
 gb|EOX93921.1| Helicase/SANT-associated, putative isoform 1 [Theobroma cacao]
Length=2082

 Score =   110 bits (276),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGE+E  EGE++      R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGVRAVCEPNSADNLLLFDGESELPEGERKSMHPRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  159  NTVAPSEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>ref|XP_007049767.1| Helicase/SANT-associated, putative isoform 4 [Theobroma cacao]
 gb|EOX93924.1| Helicase/SANT-associated, putative isoform 4 [Theobroma cacao]
Length=2042

 Score =   110 bits (276),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGE+E  EGE++      
Sbjct  99   TSEAKGSFALTASPHGDSVESSGRPGVRAVCEPNSADNLLLFDGESELPEGERKSMHPRK  158

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R + A  EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  159  RNTVAPSEQSSQMDGTQNAKESEDSAIF----RPYARRNR  194


 Score = 55.8 bits (133),  Expect(2) = 1e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  67   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  99



>ref|XP_006479271.1| PREDICTED: uncharacterized protein LOC102614167 isoform X1 [Citrus 
sinensis]
 ref|XP_006479272.1| PREDICTED: uncharacterized protein LOC102614167 isoform X2 [Citrus 
sinensis]
Length=2037

 Score =   110 bits (275),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPN+ADNL+LFDGENE +E E+     + R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGVPTVCEPNTADNLLLFDGENEILERERTSVHPVKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+RMDG+Q+AKE  DSA F    + Y RR R
Sbjct  159  KNIVPSEQSSRMDGSQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>ref|XP_006479273.1| PREDICTED: uncharacterized protein LOC102614167 isoform X3 [Citrus 
sinensis]
Length=2020

 Score =   110 bits (275),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPN+ADNL+LFDGENE +E E+     + R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGVPTVCEPNTADNLLLFDGENEILERERTSVHPVKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+RMDG+Q+AKE  DSA F    + Y RR R
Sbjct  159  KNIVPSEQSSRMDGSQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>gb|KDO65937.1| hypothetical protein CISIN_1g000147mg [Citrus sinensis]
Length=1983

 Score =   110 bits (275),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TASPH DSVES  RPG   +CEPN+ADNL+LFDGENE +E E+     + 
Sbjct  98   TSEAKGSFALTASPHGDSVESSGRPGVPTVCEPNTADNLLLFDGENEILERERTSVHPVK  157

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R +    EQS+RMDG+Q+AKE  DSA F    + Y RR R
Sbjct  158  RKNIVPSEQSSRMDGSQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>gb|KDO65939.1| hypothetical protein CISIN_1g000147mg [Citrus sinensis]
 gb|KDO65940.1| hypothetical protein CISIN_1g000147mg [Citrus sinensis]
Length=2037

 Score =   110 bits (274),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPN+ADNL+LFDGENE +E E+     + R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGVPTVCEPNTADNLLLFDGENEILERERTSVHPVKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+RMDG+Q+AKE  DSA F    + Y RR R
Sbjct  159  KNIVPSEQSSRMDGSQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>gb|KDO65938.1| hypothetical protein CISIN_1g000147mg [Citrus sinensis]
Length=2020

 Score =   110 bits (274),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPN+ADNL+LFDGENE +E E+     + R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGVPTVCEPNTADNLLLFDGENEILERERTSVHPVKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+RMDG+Q+AKE  DSA F    + Y RR R
Sbjct  159  KNIVPSEQSSRMDGSQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>ref|XP_006443596.1| hypothetical protein CICLE_v10018446mg [Citrus clementina]
 gb|ESR56836.1| hypothetical protein CICLE_v10018446mg [Citrus clementina]
Length=2041

 Score =   110 bits (274),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPN+ADNL+LFDGENE +E E+     + R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGVPTVCEPNTADNLLLFDGENEILERERTSVHPVKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+RMDG+Q+AKE  DSA F    + Y RR R
Sbjct  159  KNIVPSEQSSRMDGSQNAKESEDSAIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQQ + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHFVT  98



>ref|XP_011089681.1| PREDICTED: uncharacterized protein LOC105170563 isoform X3 [Sesamum 
indicum]
Length=1923

 Score =   106 bits (264),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFAFT SPH DSVES  R GA L  EPNSADNLMLFD E+E  EG+ R S +  R
Sbjct  99   SEARGSFAFTTSPHGDSVESSGRLGANL-SEPNSADNLMLFDAEHECSEGD-RNSLHPGR  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    E+ ++MDG+Q  ++ GDS AF +PRKAYKRR R
Sbjct  157  STIVPTEKLSQMDGSQRTRQHGDSPAFGLPRKAYKRRNR  195


 Score = 56.6 bits (135),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAASVSVQSTS TDQ P+Q +T
Sbjct  63   FLEKGGDPLDFKHGNAASVSVQSTSFTDQHPEQLLT  98



>ref|XP_011089680.1| PREDICTED: uncharacterized protein LOC105170563 isoform X2 [Sesamum 
indicum]
Length=1925

 Score =   106 bits (264),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFAFT SPH DSVES  R GA L  EPNSADNLMLFD E+E  EG+ R S +  R
Sbjct  99   SEARGSFAFTTSPHGDSVESSGRLGANL-SEPNSADNLMLFDAEHECSEGD-RNSLHPGR  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    E+ ++MDG+Q  ++ GDS AF +PRKAYKRR R
Sbjct  157  STIVPTEKLSQMDGSQRTRQHGDSPAFGLPRKAYKRRNR  195


 Score = 56.6 bits (135),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAASVSVQSTS TDQ P+Q +T
Sbjct  63   FLEKGGDPLDFKHGNAASVSVQSTSFTDQHPEQLLT  98



>ref|XP_011089675.1| PREDICTED: uncharacterized protein LOC105170563 isoform X1 [Sesamum 
indicum]
 ref|XP_011089676.1| PREDICTED: uncharacterized protein LOC105170563 isoform X1 [Sesamum 
indicum]
 ref|XP_011089677.1| PREDICTED: uncharacterized protein LOC105170563 isoform X1 [Sesamum 
indicum]
 ref|XP_011089678.1| PREDICTED: uncharacterized protein LOC105170563 isoform X1 [Sesamum 
indicum]
 ref|XP_011089679.1| PREDICTED: uncharacterized protein LOC105170563 isoform X1 [Sesamum 
indicum]
Length=1927

 Score =   106 bits (264),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFAFT SPH DSVES  R GA L  EPNSADNLMLFD E+E  EG+ R S +  R
Sbjct  99   SEARGSFAFTTSPHGDSVESSGRLGANL-SEPNSADNLMLFDAEHECSEGD-RNSLHPGR  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    E+ ++MDG+Q  ++ GDS AF +PRKAYKRR R
Sbjct  157  STIVPTEKLSQMDGSQRTRQHGDSPAFGLPRKAYKRRNR  195


 Score = 56.6 bits (135),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL+FK+GNAASVSVQSTS TDQ P+Q +T
Sbjct  63   FLEKGGDPLDFKHGNAASVSVQSTSFTDQHPEQLLT  98



>ref|XP_006352690.1| PREDICTED: uncharacterized protein LOC102597970 [Solanum tuberosum]
Length=1930

 Score =   110 bits (274),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE KGSFA T S   DSVES  RP A  +CEPNSADNLMLFDGEN++V G  R  R+ SR
Sbjct  99   SEIKGSFAVTTSARGDSVESSGRPAAPQLCEPNSADNLMLFDGENKFV-GSDRGYRHPSR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++     QS++ + +Q+AKELG S AF +P+KAYKRR R
Sbjct  158  SNVTPSGQSSKFEESQNAKELGKSTAFGIPKKAYKRRYR  196


 Score = 52.0 bits (123),  Expect(2) = 3e-31, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GGDPL FK  +AAS SVQSTS TD+ PDQFVT
Sbjct  63   FLEEGGDPLNFKIVDAASFSVQSTSLTDKHPDQFVT  98



>ref|XP_009371681.1| PREDICTED: uncharacterized protein LOC103960911 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371688.1| PREDICTED: uncharacterized protein LOC103960911 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371698.1| PREDICTED: uncharacterized protein LOC103960911 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371704.1| PREDICTED: uncharacterized protein LOC103960911 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371709.1| PREDICTED: uncharacterized protein LOC103960911 isoform X1 [Pyrus 
x bretschneideri]
Length=2041

 Score =   103 bits (256),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDVPDGE-RNSMHLSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQS++MDGNQ+ KE  DSA F    + Y RR R
Sbjct  158  RNNNGPSEQSSQMDGNQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_009371723.1| PREDICTED: uncharacterized protein LOC103960911 isoform X3 [Pyrus 
x bretschneideri]
Length=2039

 Score =   103 bits (256),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDVPDGE-RNSMHLSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQS++MDGNQ+ KE  DSA F    + Y RR R
Sbjct  158  RNNNGPSEQSSQMDGNQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_009371717.1| PREDICTED: uncharacterized protein LOC103960911 isoform X2 [Pyrus 
x bretschneideri]
Length=2040

 Score =   103 bits (256),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDVPDGE-RNSMHLSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQS++MDGNQ+ KE  DSA F    + Y RR R
Sbjct  158  RNNNGPSEQSSQMDGNQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_011458181.1| PREDICTED: uncharacterized protein LOC101292950 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=1848

 Score =   100 bits (250),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TASP  DSVES  RP    +CEPNSADNL+LFDG+N+  EGE R S ++S
Sbjct  98   TSEAKGSFALTASPRGDSVESSGRPEVPTLCEPNSADNLLLFDGDNDTPEGE-RNSMHIS  156

Query  121  -RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             R + A  EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  157  RRNNIAASEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 59.7 bits (143),  Expect(2) = 7e-31, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQHPEQFVT  98



>ref|XP_011458178.1| PREDICTED: uncharacterized protein LOC101292950 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011458179.1| PREDICTED: uncharacterized protein LOC101292950 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1994

 Score =   100 bits (250),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TASP  DSVES  RP    +CEPNSADNL+LFDG+N+  EGE R S ++S
Sbjct  98   TSEAKGSFALTASPRGDSVESSGRPEVPTLCEPNSADNLLLFDGDNDTPEGE-RNSMHIS  156

Query  121  -RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             R + A  EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  157  RRNNIAASEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 59.3 bits (142),  Expect(2) = 8e-31, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQHPEQFVT  98



>ref|XP_011458180.1| PREDICTED: uncharacterized protein LOC101292950 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1992

 Score =   100 bits (250),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TASP  DSVES  RP    +CEPNSADNL+LFDG+N+  EGE R S ++S
Sbjct  98   TSEAKGSFALTASPRGDSVESSGRPEVPTLCEPNSADNLLLFDGDNDTPEGE-RNSMHIS  156

Query  121  -RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             R + A  EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  157  RRNNIAASEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 59.3 bits (142),  Expect(2) = 8e-31, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQHPEQFVT  98



>ref|XP_007199670.1| hypothetical protein PRUPE_ppa000065mg [Prunus persica]
 gb|EMJ00869.1| hypothetical protein PRUPE_ppa000065mg [Prunus persica]
Length=2008

 Score =   103 bits (256),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASP  DSVES  RP    +CEPNSADNL+LFDG+NE  +GE R S +LSR
Sbjct  99   SEAKGSFALTASPRGDSVESSGRPEVPTLCEPNSADNLLLFDGDNEVPDGE-RNSMHLSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  158  RNNIGPSEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 56.6 bits (135),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKLGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_003548677.1| PREDICTED: uncharacterized protein LOC100811365 [Glycine max]
Length=1979

 Score =   106 bits (265),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSV+S  RPGA L  EPN+ADNL+LFDGENE  E E+R   +  R
Sbjct  99   SEAKGSFALTASPHGDSVDSSARPGAPLASEPNTADNLLLFDGENELPETERRCLHSNRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DG+Q+AKE  DSA F    + Y RR R
Sbjct  159  NNIALSEQSSQIDGSQNAKETEDSAIF----RPYARRNR  193


 Score = 52.4 bits (124),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKSGNAASVSVQSTSLTDQLHEQFVT  98



>gb|KHN13171.1| E1A-binding protein p400 [Glycine soja]
Length=1955

 Score =   106 bits (265),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSV+S  RPGA L  EPN+ADNL+LFDGENE  E E+R   +  R
Sbjct  99   SEAKGSFALTASPHGDSVDSSARPGAPLASEPNTADNLLLFDGENELPETERRCLHSNRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DG+Q+AKE  DSA F    + Y RR R
Sbjct  159  NNIALSEQSSQIDGSQNAKETEDSAIF----RPYARRNR  193


 Score = 52.4 bits (124),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKSGNAASVSVQSTSLTDQLHEQFVT  98



>ref|XP_008235469.1| PREDICTED: uncharacterized protein LOC103334305 [Prunus mume]
Length=2045

 Score =   101 bits (252),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASP  DSVES  RP    +CEPNSADNL+LFDG+N+  +GE R S +LSR
Sbjct  99   SEAKGSFALTASPRGDSVESSGRPEVPTLCEPNSADNLLLFDGDNDVPDGE-RNSMHLSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQS++MDG Q+AKE  DSA F    + Y RR R
Sbjct  158  RNNIGPSEQSSQMDGTQNAKESEDSAIF----RPYARRNR  193


 Score = 56.2 bits (134),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKLGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_010110064.1| CAG repeat protein 32 [Morus notabilis]
 gb|EXC25120.1| CAG repeat protein 32 [Morus notabilis]
Length=2040

 Score = 99.0 bits (245),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSV+S  RPGA  +CEPN+ADNL+LFDG+++  EGE R S + +R
Sbjct  99   SEAKGSFALTASPHGDSVDSSGRPGAPAVCEPNTADNLLLFDGDHDLPEGE-RNSLHPAR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSA  44
             S   P EQS+++DG Q+AKE  DSA
Sbjct  158  RSNIVPSEQSSQIDGTQNAKESEDSA  183


 Score = 58.2 bits (139),  Expect(2) = 8e-30, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNA+SVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKFGNASSVSVQSTSLTDQNPEQFVT  98



>gb|KEH22730.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1378

 Score =   102 bits (253),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A  EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  159  NKIAPSEQSSQIGGGQNAKETEESAIF----TPYARRNR  193


 Score = 54.7 bits (130),  Expect(2) = 9e-30, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  63   FLEKGGNPLDFKSGNAASVSVQSTSLTDQHQEQFVT  98



>ref|XP_004514270.1| PREDICTED: uncharacterized protein LOC101508009 isoform X2 [Cicer 
arietinum]
Length=1996

 Score =   102 bits (253),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPN+ADNL+LFDGENE  EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGAPSISEPNTADNLLLFDGENELPEGEKRFLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+++ G+Q+AKE  DSA      + Y RR R
Sbjct  159  NNIVPSEQSSQIGGSQNAKETEDSAIV----RPYARRNR  193


 Score = 53.9 bits (128),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVT  98



>ref|XP_006576615.1| PREDICTED: uncharacterized protein LOC100814315 isoform X5 [Glycine 
max]
Length=1975

 Score =   104 bits (259),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA T SPH DSV+S  RPGA L  EPN+ADNL+LFDGENE  E E+R   +  R
Sbjct  99   SEAKGSFALTPSPHGDSVDSSARPGAPLASEPNTADNLLLFDGENELPETERRCLHSNRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DGN +AKE  DSA F    + Y RR R
Sbjct  159  NNIALSEQSSQIDGNLNAKETEDSAIF----RPYARRNR  193


 Score = 51.2 bits (121),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFV+
Sbjct  66   KGGNPLDFKSGNAASVSVQSTSLTDQPHEQFVS  98



>ref|XP_006576611.1| PREDICTED: uncharacterized protein LOC100814315 isoform X1 [Glycine 
max]
 ref|XP_006576612.1| PREDICTED: uncharacterized protein LOC100814315 isoform X2 [Glycine 
max]
 ref|XP_006576613.1| PREDICTED: uncharacterized protein LOC100814315 isoform X3 [Glycine 
max]
 ref|XP_006576614.1| PREDICTED: uncharacterized protein LOC100814315 isoform X4 [Glycine 
max]
Length=1976

 Score =   104 bits (259),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA T SPH DSV+S  RPGA L  EPN+ADNL+LFDGENE  E E+R   +  R
Sbjct  99   SEAKGSFALTPSPHGDSVDSSARPGAPLASEPNTADNLLLFDGENELPETERRCLHSNRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DGN +AKE  DSA F    + Y RR R
Sbjct  159  NNIALSEQSSQIDGNLNAKETEDSAIF----RPYARRNR  193


 Score = 51.2 bits (121),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFV+
Sbjct  66   KGGNPLDFKSGNAASVSVQSTSLTDQPHEQFVS  98



>gb|KHN43848.1| E1A-binding protein p400 [Glycine soja]
Length=1938

 Score =   104 bits (259),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA T SPH DSV+S  RPGA L  EPN+ADNL+LFDGENE  E E+R   +  R
Sbjct  99   SEAKGSFALTPSPHGDSVDSSARPGAPLASEPNTADNLLLFDGENELPETERRCLHSNRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DGN +AKE  DSA F    + Y RR R
Sbjct  159  NNIALSEQSSQIDGNLNAKETEDSAIF----RPYARRNR  193


 Score = 51.2 bits (121),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFV+
Sbjct  66   KGGNPLDFKSGNAASVSVQSTSLTDQPHEQFVS  98



>ref|XP_008372484.1| PREDICTED: uncharacterized protein LOC103435838 isoform X5 [Malus 
domestica]
Length=2006

 Score = 96.7 bits (239),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TAS H DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LS
Sbjct  98   TSEAKGSFALTASTHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDAPDGE-RNSMHLS  156

Query  121  RTSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R +   P EQS++MDG Q+ KE  DSA F    + Y RR R
Sbjct  157  RRNNNGPSEQSSQMDGTQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_008372481.1| PREDICTED: uncharacterized protein LOC103435838 isoform X2 [Malus 
domestica]
Length=2040

 Score = 96.7 bits (239),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TAS H DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LS
Sbjct  98   TSEAKGSFALTASTHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDAPDGE-RNSMHLS  156

Query  121  RTSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R +   P EQS++MDG Q+ KE  DSA F    + Y RR R
Sbjct  157  RRNNNGPSEQSSQMDGTQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_008372479.1| PREDICTED: uncharacterized protein LOC103435838 isoform X1 [Malus 
domestica]
 ref|XP_008372480.1| PREDICTED: uncharacterized protein LOC103435838 isoform X1 [Malus 
domestica]
Length=2041

 Score = 96.7 bits (239),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TAS H DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LS
Sbjct  98   TSEAKGSFALTASTHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDAPDGE-RNSMHLS  156

Query  121  RTSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R +   P EQS++MDG Q+ KE  DSA F    + Y RR R
Sbjct  157  RRNNNGPSEQSSQMDGTQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_008372483.1| PREDICTED: uncharacterized protein LOC103435838 isoform X4 [Malus 
domestica]
Length=2038

 Score = 96.7 bits (239),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TAS H DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LS
Sbjct  98   TSEAKGSFALTASTHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDAPDGE-RNSMHLS  156

Query  121  RTSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R +   P EQS++MDG Q+ KE  DSA F    + Y RR R
Sbjct  157  RRNNNGPSEQSSQMDGTQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_008372482.1| PREDICTED: uncharacterized protein LOC103435838 isoform X3 [Malus 
domestica]
Length=2039

 Score = 96.7 bits (239),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA TAS H DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LS
Sbjct  98   TSEAKGSFALTASTHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDAPDGE-RNSMHLS  156

Query  121  RTSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R +   P EQS++MDG Q+ KE  DSA F    + Y RR R
Sbjct  157  RRNNNGPSEQSSQMDGTQNPKESEDSAIF----RPYARRNR  193


 Score = 58.2 bits (139),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>ref|XP_002521085.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF41236.1| DNA binding protein, putative [Ricinus communis]
Length=2009

 Score =   100 bits (250),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 8/99 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPGA  +CEPNSADN   FD ENE ++ E R  ++ SR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGAPTVCEPNSADN---FDAENEILQSE-RNPKHPSR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++ A+ EQS++MDGNQ+AKE  DSA      + Y RR R
Sbjct  155  SNIASSEQSSQMDGNQNAKESEDSAIV----RPYARRNR  189


 Score = 53.9 bits (128),  Expect(2) = 5e-29, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS TD Q + FVT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDHQTEHFVT  98



>emb|CAN78796.1| hypothetical protein VITISV_008076 [Vitis vinifera]
Length=2257

 Score =   101 bits (251),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGENE ++   R S + SR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGGPTVCEPNSADNLLLFDGENEILD---RNSLHPSR  155

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAF  38
             +   P EQS+++DG+Q+AKE  DSA F
Sbjct  156  RNNIVPSEQSSQVDGSQNAKESEDSAIF  183


 Score = 52.8 bits (125),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK G+AASVSVQSTS TDQ P+Q VT
Sbjct  66   KGGNPLDFKLGHAASVSVQSTSLTDQHPEQIVT  98



>ref|XP_007140609.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
 gb|ESW12603.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
Length=2002

 Score = 99.8 bits (247),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE+  GE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENEF-PGEKRSLHSNKR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ G+Q+AKE  DSA F    + Y RR R
Sbjct  158  NNIAPSEQSSRIGGSQNAKETEDSAIF----RPYARRNR  192


 Score = 53.9 bits (128),  Expect(2) = 9e-29, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVT  98



>ref|XP_007140610.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
 gb|ESW12604.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
Length=2004

 Score = 99.8 bits (247),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE+  GE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENEF-PGEKRSLHSNKR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ G+Q+AKE  DSA F    + Y RR R
Sbjct  158  NNIAPSEQSSRIGGSQNAKETEDSAIF----RPYARRNR  192


 Score = 53.9 bits (128),  Expect(2) = 9e-29, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVT  98



>ref|XP_007140611.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
 gb|ESW12605.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
Length=2003

 Score = 99.8 bits (247),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE+  GE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENEF-PGEKRSLHSNKR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ G+Q+AKE  DSA F    + Y RR R
Sbjct  158  NNIAPSEQSSRIGGSQNAKETEDSAIF----RPYARRNR  192


 Score = 53.9 bits (128),  Expect(2) = 9e-29, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVT  98



>ref|XP_007140608.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
 gb|ESW12602.1| hypothetical protein PHAVU_008G126600g [Phaseolus vulgaris]
Length=2001

 Score = 99.8 bits (247),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE+  GE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENEF-PGEKRSLHSNKR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ G+Q+AKE  DSA F    + Y RR R
Sbjct  158  NNIAPSEQSSRIGGSQNAKETEDSAIF----RPYARRNR  192


 Score = 53.9 bits (128),  Expect(2) = 9e-29, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVT  98



>ref|XP_002269196.2| PREDICTED: uncharacterized protein LOC100267035 isoform X2 [Vitis 
vinifera]
Length=2022

 Score =   102 bits (253),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGENE ++   R S + SR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGGPTVCEPNSADNLLLFDGENEILD---RNSLHPSR  155

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAF  38
             +   P EQS+++DG+Q+AKE  DSA F
Sbjct  156  RNNIVPSEQSSQVDGSQNAKESEDSAIF  183


 Score = 50.8 bits (120),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK G+AASVSVQSTS TDQ P+  VT
Sbjct  66   KGGNPLDFKLGHAASVSVQSTSLTDQHPEHIVT  98



>ref|XP_010652522.1| PREDICTED: uncharacterized protein LOC100267035 isoform X1 [Vitis 
vinifera]
 ref|XP_010652523.1| PREDICTED: uncharacterized protein LOC100267035 isoform X1 [Vitis 
vinifera]
Length=2023

 Score =   102 bits (253),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGENE ++   R S + SR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGGPTVCEPNSADNLLLFDGENEILD---RNSLHPSR  155

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAF  38
             +   P EQS+++DG+Q+AKE  DSA F
Sbjct  156  RNNIVPSEQSSQVDGSQNAKESEDSAIF  183


 Score = 50.8 bits (120),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK G+AASVSVQSTS TDQ P+  VT
Sbjct  66   KGGNPLDFKLGHAASVSVQSTSLTDQHPEHIVT  98



>gb|KJB38946.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38947.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=1962

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  80   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  140  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  175


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  48   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  78



>gb|KJB38938.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38945.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38954.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=1966

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  80   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  140  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  175


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  48   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  78



>emb|CBI37340.3| unnamed protein product [Vitis vinifera]
Length=1688

 Score =   101 bits (252),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPG   +CEPNSADNL+LFDGENE ++   R S + SR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGGPTVCEPNSADNLLLFDGENEILD---RNSLHPSR  155

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAF  38
             +   P EQS+++DG+Q+AKE  DSA F
Sbjct  156  RNNIVPSEQSSQVDGSQNAKESEDSAIF  183


 Score = 50.8 bits (120),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK G+AASVSVQSTS TDQ P+  VT
Sbjct  66   KGGNPLDFKLGHAASVSVQSTSLTDQHPEHIVT  98



>gb|KJB38935.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38951.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=2009

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  98   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  157

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  158  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  96



>gb|KJB38942.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38943.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=1995

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  80   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  140  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  175


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  48   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  78



>gb|KJB38936.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38944.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=2013

 Score = 99.4 bits (246),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  98   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  157

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  158  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  96



>gb|KJB38948.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38950.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=1980

 Score = 99.4 bits (246),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  98   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  157

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  158  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  96



>gb|KJB38949.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38952.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=1991

 Score = 99.8 bits (247),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  80   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  140  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  175


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  48   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  78



>gb|KJB38939.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38940.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
 gb|KJB38941.1| hypothetical protein B456_007G155000 [Gossypium raimondii]
Length=1984

 Score = 99.4 bits (246),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      
Sbjct  98   ISEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRK  157

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            + +    EQS++M   Q+AKE  DSA F    + Y RR R
Sbjct  158  KNTVVPSEQSSQMGRTQNAKESEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  96



>gb|KHF97607.1| Helicase SRCAP [Gossypium arboreum]
Length=1939

 Score = 99.4 bits (246),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA +AS H DSVES  RPG    CEPNSADNL+LFDGENE  EGE++   +  R
Sbjct  99   SEAKGSFAQSASAHGDSVESSGRPGVPAACEPNSADNLLLFDGENELPEGERKSMHSRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+ M+G Q+ KE  DS  F    + Y RR R
Sbjct  159  NTVVPSEQSSHMEGTQNVKESEDSTIF----RPYARRYR  193


 Score = 52.8 bits (125),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FKY NAASVSVQSTS TDQ    FVT
Sbjct  63   FLEKGGNPLDFKYSNAASVSVQSTSLTDQHAQHFVT  98



>gb|KJB10960.1| hypothetical protein B456_001G233800 [Gossypium raimondii]
Length=1908

 Score = 99.8 bits (247),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSFA TASPH DSVES  RPG   +CEP+SAD+L+LF GENE  EGE R S N  +
Sbjct  99   SDAKGSFAPTASPHGDSVESSGRPGIPAVCEPSSADSLLLFSGENELPEGE-RKSMNSRK  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +T  P EQS+RMDG Q+ KE  DSA F    + Y RR R
Sbjct  158  WNTVFPSEQSSRMDGAQNTKESEDSAIF----RPYARRNR  193


 Score = 52.0 bits (123),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS T+QQ +  VT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTNQQAEHLVT  98



>gb|KJB10958.1| hypothetical protein B456_001G233800 [Gossypium raimondii]
Length=2003

 Score = 99.8 bits (247),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSFA TASPH DSVES  RPG   +CEP+SAD+L+LF GENE  EGE R S N  +
Sbjct  99   SDAKGSFAPTASPHGDSVESSGRPGIPAVCEPSSADSLLLFSGENELPEGE-RKSMNSRK  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +T  P EQS+RMDG Q+ KE  DSA F    + Y RR R
Sbjct  158  WNTVFPSEQSSRMDGAQNTKESEDSAIF----RPYARRNR  193


 Score = 52.0 bits (123),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS T+QQ +  VT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTNQQAEHLVT  98



>gb|KJB10957.1| hypothetical protein B456_001G233800 [Gossypium raimondii]
Length=1989

 Score = 99.8 bits (247),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSFA TASPH DSVES  RPG   +CEP+SAD+L+LF GENE  EGE R S N  +
Sbjct  99   SDAKGSFAPTASPHGDSVESSGRPGIPAVCEPSSADSLLLFSGENELPEGE-RKSMNSRK  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +T  P EQS+RMDG Q+ KE  DSA F    + Y RR R
Sbjct  158  WNTVFPSEQSSRMDGAQNTKESEDSAIF----RPYARRNR  193


 Score = 52.0 bits (123),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS T+QQ +  VT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTNQQAEHLVT  98



>gb|KJB10954.1| hypothetical protein B456_001G233800 [Gossypium raimondii]
 gb|KJB10955.1| hypothetical protein B456_001G233800 [Gossypium raimondii]
Length=2017

 Score = 99.8 bits (247),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSFA TASPH DSVES  RPG   +CEP+SAD+L+LF GENE  EGE R S N  +
Sbjct  99   SDAKGSFAPTASPHGDSVESSGRPGIPAVCEPSSADSLLLFSGENELPEGE-RKSMNSRK  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +T  P EQS+RMDG Q+ KE  DSA F    + Y RR R
Sbjct  158  WNTVFPSEQSSRMDGAQNTKESEDSAIF----RPYARRNR  193


 Score = 52.0 bits (123),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS T+QQ +  VT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTNQQAEHLVT  98



>gb|KJB10956.1| hypothetical protein B456_001G233800 [Gossypium raimondii]
Length=1988

 Score = 99.8 bits (247),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSFA TASPH DSVES  RPG   +CEP+SAD+L+LF GENE  EGE R S N  +
Sbjct  99   SDAKGSFAPTASPHGDSVESSGRPGIPAVCEPSSADSLLLFSGENELPEGE-RKSMNSRK  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +T  P EQS+RMDG Q+ KE  DSA F    + Y RR R
Sbjct  158  WNTVFPSEQSSRMDGAQNTKESEDSAIF----RPYARRNR  193


 Score = 52.0 bits (123),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS T+QQ +  VT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTNQQAEHLVT  98



>gb|KJB10959.1| hypothetical protein B456_001G233800 [Gossypium raimondii]
Length=2019

 Score = 99.8 bits (247),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSFA TASPH DSVES  RPG   +CEP+SAD+L+LF GENE  EGE R S N  +
Sbjct  99   SDAKGSFAPTASPHGDSVESSGRPGIPAVCEPSSADSLLLFSGENELPEGE-RKSMNSRK  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +T  P EQS+RMDG Q+ KE  DSA F    + Y RR R
Sbjct  158  WNTVFPSEQSSRMDGAQNTKESEDSAIF----RPYARRNR  193


 Score = 52.0 bits (123),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSVQSTS T+QQ +  VT
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTNQQAEHLVT  98



>gb|KJB26103.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
Length=1984

 Score = 97.1 bits (240),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA +AS + DSVES  RPG    CEPNSADNL+LFDGENE  EGE++   +  R
Sbjct  99   SEAKGSFAQSASAYGDSVESSGRPGVPAACEPNSADNLLLFDGENELPEGERKSMHSRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+ M+G Q+ KE  DS  F    + Y RR R
Sbjct  159  NTVVPSEQSSHMEGTQNVKESEDSTIF----RPYARRYR  193


 Score = 54.3 bits (129),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FKYGNAASVSVQSTS TDQ    FVT
Sbjct  63   FLEKGGNPLDFKYGNAASVSVQSTSLTDQHAQLFVT  98



>gb|KJB26102.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
Length=1912

 Score = 96.7 bits (239),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA +AS + DSVES  RPG    CEPNSADNL+LFDGENE  EGE++   +  R
Sbjct  99   SEAKGSFAQSASAYGDSVESSGRPGVPAACEPNSADNLLLFDGENELPEGERKSMHSRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+ M+G Q+ KE  DS  F    + Y RR R
Sbjct  159  NTVVPSEQSSHMEGTQNVKESEDSTIF----RPYARRYR  193


 Score = 54.3 bits (129),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FKYGNAASVSVQSTS TDQ    FVT
Sbjct  63   FLEKGGNPLDFKYGNAASVSVQSTSLTDQHAQLFVT  98



>gb|KJB26105.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
Length=2002

 Score = 96.7 bits (239),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA +AS + DSVES  RPG    CEPNSADNL+LFDGENE  EGE++   +  R
Sbjct  99   SEAKGSFAQSASAYGDSVESSGRPGVPAACEPNSADNLLLFDGENELPEGERKSMHSRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+ M+G Q+ KE  DS  F    + Y RR R
Sbjct  159  NTVVPSEQSSHMEGTQNVKESEDSTIF----RPYARRYR  193


 Score = 54.3 bits (129),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FKYGNAASVSVQSTS TDQ    FVT
Sbjct  63   FLEKGGNPLDFKYGNAASVSVQSTSLTDQHAQLFVT  98



>gb|KJB26106.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
 gb|KJB26107.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
Length=2001

 Score = 96.7 bits (239),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA +AS + DSVES  RPG    CEPNSADNL+LFDGENE  EGE++   +  R
Sbjct  99   SEAKGSFAQSASAYGDSVESSGRPGVPAACEPNSADNLLLFDGENELPEGERKSMHSRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+ M+G Q+ KE  DS  F    + Y RR R
Sbjct  159  NTVVPSEQSSHMEGTQNVKESEDSTIF----RPYARRYR  193


 Score = 54.3 bits (129),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FKYGNAASVSVQSTS TDQ    FVT
Sbjct  63   FLEKGGNPLDFKYGNAASVSVQSTSLTDQHAQLFVT  98



>gb|KJB26101.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
 gb|KJB26108.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
Length=2013

 Score = 96.7 bits (239),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA +AS + DSVES  RPG    CEPNSADNL+LFDGENE  EGE++   +  R
Sbjct  99   SEAKGSFAQSASAYGDSVESSGRPGVPAACEPNSADNLLLFDGENELPEGERKSMHSRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+ M+G Q+ KE  DS  F    + Y RR R
Sbjct  159  NTVVPSEQSSHMEGTQNVKESEDSTIF----RPYARRYR  193


 Score = 53.9 bits (128),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FKYGNAASVSVQSTS TDQ    FVT
Sbjct  63   FLEKGGNPLDFKYGNAASVSVQSTSLTDQHAQLFVT  98



>gb|KJB26104.1| hypothetical protein B456_004G226000 [Gossypium raimondii]
Length=2014

 Score = 96.7 bits (239),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA +AS + DSVES  RPG    CEPNSADNL+LFDGENE  EGE++   +  R
Sbjct  99   SEAKGSFAQSASAYGDSVESSGRPGVPAACEPNSADNLLLFDGENELPEGERKSMHSRKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+ M+G Q+ KE  DS  F    + Y RR R
Sbjct  159  NTVVPSEQSSHMEGTQNVKESEDSTIF----RPYARRYR  193


 Score = 53.9 bits (128),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FKYGNAASVSVQSTS TDQ    FVT
Sbjct  63   FLEKGGNPLDFKYGNAASVSVQSTSLTDQHAQLFVT  98



>ref|XP_008382623.1| PREDICTED: uncharacterized protein LOC103445394 isoform X6 [Malus 
domestica]
Length=1471

 Score = 93.6 bits (231),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVR-LSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  158  RNXKGPSEQFSQMDGTQNPKESEDSTMF----RPYARRNR  193


 Score = 57.4 bits (137),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  63   FLEKGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_008382616.1| PREDICTED: uncharacterized protein LOC103445394 isoform X1 [Malus 
domestica]
 ref|XP_008382617.1| PREDICTED: uncharacterized protein LOC103445394 isoform X1 [Malus 
domestica]
 ref|XP_008382618.1| PREDICTED: uncharacterized protein LOC103445394 isoform X1 [Malus 
domestica]
Length=2020

 Score = 94.4 bits (233),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVR-LSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  158  RNXKGPSEQFSQMDGTQNPKESEDSTMF----RPYARRNR  193


 Score = 56.2 bits (134),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  63   FLEKGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_008382622.1| PREDICTED: uncharacterized protein LOC103445394 isoform X5 [Malus 
domestica]
Length=2000

 Score = 94.4 bits (233),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVR-LSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  158  RNXKGPSEQFSQMDGTQNPKESEDSTMF----RPYARRNR  193


 Score = 56.2 bits (134),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  63   FLEKGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_008382619.1| PREDICTED: uncharacterized protein LOC103445394 isoform X2 [Malus 
domestica]
Length=2019

 Score = 94.4 bits (233),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVR-LSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  158  RNXKGPSEQFSQMDGTQNPKESEDSTMF----RPYARRNR  193


 Score = 56.2 bits (134),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  63   FLEKGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_008382621.1| PREDICTED: uncharacterized protein LOC103445394 isoform X4 [Malus 
domestica]
Length=2001

 Score = 94.4 bits (233),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVR-LSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  158  RNXKGPSEQFSQMDGTQNPKESEDSTMF----RPYARRNR  193


 Score = 56.2 bits (134),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  63   FLEKGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_009334923.1| PREDICTED: uncharacterized protein LOC103927702 isoform X4 [Pyrus 
x bretschneideri]
Length=2008

 Score = 94.7 bits (234),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R LSR
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVR-LSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +   P EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  158  RNNKGPSEQFSQMDGTQNPKESEDSTIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>gb|KHF98888.1| E1A-binding p400 [Gossypium arboreum]
 gb|KHG26648.1| E1A-binding p400 [Gossypium arboreum]
Length=1514

 Score = 96.7 bits (239),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPG   +CEPNSADNL+LF GENE  EGE++      +
Sbjct  99   SEAKGSFGLTASPHGDSVESSGRPGIPAVCEPNSADNLLLFHGENELPEGERKSMHPRKK  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++M   Q+ KE  DSA F    + Y RR R
Sbjct  159  HTVVPSEQSSQMGRTQNVKESEDSAIF----RPYARRNR  193


 Score = 53.9 bits (128),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GNAASVSVQSTS TDQQ + F
Sbjct  66   KGGNPLDFKFGNAASVSVQSTSLTDQQAEHF  96



>ref|XP_009334921.1| PREDICTED: uncharacterized protein LOC103927702 isoform X2 [Pyrus 
x bretschneideri]
Length=2027

 Score = 94.4 bits (233),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R   R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVRLSRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  159  NNKGPSEQFSQMDGTQNPKESEDSTIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_009334922.1| PREDICTED: uncharacterized protein LOC103927702 isoform X3 [Pyrus 
x bretschneideri]
Length=2023

 Score = 94.4 bits (233),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R   R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVRLSRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  159  NNKGPSEQFSQMDGTQNPKESEDSTIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>ref|XP_009334920.1| PREDICTED: uncharacterized protein LOC103927702 isoform X1 [Pyrus 
x bretschneideri]
Length=2028

 Score = 94.4 bits (233),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R   R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVRLSRR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  159  NNKGPSEQFSQMDGTQNPKESEDSTIF----RPYARRNR  193


 Score = 55.8 bits (133),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ P+QFVT
Sbjct  66   KGGNPLDFKIGNGASVSVQSTSLTDQHPEQFVT  98



>gb|KHG21869.1| E1A-binding p400 [Gossypium arboreum]
Length=1979

 Score = 97.8 bits (242),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSFA TASPH DSVES  RPG   +CEP+SAD+L+LF GENE  EGE++  ++   
Sbjct  99   SDAKGSFAPTASPHGDSVESSGRPGIPAVCEPSSADSLLLFSGENELPEGERKSMKSRKW  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG Q+ KE  DSA F    + Y RR R
Sbjct  159  NTVVPSEQSSQMDGAQNTKESEDSAIF----RPYARRNR  193


 Score = 52.0 bits (123),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GNAASVSV+STS TDQQ +  VT
Sbjct  66   KGGNPLDFKFGNAASVSVRSTSLTDQQAEHLVT  98



>ref|XP_007134093.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 ref|XP_007134094.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06087.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06088.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
Length=1973

 Score = 98.6 bits (244),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 70/100 (70%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQR-ISRNLS  122
            SEAKGSFA TASPH DSV+S  RPG  L  EPN+ADNL+LFD ENE  E E+R ++R   
Sbjct  99   SEAKGSFALTASPHADSVDSSARPGPPLASEPNTADNLLLFDRENELPETERRCLNR---  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R + A  EQS+++DG+Q+AKE  DSA F    + Y RR R
Sbjct  156  RNNIAASEQSSQIDGSQNAKETEDSAIF----RPYARRNR  191


 Score = 51.2 bits (121),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKSGNGASVSVQSTSITDQPHEQFVT  98



>ref|XP_007134092.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 ref|XP_007134099.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06086.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06093.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
Length=1974

 Score = 98.6 bits (244),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 70/100 (70%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQR-ISRNLS  122
            SEAKGSFA TASPH DSV+S  RPG  L  EPN+ADNL+LFD ENE  E E+R ++R   
Sbjct  99   SEAKGSFALTASPHADSVDSSARPGPPLASEPNTADNLLLFDRENELPETERRCLNR---  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R + A  EQS+++DG+Q+AKE  DSA F    + Y RR R
Sbjct  156  RNNIAASEQSSQIDGSQNAKETEDSAIF----RPYARRNR  191


 Score = 51.2 bits (121),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKSGNGASVSVQSTSITDQPHEQFVT  98



>ref|XP_007134096.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 ref|XP_007134097.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06090.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06091.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
Length=1977

 Score = 98.6 bits (244),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 70/100 (70%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQR-ISRNLS  122
            SEAKGSFA TASPH DSV+S  RPG  L  EPN+ADNL+LFD ENE  E E+R ++R   
Sbjct  99   SEAKGSFALTASPHADSVDSSARPGPPLASEPNTADNLLLFDRENELPETERRCLNR---  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R + A  EQS+++DG+Q+AKE  DSA F    + Y RR R
Sbjct  156  RNNIAASEQSSQIDGSQNAKETEDSAIF----RPYARRNR  191


 Score = 51.2 bits (121),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKSGNGASVSVQSTSITDQPHEQFVT  98



>ref|XP_007134095.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 ref|XP_007134098.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06089.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
 gb|ESW06092.1| hypothetical protein PHAVU_010G018800g [Phaseolus vulgaris]
Length=1976

 Score = 98.6 bits (244),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 70/100 (70%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQR-ISRNLS  122
            SEAKGSFA TASPH DSV+S  RPG  L  EPN+ADNL+LFD ENE  E E+R ++R   
Sbjct  99   SEAKGSFALTASPHADSVDSSARPGPPLASEPNTADNLLLFDRENELPETERRCLNR---  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            R + A  EQS+++DG+Q+AKE  DSA F    + Y RR R
Sbjct  156  RNNIAASEQSSQIDGSQNAKETEDSAIF----RPYARRNR  191


 Score = 51.2 bits (121),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKSGNGASVSVQSTSITDQPHEQFVT  98



>gb|KCW58061.1| hypothetical protein EUGRSUZ_H00795 [Eucalyptus grandis]
Length=1927

 Score = 94.4 bits (233),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = -1

Query  295  EAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRT  116
            EAKGSFA TASPH DS+ES  RP A  +CEPNSADNL+LFD ENE  EG ++  R   + 
Sbjct  54   EAKGSFALTASPHGDSIESSGRPAAPPVCEPNSADNLLLFDSENELPEGSKKSIRADKKN  113

Query  115  STATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
                  QS++MDG++S K+  +SA F    + Y RR R
Sbjct  114  FIMPSVQSSQMDGSRSVKDSEESAIF----RPYARRNR  147


 Score = 53.9 bits (128),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -2

Query  489  LQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +QGG+PL+FK+GN ASVS QS SP D+ P+QFV+
Sbjct  19   IQGGNPLDFKFGNVASVSGQSASPIDRHPEQFVS  52



>gb|KDP26381.1| hypothetical protein JCGZ_17539 [Jatropha curcas]
Length=2039

 Score = 96.7 bits (239),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 64/99 (65%), Gaps = 7/99 (7%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  RPGA  +CEPNSADN   FDGENE +EG +       R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRPGAHTVCEPNSADN---FDGENEILEGNRHTKHPNRR  155

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS++MDG Q+ KE  DSA      + Y RR R
Sbjct  156  SNIIPSEQSSQMDGTQNPKESEDSAIV----RPYARRNR  190


 Score = 50.1 bits (118),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+G+AASVSVQSTS TD   + FVT
Sbjct  66   KGGNPLDFKFGSAASVSVQSTSLTDHHTEHFVT  98



>ref|XP_010069648.1| PREDICTED: uncharacterized protein LOC104456538 isoform X2 [Eucalyptus 
grandis]
Length=1915

 Score = 94.4 bits (233),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = -1

Query  295  EAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRT  116
            EAKGSFA TASPH DS+ES  RP A  +CEPNSADNL+LFD ENE  EG ++  R   + 
Sbjct  82   EAKGSFALTASPHGDSIESSGRPAAPPVCEPNSADNLLLFDSENELPEGSKKSIRADKKN  141

Query  115  STATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
                  QS++MDG++S K+  +SA F    + Y RR R
Sbjct  142  FIMPSVQSSQMDGSRSVKDSEESAIF----RPYARRNR  175


 Score = 52.0 bits (123),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+GN ASVS QS SP D+ P+QFV+
Sbjct  45   FLEKGGNPLDFKFGNVASVSGQSASPIDRHPEQFVS  80



>ref|XP_010069646.1| PREDICTED: uncharacterized protein LOC104456538 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010069647.1| PREDICTED: uncharacterized protein LOC104456538 isoform X1 [Eucalyptus 
grandis]
Length=1955

 Score = 94.4 bits (233),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = -1

Query  295  EAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRT  116
            EAKGSFA TASPH DS+ES  RP A  +CEPNSADNL+LFD ENE  EG ++  R   + 
Sbjct  82   EAKGSFALTASPHGDSIESSGRPAAPPVCEPNSADNLLLFDSENELPEGSKKSIRADKKN  141

Query  115  STATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
                  QS++MDG++S K+  +SA F    + Y RR R
Sbjct  142  FIMPSVQSSQMDGSRSVKDSEESAIF----RPYARRNR  175


 Score = 52.0 bits (123),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+GN ASVS QS SP D+ P+QFV+
Sbjct  45   FLEKGGNPLDFKFGNVASVSGQSASPIDRHPEQFVS  80



>ref|XP_011024663.1| PREDICTED: uncharacterized protein LOC105125769 isoform X2 [Populus 
euphratica]
Length=2032

 Score = 95.9 bits (237),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPGAT +CEPNSADN   FDGENE +E E R  ++  R
Sbjct  99   SEAKGSFPLTASPHGDSVESSGRPGATPVCEPNSADN---FDGENELLEVE-RKRKHPRR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  155  NNVTQSEQSSQMDGIHNAKESEDSAIF----RPYARRNR  189


 Score = 49.7 bits (117),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSLTDHHVEQFVT  98



>ref|XP_011024664.1| PREDICTED: uncharacterized protein LOC105125769 isoform X3 [Populus 
euphratica]
Length=2031

 Score = 95.9 bits (237),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPGAT +CEPNSADN   FDGENE +E E R  ++  R
Sbjct  99   SEAKGSFPLTASPHGDSVESSGRPGATPVCEPNSADN---FDGENELLEVE-RKRKHPRR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  155  NNVTQSEQSSQMDGIHNAKESEDSAIF----RPYARRNR  189


 Score = 49.7 bits (117),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSLTDHHVEQFVT  98



>ref|XP_011024662.1| PREDICTED: uncharacterized protein LOC105125769 isoform X1 [Populus 
euphratica]
Length=2033

 Score = 95.9 bits (237),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPGAT +CEPNSADN   FDGENE +E E R  ++  R
Sbjct  99   SEAKGSFPLTASPHGDSVESSGRPGATPVCEPNSADN---FDGENELLEVE-RKRKHPRR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  155  NNVTQSEQSSQMDGIHNAKESEDSAIF----RPYARRNR  189


 Score = 49.7 bits (117),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSLTDHHVEQFVT  98



>ref|XP_011024665.1| PREDICTED: uncharacterized protein LOC105125769 isoform X4 [Populus 
euphratica]
Length=2017

 Score = 95.5 bits (236),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPGAT +CEPNSADN   FDGENE +E E R  ++  R
Sbjct  99   SEAKGSFPLTASPHGDSVESSGRPGATPVCEPNSADN---FDGENELLEVE-RKRKHPRR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  155  NNVTQSEQSSQMDGIHNAKESEDSAIF----RPYARRNR  189


 Score = 49.7 bits (117),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSLTDHHVEQFVT  98



>ref|XP_011024666.1| PREDICTED: uncharacterized protein LOC105125769 isoform X5 [Populus 
euphratica]
Length=2014

 Score = 95.5 bits (236),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPGAT +CEPNSADN   FDGENE +E E R  ++  R
Sbjct  99   SEAKGSFPLTASPHGDSVESSGRPGATPVCEPNSADN---FDGENELLEVE-RKRKHPRR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  155  NNVTQSEQSSQMDGIHNAKESEDSAIF----RPYARRNR  189


 Score = 49.7 bits (117),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSLTDHHVEQFVT  98



>ref|XP_011024667.1| PREDICTED: uncharacterized protein LOC105125769 isoform X6 [Populus 
euphratica]
Length=1985

 Score = 95.5 bits (236),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPGAT +CEPNSADN   FDGENE +E E R  ++  R
Sbjct  99   SEAKGSFPLTASPHGDSVESSGRPGATPVCEPNSADN---FDGENELLEVE-RKRKHPRR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  155  NNVTQSEQSSQMDGIHNAKESEDSAIF----RPYARRNR  189


 Score = 49.7 bits (117),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSLTDHHVEQFVT  98



>ref|XP_002303042.2| hypothetical protein POPTR_0002s24490g [Populus trichocarpa]
 gb|EEE82315.2| hypothetical protein POPTR_0002s24490g [Populus trichocarpa]
Length=1545

 Score = 96.3 bits (238),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 65/99 (66%), Gaps = 7/99 (7%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES  RPGAT +CEPNSADN   FDGENE +E E++      R
Sbjct  99   SEAKGSFPLTASPHGDSVESSGRPGATPVCEPNSADN---FDGENELLEVERKRKHPSRR  155

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  156  NNVTQSEQSSQMDGIHNAKESEDSAIF----RPYARRNR  190


 Score = 48.5 bits (114),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NA SVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNATSVSVQSTSLTDHHVEQFVT  98



>ref|XP_010241374.1| PREDICTED: uncharacterized protein LOC104585998 isoform X1 [Nelumbo 
nucifera]
Length=2125

 Score = 98.6 bits (244),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA  ASPH DSVES  RPGA    E NSADNL+LFDGEN+ VE E R S N SR
Sbjct  99   SEAKGSFALAASPHGDSVESSGRPGAPSGREQNSADNLLLFDGENDLVESE-RNSVNPSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
             +   P EQS+++DGN +AKE  DS+   F V  +AY RR R
Sbjct  158  RNNVAPSEQSSQLDGNHNAKESEDSSILRFVVKSQAYARRNR  199


 Score = 46.2 bits (108),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK G A S SVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGPATSFSVQSTSFTDQLAEQFVT  98



>ref|XP_010241375.1| PREDICTED: uncharacterized protein LOC104585998 isoform X2 [Nelumbo 
nucifera]
Length=2124

 Score = 98.6 bits (244),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA  ASPH DSVES  RPGA    E NSADNL+LFDGEN+ VE E R S N SR
Sbjct  99   SEAKGSFALAASPHGDSVESSGRPGAPSGREQNSADNLLLFDGENDLVESE-RNSVNPSR  157

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
             +   P EQS+++DGN +AKE  DS+   F V  +AY RR R
Sbjct  158  RNNVAPSEQSSQLDGNHNAKESEDSSILRFVVKSQAYARRNR  199


 Score = 46.2 bits (108),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK G A S SVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGPATSFSVQSTSFTDQLAEQFVT  98



>ref|NP_001189965.1| Helicase/SANT-associated, DNA binding protein [Arabidopsis thaliana]
 gb|AEE76956.1| Helicase/SANT-associated, DNA binding protein [Arabidopsis thaliana]
Length=1899

 Score = 90.5 bits (223),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  93   SEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQ  152

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++   NQ+ KE  DSA F    + Y RR R
Sbjct  153  NRTSESERSSKAHTNQNTKETEDSAIF----RPYARRNR  187


 Score = 51.6 bits (122),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  504  LYLFSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            L  + LQGG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  54   LLFYLLQGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  91



>ref|XP_002321281.2| hypothetical protein POPTR_0014s19020g [Populus trichocarpa]
 gb|EEE99596.2| hypothetical protein POPTR_0014s19020g [Populus trichocarpa]
Length=2008

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 63/99 (64%), Gaps = 7/99 (7%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKG+F  T S H DSVES  RPGAT +CEPNSADN   FDGENE +E E++ +    R
Sbjct  99   SEAKGNFPLTTSLHGDSVESSGRPGATAVCEPNSADN---FDGENELLEVERKPTNPSRR  155

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
                  EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  156  NKVTQSEQSSQMDGTHNAKESEDSAIF----RPYARRNR  190


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSLTDHHVEQFVT  98



>ref|XP_008382620.1| PREDICTED: uncharacterized protein LOC103445394 isoform X3 [Malus 
domestica]
Length=2016

 Score = 92.8 bits (229),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = -1

Query  295  EAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRT  116
            EAKGSFA TASPH DSVES  RP    +CEPNSADNL+LFDG ++  EGE    R LSR 
Sbjct  96   EAKGSFALTASPHGDSVESSGRPEVPTLCEPNSADNLLLFDGGSDAPEGEMNSVR-LSRR  154

Query  115  STATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +   P EQ ++MDG Q+ KE  DS  F    + Y RR R
Sbjct  155  NXKGPSEQFSQMDGTQNPKESEDSTMF----RPYARRNR  189


 Score = 48.5 bits (114),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQ  397
            F  +GG+PL+FK GN ASVSVQSTS TDQ P+ 
Sbjct  63   FLEKGGNPLDFKIGNGASVSVQSTSLTDQHPEH  95



>ref|XP_010685017.1| PREDICTED: uncharacterized protein LOC104899514 [Beta vulgaris 
subsp. vulgaris]
Length=1971

 Score = 89.4 bits (220),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 5/93 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TASPH DSVES  R G T  CEPNSADN   FDGENE +E E R S++ +R
Sbjct  99   SEAKGSFALTASPHGDSVESSGRLGITTACEPNSADN---FDGENEMLESE-RKSKHPTR  154

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKA  20
             S    E+S+++DG+Q+ KE  DS  F  P+K 
Sbjct  155  GSITPSERSSQLDGSQNVKESEDSPIFH-PKKG  186


 Score = 52.0 bits (123),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+G+AASVSVQSTS T Q PDQ +T
Sbjct  66   KGGNPLDFKFGHAASVSVQSTSHTYQHPDQILT  98



>gb|KHG16179.1| E1A-binding p400 [Gossypium arboreum]
Length=1931

 Score = 91.3 bits (225),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 65/98 (66%), Gaps = 5/98 (5%)
 Frame = -1

Query  295  EAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRT  116
            EAKGSF  T SPH DS+ES  RP    ICEPNSADNL+LFDGENE + G +R S +  R 
Sbjct  99   EAKGSFTPTISPHGDSIESSGRPPVPAICEPNSADNLLLFDGENE-LPGCERKSMHHKRN  157

Query  115  STATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +    EQS++++G ++AKE  DSA F    + Y RR R
Sbjct  158  NVVPSEQSSQINGTRNAKESEDSAIF----RPYARRNR  191


 Score = 47.8 bits (112),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPD  400
            F  +GG+PL+FK+GNAASVSVQS S TDQQ +
Sbjct  63   FLEKGGNPLDFKFGNAASVSVQSISFTDQQAE  94



>gb|KJB10168.1| hypothetical protein B456_001G187100 [Gossypium raimondii]
Length=1933

 Score = 90.1 bits (222),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -1

Query  295  EAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRT  116
            EAKGSFA T SPH DS+ES  RP    ICEPNSADNL+LFDGENE    E++      R 
Sbjct  99   EAKGSFAPTISPHGDSIESSGRPRVPAICEPNSADNLLLFDGENELPGCERKSMHPYKRN  158

Query  115  STATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +    E+S++++G ++AKE  DSA F    + Y RR R
Sbjct  159  NVVPSEKSSQINGTRNAKESEDSAIF----RPYARRNR  192


 Score = 47.8 bits (112),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPD  400
            +GG+PL+FK+GNAASVSVQS S TDQQ +
Sbjct  66   KGGNPLDFKFGNAASVSVQSISFTDQQAE  94



>ref|XP_010468476.1| PREDICTED: uncharacterized protein LOC104748554 [Camelina sativa]
Length=1799

 Score = 91.3 bits (225),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.6 bits (109),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  96



>ref|XP_011011420.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105115993 
[Populus euphratica]
Length=2082

 Score = 87.8 bits (216),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 7/99 (7%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKG+F  T S H DSVE+  RPGAT +C PNSADN   FDGENE +E E++ +    R
Sbjct  99   SEAKGNFPLTTSLHGDSVETSGRPGATAVCGPNSADN---FDGENELLEVERKPTNPSRR  155

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +     EQS++MDG  +AKE  DSA F    + Y RR R
Sbjct  156  SKVTQSEQSSQMDGIHNAKEPEDSAIF----RPYARRNR  190


 Score = 49.7 bits (117),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+ NAASVSVQSTS TD   +QFVT
Sbjct  66   KGGNPLDFKFVNAASVSVQSTSFTDHHVEQFVT  98



>ref|NP_189131.5| Helicase/SANT-associated, DNA binding protein [Arabidopsis thaliana]
 gb|AEE76955.1| Helicase/SANT-associated, DNA binding protein [Arabidopsis thaliana]
Length=1907

 Score = 90.9 bits (224),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++   NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKAHTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.2 bits (108),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  96



>dbj|BAB02897.1| unnamed protein product [Arabidopsis thaliana]
Length=1836

 Score = 90.9 bits (224),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++   NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKAHTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.2 bits (108),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  96



>dbj|BAB02898.1| unnamed protein product [Arabidopsis thaliana]
Length=1909

 Score = 90.9 bits (224),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++   NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKAHTNQNTKETEDSAIF----RPYARRNR  192


 Score = 45.8 bits (107),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  96



>ref|XP_004154474.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223382 
[Cucumis sativus]
Length=1953

 Score = 95.9 bits (237),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES   PG    CEPNSADNL+L  G NE   GE+   R  S+
Sbjct  99   SEAKGSFVLTASPHGDSVESSGIPGPPTTCEPNSADNLLLLRGANELSGGERTSRRPSSK  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DG+Q+ KE  DSA F    K Y RR R
Sbjct  159  AAVAPSEQSSQLDGSQNNKETEDSAIF----KPYARRHR  193


 Score = 40.8 bits (94),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GN  +   QSTS  DQ PDQ 
Sbjct  66   KGGNPLDFKFGNNTTSVSQSTSLADQLPDQL  96



>gb|KGN44605.1| hypothetical protein Csa_7G341250 [Cucumis sativus]
Length=1931

 Score = 95.9 bits (237),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES   PG    CEPNSADNL+L  G NE   GE+   R  S+
Sbjct  81   SEAKGSFVLTASPHGDSVESSGIPGPPTTCEPNSADNLLLLRGANELSGGERTSRRPSSK  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DG+Q+ KE  DSA F    K Y RR R
Sbjct  141  AAVAPSEQSSQLDGSQNNKETEDSAIF----KPYARRHR  175


 Score = 40.8 bits (94),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GN  +   QSTS  DQ PDQ 
Sbjct  48   KGGNPLDFKFGNNTTSVSQSTSLADQLPDQL  78



>ref|NP_189132.2| Helicase/SANT-associated, DNA binding protein [Arabidopsis thaliana]
 gb|AEE76957.1| Helicase/SANT-associated, DNA binding protein [Arabidopsis thaliana]
Length=1957

 Score = 90.5 bits (223),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++   NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKAHTNQNTKETEDSAIF----RPYARRNR  192


 Score = 45.8 bits (107),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  96



>ref|XP_002885676.1| hypothetical protein ARALYDRAFT_480005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61935.1| hypothetical protein ARALYDRAFT_480005 [Arabidopsis lyrata subsp. 
lyrata]
Length=1980

 Score = 91.3 bits (225),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSDSERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 45.4 bits (106),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + F+
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFI  96



>ref|XP_004150965.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221686, 
partial [Cucumis sativus]
Length=1132

 Score = 95.1 bits (235),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES   PG    CEPNSADNL+L  G NE   GE+   R  S+
Sbjct  99   SEAKGSFVLTASPHGDSVESSGIPGPPTTCEPNSADNLLLLRGANELSGGERTSRRPSSK  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DG+Q+ KE  DSA F    K Y RR R
Sbjct  159  AAVAPSEQSSQLDGSQNNKETEDSAIF----KPYARRHR  193


 Score = 41.6 bits (96),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GN  +   QSTS  DQ PDQ 
Sbjct  66   KGGNPLDFKFGNNTTSVSQSTSLADQLPDQL  96



>ref|XP_008458010.1| PREDICTED: uncharacterized protein LOC103497550 [Cucumis melo]
 ref|XP_008458011.1| PREDICTED: uncharacterized protein LOC103497550 [Cucumis melo]
 ref|XP_008458012.1| PREDICTED: uncharacterized protein LOC103497550 [Cucumis melo]
 ref|XP_008458013.1| PREDICTED: uncharacterized protein LOC103497550 [Cucumis melo]
Length=1929

 Score = 95.9 bits (237),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSVES   PG    CEPNSADNL+L  G NE   GE+   R  S+
Sbjct  81   SEAKGSFVLTASPHGDSVESSGIPGPPTTCEPNSADNLLLLRGANELSGGERTSRRPSSK  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+++DG+Q+ KE  DSA F    K Y RR R
Sbjct  141  AAVAPSEQSSQLDGSQNNKETEDSAIF----KPYARRHR  175


 Score = 40.8 bits (94),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQF  394
            +GG+PL+FK+GN  +   QSTS  DQ PDQ 
Sbjct  48   KGGNPLDFKFGNNTTSVSQSTSLADQLPDQL  78



>ref|XP_010550893.1| PREDICTED: uncharacterized protein LOC104821651 isoform X5 [Tarenaya 
hassleriana]
Length=1840

 Score = 89.7 bits (221),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPNSADNL+LFDGENE +E E R SR  ++
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTVSEPNSADNLLLFDGENEPLERE-RNSRTSNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    E+S++ + NQ++KE  DSA F    + Y RR R
Sbjct  157  RNRTESERSSQANANQNSKEREDSAIF----RPYARRNR  191


 Score = 46.6 bits (109),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GN  S SVQSTS TD Q D  V+
Sbjct  65   KGGNPLDFKFGNTTSQSVQSTSLTDHQADHLVS  97



>ref|XP_010550887.1| PREDICTED: uncharacterized protein LOC104821651 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010550888.1| PREDICTED: uncharacterized protein LOC104821651 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010550889.1| PREDICTED: uncharacterized protein LOC104821651 isoform X1 [Tarenaya 
hassleriana]
Length=1844

 Score = 89.7 bits (221),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPNSADNL+LFDGENE +E E R SR  ++
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTVSEPNSADNLLLFDGENEPLERE-RNSRTSNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    E+S++ + NQ++KE  DSA F    + Y RR R
Sbjct  157  RNRTESERSSQANANQNSKEREDSAIF----RPYARRNR  191


 Score = 46.6 bits (109),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GN  S SVQSTS TD Q D  V+
Sbjct  65   KGGNPLDFKFGNTTSQSVQSTSLTDHQADHLVS  97



>ref|XP_010550892.1| PREDICTED: uncharacterized protein LOC104821651 isoform X4 [Tarenaya 
hassleriana]
Length=1841

 Score = 89.7 bits (221),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPNSADNL+LFDGENE +E E R SR  ++
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTVSEPNSADNLLLFDGENEPLERE-RNSRTSNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    E+S++ + NQ++KE  DSA F    + Y RR R
Sbjct  157  RNRTESERSSQANANQNSKEREDSAIF----RPYARRNR  191


 Score = 46.6 bits (109),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GN  S SVQSTS TD Q D  V+
Sbjct  65   KGGNPLDFKFGNTTSQSVQSTSLTDHQADHLVS  97



>ref|XP_010550890.1| PREDICTED: uncharacterized protein LOC104821651 isoform X2 [Tarenaya 
hassleriana]
Length=1843

 Score = 89.7 bits (221),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPNSADNL+LFDGENE +E E R SR  ++
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTVSEPNSADNLLLFDGENEPLERE-RNSRTSNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    E+S++ + NQ++KE  DSA F    + Y RR R
Sbjct  157  RNRTESERSSQANANQNSKEREDSAIF----RPYARRNR  191


 Score = 46.6 bits (109),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GN  S SVQSTS TD Q D  V+
Sbjct  65   KGGNPLDFKFGNTTSQSVQSTSLTDHQADHLVS  97



>ref|XP_010550891.1| PREDICTED: uncharacterized protein LOC104821651 isoform X3 [Tarenaya 
hassleriana]
Length=1842

 Score = 89.7 bits (221),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPNSADNL+LFDGENE +E E R SR  ++
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTVSEPNSADNLLLFDGENEPLERE-RNSRTSNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    E+S++ + NQ++KE  DSA F    + Y RR R
Sbjct  157  RNRTESERSSQANANQNSKEREDSAIF----RPYARRNR  191


 Score = 46.6 bits (109),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+GN  S SVQSTS TD Q D  V+
Sbjct  65   KGGNPLDFKFGNTTSQSVQSTSLTDHQADHLVS  97



>ref|XP_010488606.1| PREDICTED: uncharacterized protein LOC104766415 isoform X4 [Camelina 
sativa]
Length=1906

 Score = 87.8 bits (216),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG     EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTNSEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.6 bits (109),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  96



>ref|XP_010488603.1| PREDICTED: uncharacterized protein LOC104766415 isoform X1 [Camelina 
sativa]
Length=1909

 Score = 87.8 bits (216),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG     EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTNSEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.6 bits (109),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  96



>ref|XP_010488604.1| PREDICTED: uncharacterized protein LOC104766415 isoform X2 [Camelina 
sativa]
Length=1908

 Score = 87.8 bits (216),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG     EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTNSEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.6 bits (109),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  96



>ref|XP_010488609.1| PREDICTED: uncharacterized protein LOC104766415 isoform X6 [Camelina 
sativa]
Length=1909

 Score = 87.8 bits (216),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG     EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTNSEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.6 bits (109),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  96



>ref|XP_010488605.1| PREDICTED: uncharacterized protein LOC104766415 isoform X3 [Camelina 
sativa]
Length=1907

 Score = 87.8 bits (216),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG     EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTNSEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.6 bits (109),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  96



>ref|XP_010488607.1| PREDICTED: uncharacterized protein LOC104766415 isoform X5 [Camelina 
sativa]
 ref|XP_010488608.1| PREDICTED: uncharacterized protein LOC104766415 isoform X5 [Camelina 
sativa]
Length=1892

 Score = 87.8 bits (216),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG     EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  81   SEVKDSFALTASPHGDSVESSGRPGVPTNSEPNTADNLLLFDSENKSVEGERNLRYPNRQ  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  141  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  175


 Score = 46.6 bits (109),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  48   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  79



>gb|KHN11006.1| E1A-binding protein p400 [Glycine soja]
Length=1709

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDG+NE +EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGDNELLEGEKRSLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKLGNGASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006299676.1| hypothetical protein CARUB_v10015863mg [Capsella rubella]
 gb|EOA32574.1| hypothetical protein CARUB_v10015863mg [Capsella rubella]
Length=1918

 Score = 87.0 bits (214),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPN+ADNL+LF+ EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTVSEPNTADNLLLFNSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ K+  DSA F    + Y RR R
Sbjct  158  NRTSETERSSKANTNQNTKDTEDSAIF----RPYARRNR  192


 Score = 46.2 bits (108),  Expect(2) = 9e-23, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  96



>ref|XP_006586244.1| PREDICTED: uncharacterized protein LOC100779997 isoform X5 [Glycine 
max]
Length=1989

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDG+NE +EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGDNELLEGEKRSLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKLGNGASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006586240.1| PREDICTED: uncharacterized protein LOC100779997 isoform X1 [Glycine 
max]
Length=2008

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDG+NE +EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGDNELLEGEKRSLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKLGNGASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006586242.1| PREDICTED: uncharacterized protein LOC100779997 isoform X3 [Glycine 
max]
Length=2006

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDG+NE +EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGDNELLEGEKRSLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKLGNGASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006586245.1| PREDICTED: uncharacterized protein LOC100779997 isoform X6 [Glycine 
max]
Length=1988

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDG+NE +EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGDNELLEGEKRSLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKLGNGASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006586241.1| PREDICTED: uncharacterized protein LOC100779997 isoform X2 [Glycine 
max]
Length=2007

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDG+NE +EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGDNELLEGEKRSLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKLGNGASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>gb|EYU39228.1| hypothetical protein MIMGU_mgv1a000074mg [Erythranthe guttata]
Length=1899

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKG  AFT SPH DSVES RRP A L CEPNSADNL+L D E+ Y EG + +  + +R
Sbjct  98   SEAKGGLAFTTSPHGDSVESNRRPEAAL-CEPNSADNLILLDAEHGYSEGRKSL-LHPNR  155

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    EQS +MD ++  +E GDSAAF +PRKAYKRR R
Sbjct  156  SNVVPSEQSFQMDVSRKTQEHGDSAAFGLPRKAYKRRNR  194


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVTRYFSRVVLVACDHPYIFYYSSNR  319
            F  QGG+PL+FK GN ASVSVQSTS TDQ PDQFVT   ++  L     P+     SNR
Sbjct  62   FLEQGGNPLDFKLGNVASVSVQSTSVTDQHPDQFVTSE-AKGGLAFTTSPHGDSVESNR  119



>ref|XP_006418678.1| hypothetical protein EUTSA_v10002368mg [Eutrema salsugineum]
 gb|ESQ37114.1| hypothetical protein EUTSA_v10002368mg [Eutrema salsugineum]
Length=1905

 Score = 87.0 bits (214),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA  ASPH DSVES  RPG   I EPN+ADNL+LFD EN+  EGE+ +     +
Sbjct  98   SEVKDSFALAASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSAEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 45.8 bits (107),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  96



>gb|EYU40613.1| hypothetical protein MIMGU_mgv1a0000831mg, partial [Erythranthe 
guttata]
Length=1149

 Score = 96.3 bits (238),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGS AFTASPH DSVES  R G     E N ADNL+LFD E+E+ EG++  S + SR
Sbjct  96   SEAKGSIAFTASPHGDSVESSGRLGEKPF-ESNGADNLVLFDAEHEFSEGDKN-SLHASR  153

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            ++    E+ +++ G Q  +E GDSAAF +PRKAYKRR R
Sbjct  154  SNIVPSEKLSQVGGIQRTREHGDSAAFGIPRKAYKRRYR  192


 Score = 35.8 bits (81),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 1/30 (3%)
 Frame = -2

Query  495  FSLQGGDPLEF-KYGNAASVSVQSTSPTDQ  409
            F  +GGDP+E+ K  +AASVSV STS TDQ
Sbjct  63   FLEEGGDPMEYYKIRSAASVSVHSTSFTDQ  92



>ref|XP_010527244.1| PREDICTED: uncharacterized protein LOC104804615 isoform X4 [Tarenaya 
hassleriana]
Length=1922

 Score = 83.6 bits (205),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPN+ADNL+LFDGE E +E E   SR+ ++
Sbjct  98   SEVKDSFALTASPHGDSVESGGRPGVPTVSEPNTADNLLLFDGEKELLERETN-SRSFNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A   + ++ + NQ+ KE  DSA F    + Y RR R
Sbjct  157  RNKAESVRCSQENTNQNVKETEDSAIF----RPYARRNR  191


 Score = 48.1 bits (113),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+GN  S SVQS S TDQQ DQ V
Sbjct  65   KGGNPLDFKFGNTTSHSVQSPSSTDQQADQLV  96



>ref|XP_010527245.1| PREDICTED: uncharacterized protein LOC104804615 isoform X5 [Tarenaya 
hassleriana]
Length=1922

 Score = 83.6 bits (205),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPN+ADNL+LFDGE E +E E   SR+ ++
Sbjct  98   SEVKDSFALTASPHGDSVESGGRPGVPTVSEPNTADNLLLFDGEKELLERETN-SRSFNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A   + ++ + NQ+ KE  DSA F    + Y RR R
Sbjct  157  RNKAESVRCSQENTNQNVKETEDSAIF----RPYARRNR  191


 Score = 48.1 bits (113),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+GN  S SVQS S TDQQ DQ V
Sbjct  65   KGGNPLDFKFGNTTSHSVQSPSSTDQQADQLV  96



>ref|XP_010527243.1| PREDICTED: uncharacterized protein LOC104804615 isoform X3 [Tarenaya 
hassleriana]
Length=1923

 Score = 83.6 bits (205),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPN+ADNL+LFDGE E +E E   SR+ ++
Sbjct  98   SEVKDSFALTASPHGDSVESGGRPGVPTVSEPNTADNLLLFDGEKELLERETN-SRSFNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A   + ++ + NQ+ KE  DSA F    + Y RR R
Sbjct  157  RNKAESVRCSQENTNQNVKETEDSAIF----RPYARRNR  191


 Score = 48.1 bits (113),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+GN  S SVQS S TDQQ DQ V
Sbjct  65   KGGNPLDFKFGNTTSHSVQSPSSTDQQADQLV  96



>ref|XP_010527240.1| PREDICTED: uncharacterized protein LOC104804615 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527241.1| PREDICTED: uncharacterized protein LOC104804615 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010527242.1| PREDICTED: uncharacterized protein LOC104804615 isoform X1 [Tarenaya 
hassleriana]
Length=1924

 Score = 83.6 bits (205),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG   + EPN+ADNL+LFDGE E +E E   SR+ ++
Sbjct  98   SEVKDSFALTASPHGDSVESGGRPGVPTVSEPNTADNLLLFDGEKELLERETN-SRSFNK  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A   + ++ + NQ+ KE  DSA F    + Y RR R
Sbjct  157  RNKAESVRCSQENTNQNVKETEDSAIF----RPYARRNR  191


 Score = 48.1 bits (113),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+GN  S SVQS S TDQQ DQ V
Sbjct  65   KGGNPLDFKFGNTTSHSVQSPSSTDQQADQLV  96



>ref|XP_010422465.1| PREDICTED: uncharacterized protein LOC104707737 [Camelina sativa]
Length=404

 Score = 87.4 bits (215),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DSVES  RPG     EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDSFALTASPHGDSVESSGRPGVPTNSEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 44.3 bits (103),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSQSVQSTSLTDQQAEHFV  96



>ref|XP_006299914.1| hypothetical protein CARUB_v10016123mg [Capsella rubella]
 gb|EOA32812.1| hypothetical protein CARUB_v10016123mg [Capsella rubella]
Length=1900

 Score = 85.1 bits (209),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K  FA TASP+ DSVES  RPG   I EPN+ADNL+LFD EN+ VEGE+ +     +
Sbjct  98   SEVKDRFALTASPNGDSVESSGRPGVPSISEPNTADNLLLFDSENKSVEGERNLRYPNRQ  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  158  NRTSETERSSKANTNQNTKETEDSAIF----RPYARRNR  192


 Score = 46.2 bits (108),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  65   KGGNPLDFKFGIATSHSVQSTSLTDQQTEHFV  96



>ref|XP_008346247.1| PREDICTED: uncharacterized protein LOC103409211 [Malus domestica]
Length=335

 Score = 73.6 bits (179),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA TAS H DSVES  RP    +CEPNSADNL+LFD +N+  +GE R S +LSR
Sbjct  99   SEAKGSFALTASTHGDSVESSGRPEVPTLCEPNSADNLLLFDADNDAPDGE-RNSMHLSR  157


 Score = 57.8 bits (138),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQQP+QFVT
Sbjct  63   FLEKGGNPLDFKVGNGASVSVQSTSLTDQQPEQFVT  98



>gb|KHN23706.1| E1A-binding protein p400 [Glycine soja]
Length=1921

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE +EGE+R       
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENELLEGEKRSLHPNKS  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006602523.1| PREDICTED: uncharacterized protein LOC100819248 isoform X7 [Glycine 
max]
Length=1988

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE +EGE+R       
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENELLEGEKRSLHPNKS  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006602522.1| PREDICTED: uncharacterized protein LOC100819248 isoform X6 [Glycine 
max]
Length=1989

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE +EGE+R       
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENELLEGEKRSLHPNKS  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006602521.1| PREDICTED: uncharacterized protein LOC100819248 isoform X5 [Glycine 
max]
Length=1990

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE +EGE+R       
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENELLEGEKRSLHPNKS  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_006602517.1| PREDICTED: uncharacterized protein LOC100819248 isoform X1 [Glycine 
max]
 ref|XP_006602518.1| PREDICTED: uncharacterized protein LOC100819248 isoform X2 [Glycine 
max]
 ref|XP_006602519.1| PREDICTED: uncharacterized protein LOC100819248 isoform X3 [Glycine 
max]
 ref|XP_006602520.1| PREDICTED: uncharacterized protein LOC100819248 isoform X4 [Glycine 
max]
Length=1991

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPG   + EPN+ADNL+LFDGENE +EGE+R       
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGVPSLSEPNTADNLLLFDGENELLEGEKRSLHPNKS  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             + A  EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  159  NNIAPSEQSSRIGGNQNAKETEDSAIF----RPYARRNR  193


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_008790654.1| PREDICTED: uncharacterized protein LOC103707774 isoform X3 [Phoenix 
dactylifera]
Length=1922

 Score = 83.2 bits (204),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 66/103 (64%), Gaps = 6/103 (6%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEA+GSFA  ASPH DSVES  RPG +L  EPN ADNL+L DGEN  + GE+   ++  
Sbjct  80   ISEARGSFALAASPHGDSVESSDRPGGSLSREPNIADNLLLLDGENSNLGGERNF-KHSG  138

Query  121  RTSTATP-EQSTRMDGNQSAKELGDSAAFE--VPRKAYKRRVR  2
            ++   TP EQ++++D   SAKE  DS  F   V  +AY RR R
Sbjct  139  KSGNITPLEQASQIDC--SAKESEDSVIFRPGVKSQAYARRNR  179


 Score = 47.8 bits (112),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  +Q+V
Sbjct  45   FLEKGGNPLDFKFAHAASISVQSTSLTDQLAEQYV  79



>ref|XP_008790635.1| PREDICTED: uncharacterized protein LOC103707774 isoform X1 [Phoenix 
dactylifera]
Length=1947

 Score = 83.2 bits (204),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASPH DSVES  RPG +L  EPN ADNL+L DGEN  + GE+   ++  +
Sbjct  81   SEARGSFALAASPHGDSVESSDRPGGSLSREPNIADNLLLLDGENSNLGGERNF-KHSGK  139

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFE--VPRKAYKRRVR  2
            +   TP EQ++++D   SAKE  DS  F   V  +AY RR R
Sbjct  140  SGNITPLEQASQIDC--SAKESEDSVIFRPGVKSQAYARRNR  179


 Score = 47.8 bits (112),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  +Q+V
Sbjct  45   FLEKGGNPLDFKFAHAASISVQSTSLTDQLAEQYV  79



>ref|XP_008790645.1| PREDICTED: uncharacterized protein LOC103707774 isoform X2 [Phoenix 
dactylifera]
Length=1945

 Score = 83.2 bits (204),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASPH DSVES  RPG +L  EPN ADNL+L DGEN  + GE+   ++  +
Sbjct  81   SEARGSFALAASPHGDSVESSDRPGGSLSREPNIADNLLLLDGENSNLGGERNF-KHSGK  139

Query  118  TSTATP-EQSTRMDGNQSAKELGDSAAFE--VPRKAYKRRVR  2
            +   TP EQ++++D   SAKE  DS  F   V  +AY RR R
Sbjct  140  SGNITPLEQASQIDC--SAKESEDSVIFRPGVKSQAYARRNR  179


 Score = 47.8 bits (112),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  +Q+V
Sbjct  45   FLEKGGNPLDFKFAHAASISVQSTSLTDQLAEQYV  79



>ref|XP_004969428.1| PREDICTED: uncharacterized protein LOC101768814 [Setaria italica]
Length=1945

 Score = 85.5 bits (210),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 2/100 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFAF  SPH DSVES  +PG +L  E N+ADNLML DG+     GE+ + R   
Sbjct  96   ISEAKGSFAFATSPHGDSVESSGKPGNSLCREGNTADNLMLLDGDTSNTGGEKIVKRGTK  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEV-PR-KAYKRR  8
            R +    EQ    DG  +AKE  DS  F + P+ +AY RR
Sbjct  156  RATATQAEQFLHCDGQNNAKEGEDSGLFRLGPKSQAYARR  195


 Score = 44.3 bits (103),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS TDQ  DQ V
Sbjct  64   KGGNPLDFKLGHVASLSVQSTSVTDQIADQNV  95



>ref|XP_009383644.1| PREDICTED: uncharacterized protein LOC103971365 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1496

 Score = 85.9 bits (211),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH DSVES  RPG ++  EPN  DNL+L DG+N    GE+       R
Sbjct  81   SEAKGSFTLAASPHGDSVESSGRPGGSIGREPNIGDNLLLLDGKNNK-HGEKNAKHKGKR  139

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S    EQS+++DG+ + KE  DS  F V  K  AY RR R
Sbjct  140  GSVVLSEQSSQVDGSHNVKETEDSVIFRVGAKSQAYARRNR  180


 Score = 43.9 bits (102),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+  AAS SVQSTS TDQ  + +VT
Sbjct  48   KGGNPLDFKFSRAASGSVQSTSYTDQLAEPYVT  80



>ref|XP_009383645.1| PREDICTED: uncharacterized protein LOC103971365 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=1495

 Score = 85.9 bits (211),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH DSVES  RPG ++  EPN  DNL+L DG+N    GE+       R
Sbjct  81   SEAKGSFTLAASPHGDSVESSGRPGGSIGREPNIGDNLLLLDGKNNK-HGEKNAKHKGKR  139

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S    EQS+++DG+ + KE  DS  F V  K  AY RR R
Sbjct  140  GSVVLSEQSSQVDGSHNVKETEDSVIFRVGAKSQAYARRNR  180


 Score = 43.9 bits (102),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+  AAS SVQSTS TDQ  + +VT
Sbjct  48   KGGNPLDFKFSRAASGSVQSTSYTDQLAEPYVT  80



>gb|KEH22725.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1974

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A  EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  159  NKIAPSEQSSQIGGGQNAKETEESAIF----TPYARRNR  193


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKSGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>gb|KEH22728.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1918

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R
Sbjct  24   SEAKGSFVLTASPHGDSVDSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKR  83

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A  EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  84   NKIAPSEQSSQIGGGQNAKETEESAIF----TPYARRNR  118



>ref|XP_009383643.1| PREDICTED: uncharacterized protein LOC103971365 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1934

 Score = 85.9 bits (211),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH DSVES  RPG ++  EPN  DNL+L DG+N    GE+       R
Sbjct  81   SEAKGSFTLAASPHGDSVESSGRPGGSIGREPNIGDNLLLLDGKNNK-HGEKNAKHKGKR  139

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S    EQS+++DG+ + KE  DS  F V  K  AY RR R
Sbjct  140  GSVVLSEQSSQVDGSHNVKETEDSVIFRVGAKSQAYARRNR  180


 Score = 43.5 bits (101),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+  AAS SVQSTS TDQ  + +VT
Sbjct  48   KGGNPLDFKFSRAASGSVQSTSYTDQLAEPYVT  80



>gb|KEH22727.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1899

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R
Sbjct  24   SEAKGSFVLTASPHGDSVDSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKR  83

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A  EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  84   NKIAPSEQSSQIGGGQNAKETEESAIF----TPYARRNR  118



>gb|KEH22724.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1976

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A  EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  159  NKIAPSEQSSQIGGGQNAKETEESAIF----TPYARRNR  193


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKSGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>gb|KEH22723.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1993

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A  EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  159  NKIAPSEQSSQIGGGQNAKETEESAIF----TPYARRNR  193


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            F  +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  63   FLEKGGNPLDFKSGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>gb|KEH22729.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1901

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R
Sbjct  24   SEAKGSFVLTASPHGDSVDSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKR  83

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A  EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  84   NKIAPSEQSSQIGGGQNAKETEESAIF----TPYARRNR  118



>ref|XP_009383641.1| PREDICTED: uncharacterized protein LOC103971365 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009383642.1| PREDICTED: uncharacterized protein LOC103971365 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1935

 Score = 85.9 bits (211),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH DSVES  RPG ++  EPN  DNL+L DG+N    GE+       R
Sbjct  81   SEAKGSFTLAASPHGDSVESSGRPGGSIGREPNIGDNLLLLDGKNNK-HGEKNAKHKGKR  139

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S    EQS+++DG+ + KE  DS  F V  K  AY RR R
Sbjct  140  GSVVLSEQSSQVDGSHNVKETEDSVIFRVGAKSQAYARRNR  180


 Score = 43.5 bits (101),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK+  AAS SVQSTS TDQ  + +VT
Sbjct  48   KGGNPLDFKFSRAASGSVQSTSYTDQLAEPYVT  80



>ref|XP_004514269.1| PREDICTED: uncharacterized protein LOC101508009 isoform X1 [Cicer 
arietinum]
Length=1997

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF  TASPH DSV+S  RPGA  I EPN+ADNL+LFDGENE  EGE+R   +  R
Sbjct  99   SEAKGSFVLTASPHGDSVDSSARPGAPSISEPNTADNLLLFDGENELPEGEKRFLHSNKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +    EQS+++ G+Q+AKE  DSA      + Y RR R
Sbjct  159  NNIVPSEQSSQIGGSQNAKETEDSAIV----RPYARRNR  193


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT-RYFSRVVLVACDH  349
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT       VL A  H
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVTSEAKGSFVLTASPH  112



>ref|XP_003569253.2| PREDICTED: uncharacterized protein LOC100846606 isoform X2 [Brachypodium 
distachyon]
Length=1447

 Score = 82.4 bits (202),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 61/99 (62%), Gaps = 3/99 (3%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFA  ASPH DSVES  +PG++   E N+ADNLML DG    +  E+ I R   R
Sbjct  97   SEAKGSFALDASPHGDSVESSGKPGSSSCREANTADNLMLLDGGTSNIGVEKLIKRGTKR  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRR  8
            TSTA PEQS   D  Q+ KE  +S  F +  K  AY RR
Sbjct  157  TSTAQPEQSLCND-VQNIKEAEESGLFRLGAKSQAYARR  194


 Score = 45.4 bits (106),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F ++GG+PL+FK G+ AS+SVQSTS TDQ  +Q V
Sbjct  61   FLVKGGNPLDFKLGHVASLSVQSTSVTDQIAEQNV  95



>ref|XP_010932960.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105053476 
[Elaeis guineensis]
Length=1934

 Score = 83.2 bits (204),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASP  DSVES  RPG +L  EP+ AD+L+  DGEN  + GE+R + +   
Sbjct  102  SEARGSFALAASPRGDSVESNDRPGGSLSREPDIADSLLHLDGENSNLVGERRFNHSGKN  161

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFE--VPRKAYKRRVR  2
               A  EQS+ +DG+ +AK+  DS  F+  V  +AY RR R
Sbjct  162  GDIAPLEQSSHIDGSHNAKKSEDSVIFQLGVKSQAYARRKR  202


 Score = 44.3 bits (103),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G+A S+SVQS S  DQ  +Q+V
Sbjct  69   KGGNPLDFKFGHAVSISVQSASLIDQPAEQYV  100



>ref|XP_010231947.1| PREDICTED: uncharacterized protein LOC100846606 isoform X1 [Brachypodium 
distachyon]
Length=1883

 Score = 82.4 bits (202),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFA  ASPH DSVES  +PG++   E N+ADNLML DG    +  E+ I R   
Sbjct  96   ISEAKGSFALDASPHGDSVESSGKPGSSSCREANTADNLMLLDGGTSNIGVEKLIKRGTK  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRR  8
            RTSTA PEQS   D  Q+ KE  +S  F +  K  AY RR
Sbjct  156  RTSTAQPEQSLCND-VQNIKEAEESGLFRLGAKSQAYARR  194


 Score = 44.7 bits (104),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F ++GG+PL+FK G+ AS+SVQSTS TDQ  +Q V
Sbjct  61   FLVKGGNPLDFKLGHVASLSVQSTSVTDQIAEQNV  95



>ref|XP_006644307.1| PREDICTED: uncharacterized protein LOC102716260 isoform X1 [Oryza 
brachyantha]
Length=1916

 Score = 86.3 bits (212),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 2/100 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF F ASPH DSVES  +PG++   + N+ADN+ML DG+     GE+ +     
Sbjct  80   ISEAKGSFVFAASPHGDSVESSGKPGSSSCRDANTADNIMLLDGDTSNTGGEKLVKHGTK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRR  8
            RT+T+ P+ S R DG  + KE  D   F +  K  AY RR
Sbjct  140  RTNTSQPDVSVRCDGQNNVKEAEDPGLFRLGAKNQAYARR  179


 Score = 39.7 bits (91),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS  D   +Q V
Sbjct  48   KGGNPLDFKLGHVASLSVQSTSVADHTTEQNV  79



>ref|XP_006644308.1| PREDICTED: uncharacterized protein LOC102716260 isoform X2 [Oryza 
brachyantha]
Length=1898

 Score = 86.3 bits (212),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 2/100 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF F ASPH DSVES  +PG++   + N+ADN+ML DG+     GE+ +     
Sbjct  80   ISEAKGSFVFAASPHGDSVESSGKPGSSSCRDANTADNIMLLDGDTSNTGGEKLVKHGTK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRR  8
            RT+T+ P+ S R DG  + KE  D   F +  K  AY RR
Sbjct  140  RTNTSQPDVSVRCDGQNNVKEAEDPGLFRLGAKNQAYARR  179


 Score = 39.7 bits (91),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS  D   +Q V
Sbjct  48   KGGNPLDFKLGHVASLSVQSTSVADHTTEQNV  79



>ref|NP_001061122.1| Os08g0177300 [Oryza sativa Japonica Group]
 dbj|BAD03042.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD03238.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23036.1| Os08g0177300 [Oryza sativa Japonica Group]
Length=1259

 Score = 86.3 bits (212),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFAF ASPH DSVES  +PG++   + N+ADNLML DG+     GE+ +     R
Sbjct  81   SEAKGSFAFAASPHGDSVESSGKPGSSSCRDANTADNLMLLDGDTSNTGGEKLVKCGTKR  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFE--VPRKAYKRR  8
            T+ + P+ S R DG  + KE  DS+ F      +AY RR
Sbjct  141  TNVSQPDVSLRCDGQNNVKEAEDSSLFRPGAKNQAYARR  179


 Score = 39.7 bits (91),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS  D   +Q V
Sbjct  48   KGGNPLDFKLGHVASLSVQSTSVADHITEQNV  79



>ref|XP_002455831.1| hypothetical protein SORBIDRAFT_03g025920 [Sorghum bicolor]
 gb|EES00951.1| hypothetical protein SORBIDRAFT_03g025920 [Sorghum bicolor]
Length=1788

 Score = 84.3 bits (207),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 61/100 (61%), Gaps = 2/100 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFAF  SPH DSVES  +PG +L  E N+ADNLML DG+   + GE+   R   
Sbjct  96   ISEAKGSFAFATSPHGDSVESSDKPGNSLCREGNTADNLMLLDGDASNIGGEKLSKRGTK  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEV-PR-KAYKRR  8
            RT++   EQ    DG  +AKE  DS    + P+ +AY RR
Sbjct  156  RTNSVQAEQFLHCDGQNNAKEGEDSGLLRLGPKSQAYARR  195


 Score = 41.2 bits (95),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS T+Q  +Q V
Sbjct  64   KGGNPLDFKLGHVASLSVQSTSVTEQIAEQNV  95



>gb|EEC82989.1| hypothetical protein OsI_28025 [Oryza sativa Indica Group]
Length=2017

 Score = 85.9 bits (211),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFAF ASPH DSVES  +PG++   + N+ADNLML DG+     GE+ +     R
Sbjct  81   SEAKGSFAFAASPHGDSVESSGKPGSSSCRDANTADNLMLLDGDTSNTGGEKLVKCGTKR  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFE--VPRKAYKRR  8
            T+ + P+ S R DG  + KE  DS+ F      +AY RR
Sbjct  141  TNVSQPDVSLRCDGQNNVKEAEDSSLFRPGAKNQAYARR  179


 Score = 38.9 bits (89),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS  D   +Q V
Sbjct  48   KGGNPLDFKLGHVASLSVQSTSVADHITEQNV  79



>gb|EEE68140.1| hypothetical protein OsJ_26241 [Oryza sativa Japonica Group]
Length=1805

 Score = 85.9 bits (211),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 2/100 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSFAF ASPH DSVES  +PG++   + N+ADNLML DG+     GE+ +     
Sbjct  80   ISEAKGSFAFAASPHGDSVESSGKPGSSSCRDANTADNLMLLDGDTSNTGGEKLVKCGTK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFE--VPRKAYKRR  8
            RT+ + P+ S R DG  + KE  DS+ F      +AY RR
Sbjct  140  RTNVSQPDVSLRCDGQNNVKEAEDSSLFRPGAKNQAYARR  179


 Score = 38.9 bits (89),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS  D   +Q V
Sbjct  48   KGGNPLDFKLGHVASLSVQSTSVADHITEQNV  79



>ref|XP_010917964.1| PREDICTED: uncharacterized protein LOC105042442 isoform X2 [Elaeis 
guineensis]
Length=1937

 Score = 78.2 bits (191),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASPH DSVES  RPG  L  EPN ADNL+L DG+N  + GE+    +   
Sbjct  81   SEARGSFALAASPHGDSVESSDRPGGYLSREPNIADNLLLLDGDNSNLGGERNFKHSGKS  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPR-----KAYKRRVR  2
             + A  EQ++++D   SAKE  DS    +PR     +AY RR R
Sbjct  141  GNIARLEQASQIDF--SAKESEDSV---IPRSGGRSQAYARRNR  179


 Score = 46.2 bits (108),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +AAS+SVQSTS TDQ  +Q+V
Sbjct  48   KGGNPLDFKFPHAASISVQSTSLTDQLAEQYV  79



>ref|XP_010917963.1| PREDICTED: uncharacterized protein LOC105042442 isoform X1 [Elaeis 
guineensis]
Length=1939

 Score = 78.2 bits (191),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASPH DSVES  RPG  L  EPN ADNL+L DG+N  + GE+    +   
Sbjct  81   SEARGSFALAASPHGDSVESSDRPGGYLSREPNIADNLLLLDGDNSNLGGERNFKHSGKS  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPR-----KAYKRRVR  2
             + A  EQ++++D   SAKE  DS    +PR     +AY RR R
Sbjct  141  GNIARLEQASQIDF--SAKESEDSV---IPRSGGRSQAYARRNR  179


 Score = 46.2 bits (108),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +AAS+SVQSTS TDQ  +Q+V
Sbjct  48   KGGNPLDFKFPHAASISVQSTSLTDQLAEQYV  79



>ref|XP_010917965.1| PREDICTED: uncharacterized protein LOC105042442 isoform X3 [Elaeis 
guineensis]
Length=1914

 Score = 77.8 bits (190),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASPH DSVES  RPG  L  EPN ADNL+L DG+N  + GE+    +   
Sbjct  81   SEARGSFALAASPHGDSVESSDRPGGYLSREPNIADNLLLLDGDNSNLGGERNFKHSGKS  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPR-----KAYKRRVR  2
             + A  EQ++++D   SAKE  DS    +PR     +AY RR R
Sbjct  141  GNIARLEQASQIDF--SAKESEDSV---IPRSGGRSQAYARRNR  179


 Score = 46.2 bits (108),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +AAS+SVQSTS TDQ  +Q+V
Sbjct  48   KGGNPLDFKFPHAASISVQSTSLTDQLAEQYV  79



>ref|XP_009102451.1| PREDICTED: uncharacterized protein LOC103828590 isoform X1 [Brassica 
rapa]
Length=1901

 Score = 76.6 bits (187),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = -1

Query  289  KGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTST  110
            K SFA  +SPH DSVES  RP    + EPN+ADNL+LFD  N+ VEGE  +     +  T
Sbjct  97   KDSFALASSPHGDSVESSGRPAVPTVSEPNTADNLLLFDSGNKSVEGENNLRYPNRQHRT  156

Query  109  ATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +  E+S + + NQ+ KE  DSA F    + Y RR R
Sbjct  157  SESERSYKANTNQNIKETEDSAIF----RPYARRNR  188


 Score = 46.2 bits (108),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  61   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  92



>ref|XP_009102452.1| PREDICTED: uncharacterized protein LOC103828590 isoform X2 [Brassica 
rapa]
Length=1899

 Score = 76.6 bits (187),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = -1

Query  289  KGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTST  110
            K SFA  +SPH DSVES  RP    + EPN+ADNL+LFD  N+ VEGE  +     +  T
Sbjct  97   KDSFALASSPHGDSVESSGRPAVPTVSEPNTADNLLLFDSGNKSVEGENNLRYPNRQHRT  156

Query  109  ATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +  E+S + + NQ+ KE  DSA F    + Y RR R
Sbjct  157  SESERSYKANTNQNIKETEDSAIF----RPYARRNR  188


 Score = 46.2 bits (108),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S SVQSTS TDQQ + FV
Sbjct  61   KGGNPLDFKFGIATSHSVQSTSLTDQQAEHFV  92



>emb|CDX93040.1| BnaA03g37620D [Brassica napus]
Length=1850

 Score = 81.3 bits (199),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (60%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DS ES  RP    + EPN+ADNL+LFD  N+ VEGE        +
Sbjct  100  SEVKDSFAMTASPHGDSAESSGRPAVPTVSEPNTADNLLLFDSGNKSVEGENNSKYPNRQ  159

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  160  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  194


 Score = 40.4 bits (93),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S+S QSTS TDQQ + F+
Sbjct  67   KGGNPLDFKFGVATSLSFQSTSLTDQQAEHFL  98



>emb|CDY15112.1| BnaC03g44730D [Brassica napus]
Length=1886

 Score = 80.9 bits (198),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (60%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DS ES  RP    + EPN+ADNL+LFD  N+ VEGE        +
Sbjct  97   SEVKDSFAMTASPHGDSAESSGRPAVPTVSEPNTADNLLLFDSGNKSVEGENSSKYPNRQ  156

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  157  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  191


 Score = 40.4 bits (93),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S+S QSTS TDQQ + F+
Sbjct  64   KGGNPLDFKFGVATSLSFQSTSLTDQQAEHFL  95



>gb|EMT21406.1| E1A-binding protein p400 [Aegilops tauschii]
Length=1529

 Score = 78.2 bits (191),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLIC-EPNSADNLMLFDGENEYVEGEQRISRNLS  122
            SEAKGSF F ASPH DS +S  RPG++  C E N+ADNLML  G+   + GE+ + R   
Sbjct  81   SEAKGSFTFAASPHGDSFDSSGRPGSS--CREANTADNLMLLYGDTSKIGGEKLVKRGTK  138

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFE--VPRKAYKRR  8
            R++T  PE S   DG  + KE  DS  F      +AY RR
Sbjct  139  RSNTPQPEMSFCNDGQNNTKEAEDSGLFRHGAKSQAYARR  178


 Score = 43.1 bits (100),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F ++GG+PL+FK G+  S+SVQSTS TDQ  +Q V
Sbjct  45   FLVKGGNPLDFKLGHVVSLSVQSTSVTDQIAEQNV  79



>emb|CDY52088.1| BnaCnng21890D [Brassica napus]
Length=1659

 Score = 76.6 bits (187),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = -1

Query  289  KGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTST  110
            K SFA  +SPH DSVES  RP    + EPN+ADNL+LFD  N+ VEGE  +     +  T
Sbjct  97   KDSFALASSPHGDSVESSGRPAVPTVSEPNTADNLLLFDSGNKSVEGENNLRYPNRQHRT  156

Query  109  ATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            +  E+S + + NQ+ KE  DSA F    + Y RR R
Sbjct  157  SESERSYKANTNQNIKETEDSAIF----RPYARRNR  188


 Score = 43.5 bits (101),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F  +GG+PL+FK+G A S SVQSTS TD Q + F+
Sbjct  58   FLEKGGNPLDFKFGIATSHSVQSTSLTDHQAEHFL  92



>ref|XP_006654876.1| PREDICTED: uncharacterized protein LOC102700433 isoform X2 [Oryza 
brachyantha]
Length=1850

 Score = 77.4 bits (189),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 60/102 (59%), Gaps = 2/102 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             S+AKGSFAF ASP  DSVES  +PG++   E N+ADNLMLF G N  V  E+ + R   
Sbjct  86   ISDAKGSFAFAASPPGDSVESNGKPGSSPCRETNTADNLMLFLGNNSDVVEEKIVKRGTK  145

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            RT  A  +Q    DG+ +AK+  DS      V  +AY RR R
Sbjct  146  RTIAAQSKQPLPTDGHNNAKQAEDSVLSRLGVKSQAYVRRNR  187


 Score = 42.0 bits (97),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQ  397
            F  +GG+PL+FK+ + ASVSVQSTS TDQ  +Q
Sbjct  51   FLEKGGNPLDFKFVHVASVSVQSTSLTDQIAEQ  83



>ref|XP_006654875.1| PREDICTED: uncharacterized protein LOC102700433 isoform X1 [Oryza 
brachyantha]
Length=1869

 Score = 77.4 bits (189),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 60/102 (59%), Gaps = 2/102 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             S+AKGSFAF ASP  DSVES  +PG++   E N+ADNLMLF G N  V  E+ + R   
Sbjct  86   ISDAKGSFAFAASPPGDSVESNGKPGSSPCRETNTADNLMLFLGNNSDVVEEKIVKRGTK  145

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            RT  A  +Q    DG+ +AK+  DS      V  +AY RR R
Sbjct  146  RTIAAQSKQPLPTDGHNNAKQAEDSVLSRLGVKSQAYVRRNR  187


 Score = 42.0 bits (97),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQ  397
            F  +GG+PL+FK+ + ASVSVQSTS TDQ  +Q
Sbjct  51   FLEKGGNPLDFKFVHVASVSVQSTSLTDQIAEQ  83



>emb|CDX77380.1| BnaA07g05180D [Brassica napus]
Length=1642

 Score = 76.3 bits (186),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 58/99 (59%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S  K SFA  +SPH DSVES  RP    + EPN+ADNL+LFD  N+ VEGE  +     +
Sbjct  94   SGLKDSFALASSPHGDSVESSGRPAVPTVSEPNTADNLLLFDSGNKSVEGENNLRYPNRQ  153

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S + + NQ+ KE  DSA F    + Y RR R
Sbjct  154  HRTSESERSYKANTNQNIKETEDSAIF----RPYARRNR  188


 Score = 43.1 bits (100),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+  A S SVQSTS TDQQ + FV
Sbjct  61   KGGNPLDFKFVIATSHSVQSTSLTDQQAEHFV  92



>ref|XP_009136094.1| PREDICTED: uncharacterized protein LOC103860260 isoform X1 [Brassica 
rapa]
 ref|XP_009136095.1| PREDICTED: uncharacterized protein LOC103860260 isoform X1 [Brassica 
rapa]
Length=1853

 Score = 77.8 bits (190),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 58/99 (59%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DS ES  RP    + EPN+ADNL+LFD  N+ VE E        +
Sbjct  96   SEVKDSFAMTASPHGDSAESSGRPAVPTVSEPNTADNLLLFDSGNKSVEVENNSKYPNRQ  155

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  156  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  190


 Score = 40.4 bits (93),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S+S QSTS TDQQ + F+
Sbjct  63   KGGNPLDFKFGVATSLSFQSTSLTDQQAEHFL  94



>ref|XP_009136096.1| PREDICTED: uncharacterized protein LOC103860260 isoform X2 [Brassica 
rapa]
Length=1852

 Score = 77.8 bits (190),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 58/99 (59%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SE K SFA TASPH DS ES  RP    + EPN+ADNL+LFD  N+ VE E        +
Sbjct  96   SEVKDSFAMTASPHGDSAESSGRPAVPTVSEPNTADNLLLFDSGNKSVEVENNSKYPNRQ  155

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              T+  E+S++ + NQ+ KE  DSA F    + Y RR R
Sbjct  156  NRTSESERSSKANTNQNTKETEDSAIF----RPYARRNR  190


 Score = 40.4 bits (93),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+G A S+S QSTS TDQQ + F+
Sbjct  63   KGGNPLDFKFGVATSLSFQSTSLTDQQAEHFL  94



>gb|EEE64905.1| hypothetical protein OsJ_19765 [Oryza sativa Japonica Group]
Length=1903

 Score = 78.6 bits (192),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 61/102 (60%), Gaps = 2/102 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             S+AKGSFAF ASP  DSVES  RPG++   E N+ADNLMLF G+   V  E+ + R   
Sbjct  137  ISDAKGSFAFAASPRGDSVESNGRPGSSPCRETNTADNLMLFRGDKNDVVEEKIVKRGTK  196

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            RT+ A  +Q    DG+ +AK+  DS      V  +AY RR R
Sbjct  197  RTNAAQSKQPLPTDGHNNAKQAEDSVLSRLGVKSQAYVRRNR  238


 Score = 39.7 bits (91),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F  +GG+PL+FK+ + ASVSVQSTS T+Q  +Q V
Sbjct  102  FLEKGGNPLDFKFVHVASVSVQSTSLTEQIVEQNV  136



>gb|EEC79795.1| hypothetical protein OsI_21223 [Oryza sativa Indica Group]
Length=1846

 Score = 78.6 bits (192),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 61/102 (60%), Gaps = 2/102 (2%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             S+AKGSFAF ASP  DSVES  RPG++   E N+ADNLMLF G+   V  E+ + R   
Sbjct  80   ISDAKGSFAFAASPRGDSVESNGRPGSSPCRETNTADNLMLFRGDKNDVVEEKIVKRGTK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            RT+ A  +Q    DG+ +AK+  DS      V  +AY RR R
Sbjct  140  RTNAAQSKQPLPTDGHNNAKQAEDSVLSRLGVKSQAYVRRNR  181


 Score = 39.7 bits (91),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F  +GG+PL+FK+ + ASVSVQSTS T+Q  +Q V
Sbjct  45   FLEKGGNPLDFKFVHVASVSVQSTSLTEQIVEQNV  79



>gb|ACU01769.1| hypothetical protein [Brachypodium distachyon]
Length=1815

 Score = 75.9 bits (185),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFAF AS H DSVES  +PG++L  E N ADNLMLF G+N  +  E+ + R   R
Sbjct  81   SEAKGSFAFAASTHGDSVESSGKPGSSLCRETNMADNLMLFGGDNNGITKEKIVKRGSRR  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            T+     QS+  DG+ +AK    S      V  +AY RR R
Sbjct  141  TNAGQLRQSS--DGHNNAKRAEGSGLSRLGVKSQAYVRRNR  179


 Score = 41.2 bits (95),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQ  397
            F  +GG+PL+FK+G   SVS+QSTS TDQ  +Q
Sbjct  45   FLEKGGNPLDFKFGYVESVSLQSTSLTDQIAEQ  77



>ref|XP_010230951.1| PREDICTED: uncharacterized protein LOC100845890 [Brachypodium 
distachyon]
Length=1884

 Score = 75.5 bits (184),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSFAF AS H DSVES  +PG++L  E N ADNLMLF G+N  +  E+ + R   R
Sbjct  81   SEAKGSFAFAASTHGDSVESSGKPGSSLCRETNMADNLMLFGGDNNGITKEKIVKRGSRR  140

Query  118  TSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            T+     QS+  DG+ +AK    S      V  +AY RR R
Sbjct  141  TNAGQLRQSS--DGHNNAKRAEGSGLSRLGVKSQAYVRRNR  179


 Score = 41.2 bits (95),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQ  397
            F  +GG+PL+FK+G   SVS+QSTS TDQ  +Q
Sbjct  45   FLEKGGNPLDFKFGYVESVSLQSTSLTDQIAEQ  77



>tpg|DAA58666.1| TPA: putative homeodomain-like transcription factor superfamily 
protein [Zea mays]
Length=1195

 Score = 72.4 bits (176),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGS AF  SPH DSVES  +PG +L  E N+ADN+ L DG+   +  ++ + R   
Sbjct  96   ISEAKGSSAFATSPHGDSVESNDKPGNSLCREGNTADNITLLDGDASSMGVDKIVKRGTK  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEV-PR-KAYKRR  8
            RT++A  EQ    DG  +AKE  DS  + + P+ +AY RR
Sbjct  156  RTNSAQAEQFLHCDGQNNAKE-EDSGLYRLGPKSQAYARR  194


 Score = 41.6 bits (96),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS T+Q  +Q V
Sbjct  64   KGGNPLDFKLGHVASLSVQSTSVTEQIAEQNV  95



>ref|XP_008675390.1| PREDICTED: uncharacterized protein LOC103651525 isoform X2 [Zea 
mays]
Length=1914

 Score = 72.4 bits (176),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGS AF  SPH DSVES  +PG +L  E N+ADN+ L DG+   +  ++ + R   
Sbjct  96   ISEAKGSSAFATSPHGDSVESNDKPGNSLCREGNTADNITLLDGDASSMGVDKIVKRGTK  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEV-PR-KAYKRR  8
            RT++A  EQ    DG  +AKE  DS  + + P+ +AY RR
Sbjct  156  RTNSAQAEQFLHCDGQNNAKE-EDSGLYRLGPKSQAYARR  194


 Score = 40.8 bits (94),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS T+Q  +Q V
Sbjct  64   KGGNPLDFKLGHVASLSVQSTSVTEQIAEQNV  95



>ref|XP_008675386.1| PREDICTED: uncharacterized protein LOC103651525 isoform X1 [Zea 
mays]
 ref|XP_008675387.1| PREDICTED: uncharacterized protein LOC103651525 isoform X1 [Zea 
mays]
 ref|XP_008675388.1| PREDICTED: uncharacterized protein LOC103651525 isoform X1 [Zea 
mays]
 ref|XP_008675389.1| PREDICTED: uncharacterized protein LOC103651525 isoform X1 [Zea 
mays]
Length=1921

 Score = 72.4 bits (176),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGS AF  SPH DSVES  +PG +L  E N+ADN+ L DG+   +  ++ + R   
Sbjct  96   ISEAKGSSAFATSPHGDSVESNDKPGNSLCREGNTADNITLLDGDASSMGVDKIVKRGTK  155

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEV-PR-KAYKRR  8
            RT++A  EQ    DG  +AKE  DS  + + P+ +AY RR
Sbjct  156  RTNSAQAEQFLHCDGQNNAKE-EDSGLYRLGPKSQAYARR  194


 Score = 40.8 bits (94),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS T+Q  +Q V
Sbjct  64   KGGNPLDFKLGHVASLSVQSTSVTEQIAEQNV  95



>gb|ACT34068.1| hypothetical protein [Aegilops tauschii]
Length=1811

 Score = 77.8 bits (190),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF F ASP  DSVES  +PG++L  E N+ADNLMLF G N  V  E+ + R   
Sbjct  77   ISEAKGSFTFAASPRGDSVESSGKPGSSLCRETNTADNLMLFGGNNNGVVKEKVVKRGSR  136

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            R + A P QS   +G+ + K   DS      V  +AY RR R
Sbjct  137  RANVAQPRQSA--EGHNNVKRADDSGLSRLGVKSQAYVRRNR  176


 Score = 33.9 bits (76),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQ  406
            +GG+PL+FK     S+SVQSTS T +Q
Sbjct  48   KGGNPLDFKVDRVESISVQSTSLTAEQ  74



>gb|EMT31460.1| hypothetical protein F775_01577 [Aegilops tauschii]
Length=1879

 Score = 77.4 bits (189),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGSF F ASP  DSVES  +PG++L  E N+ADNLMLF G N  V  E+ + R   
Sbjct  77   ISEAKGSFTFAASPRGDSVESSGKPGSSLCRETNTADNLMLFGGNNNGVVKEKVVKRGSR  136

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
            R + A P QS   +G+ + K   DS      V  +AY RR R
Sbjct  137  RANVAQPRQSA--EGHNNVKRADDSGLSRLGVKSQAYVRRNR  176


 Score = 33.9 bits (76),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQ  406
            +GG+PL+FK     S+SVQSTS T +Q
Sbjct  48   KGGNPLDFKVDRVESISVQSTSLTAEQ  74



>tpg|DAA58669.1| TPA: putative homeodomain-like transcription factor superfamily 
protein [Zea mays]
Length=895

 Score = 69.3 bits (168),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGS AF  S H DSVES  +PG +L  E N+ADNL L DG+   +  ++ +     
Sbjct  151  ISEAKGSSAFATSSHGDSVESNDKPGNSLCREGNTADNLTLLDGDASNLGVDKIVKHGTK  210

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEV-PR-KAYKRR  8
            RT++A  EQ    DG  +AKE  DS  F + P+ +AY RR
Sbjct  211  RTNSAQAEQFLHCDGQNNAKE-EDSGLFRLGPKSQAYARR  249


 Score = 42.0 bits (97),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS T+Q  +Q V
Sbjct  119  KGGNPLDFKLGHVASLSVQSTSVTEQIAEQNV  150



>ref|XP_008676365.1| PREDICTED: uncharacterized protein LOC103652593 [Zea mays]
Length=900

 Score = 68.9 bits (167),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             SEAKGS AF  S H DSVES  +PG +L  E N+ADNL L DG+   +  ++ +     
Sbjct  80   ISEAKGSSAFATSSHGDSVESNDKPGNSLCREGNTADNLTLLDGDASNLGVDKIVKHGTK  139

Query  121  RTSTATPEQSTRMDGNQSAKELGDSAAFEV-PR-KAYKRR  8
            RT++A  EQ    DG  +AKE  DS  F + P+ +AY RR
Sbjct  140  RTNSAQAEQFLHCDGQNNAKE-EDSGLFRLGPKSQAYARR  178


 Score = 41.6 bits (96),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK G+ AS+SVQSTS T+Q  +Q V
Sbjct  48   KGGNPLDFKLGHVASLSVQSTSVTEQIAEQNV  79



>ref|XP_009409891.1| PREDICTED: uncharacterized protein LOC103992013 isoform X5 [Musa 
acuminata subsp. malaccensis]
Length=1964

 Score = 64.3 bits (155),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH +SVES  RPG ++  EPN  DNL+L + EN  + GE+       R
Sbjct  99   SEAKGSFTLAASPHGESVESSGRPGGSVGREPNIGDNLLLLNRENNKLHGEKNAKHRSKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S +  EQS+ +DG  +AK+  DS  F +  K  AY RR R
Sbjct  159  GSISHLEQSSHVDGCHNAKDTEDSVIFRLGAKSQAYARRNR  199


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  + +VT
Sbjct  63   FLEKGGNPLDFKFIHAASISVQSTSLTDQVAEPYVT  98



>ref|XP_009409885.1| PREDICTED: uncharacterized protein LOC103992013 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=1969

 Score = 64.3 bits (155),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH +SVES  RPG ++  EPN  DNL+L + EN  + GE+       R
Sbjct  99   SEAKGSFTLAASPHGESVESSGRPGGSVGREPNIGDNLLLLNRENNKLHGEKNAKHRSKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S +  EQS+ +DG  +AK+  DS  F +  K  AY RR R
Sbjct  159  GSISHLEQSSHVDGCHNAKDTEDSVIFRLGAKSQAYARRNR  199


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  + +VT
Sbjct  63   FLEKGGNPLDFKFIHAASISVQSTSLTDQVAEPYVT  98



>ref|XP_009409867.1| PREDICTED: uncharacterized protein LOC103992013 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1973

 Score = 64.3 bits (155),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH +SVES  RPG ++  EPN  DNL+L + EN  + GE+       R
Sbjct  99   SEAKGSFTLAASPHGESVESSGRPGGSVGREPNIGDNLLLLNRENNKLHGEKNAKHRSKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S +  EQS+ +DG  +AK+  DS  F +  K  AY RR R
Sbjct  159  GSISHLEQSSHVDGCHNAKDTEDSVIFRLGAKSQAYARRNR  199


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  + +VT
Sbjct  63   FLEKGGNPLDFKFIHAASISVQSTSLTDQVAEPYVT  98



>ref|XP_009409876.1| PREDICTED: uncharacterized protein LOC103992013 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1970

 Score = 64.3 bits (155),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH +SVES  RPG ++  EPN  DNL+L + EN  + GE+       R
Sbjct  99   SEAKGSFTLAASPHGESVESSGRPGGSVGREPNIGDNLLLLNRENNKLHGEKNAKHRSKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S +  EQS+ +DG  +AK+  DS  F +  K  AY RR R
Sbjct  159  GSISHLEQSSHVDGCHNAKDTEDSVIFRLGAKSQAYARRNR  199


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  + +VT
Sbjct  63   FLEKGGNPLDFKFIHAASISVQSTSLTDQVAEPYVT  98



>ref|XP_009409845.1| PREDICTED: uncharacterized protein LOC103992013 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409850.1| PREDICTED: uncharacterized protein LOC103992013 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409858.1| PREDICTED: uncharacterized protein LOC103992013 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409898.1| PREDICTED: uncharacterized protein LOC103992013 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1974

 Score = 64.3 bits (155),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEAKGSF   ASPH +SVES  RPG ++  EPN  DNL+L + EN  + GE+       R
Sbjct  99   SEAKGSFTLAASPHGESVESSGRPGGSVGREPNIGDNLLLLNRENNKLHGEKNAKHRSKR  158

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRK--AYKRRVR  2
             S +  EQS+ +DG  +AK+  DS  F +  K  AY RR R
Sbjct  159  GSISHLEQSSHVDGCHNAKDTEDSVIFRLGAKSQAYARRNR  199


 Score = 44.7 bits (104),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+ +AAS+SVQSTS TDQ  + +VT
Sbjct  63   FLEKGGNPLDFKFIHAASISVQSTSLTDQVAEPYVT  98



>ref|XP_006576616.1| PREDICTED: uncharacterized protein LOC100814315 isoform X6 [Glycine 
max]
Length=1957

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = -1

Query  283  SFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTSTAT  104
            S + T  PHE  V S  RPGA L  EPN+ADNL+LFDGENE  E E+R   +  R + A 
Sbjct  85   STSLTDQPHEQFVSSSARPGAPLASEPNTADNLLLFDGENELPETERRCLHSNRRNNIAL  144

Query  103  PEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             EQS+++DGN +AKE  DSA F    + Y RR R
Sbjct  145  SEQSSQIDGNLNAKETEDSAIF----RPYARRNR  174


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFV+
Sbjct  66   KGGNPLDFKSGNAASVSVQSTSLTDQPHEQFVS  98



>ref|XP_010036817.1| PREDICTED: uncharacterized protein LOC104425727 isoform X4 [Eucalyptus 
grandis]
Length=1298

 Score = 62.4 bits (150),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASP  DS+ES  RP   L+   N  DN +  +GE   VEGE+   R   R
Sbjct  100  SEARGSFALAASPQGDSLESSDRP--RLLRGSNCPDNQLDSNGEGHLVEGEKNSIRGGRR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A+ +QS++ DG+++AK+  +SA F    + Y RR R
Sbjct  158  NKFASSKQSSQFDGSKNAKDSEESAIF----RPYARRNR  192


 Score = 45.4 bits (106),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+G A S SVQSTS TDQ  +Q  T
Sbjct  64   FLEKGGNPLDFKHGTATSASVQSTSLTDQHLEQVAT  99



>ref|XP_004961001.1| PREDICTED: uncharacterized protein LOC101757003 isoform X5 [Setaria 
italica]
Length=1846

 Score = 74.3 bits (181),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>emb|CDY47335.1| BnaCnng14720D [Brassica napus]
Length=1726

 Score = 65.5 bits (158),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 7/97 (7%)
 Frame = -1

Query  292  AKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTS  113
             K S   TASP  DSVES  RPG   + EPN+ADNL+LFD +N+ +EG++       R+ 
Sbjct  72   VKDSLLRTASPPGDSVESSGRPG---VSEPNTADNLLLFDSDNKSLEGDKNSQYPNKRSR  128

Query  112  TATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
            T+  ++S++++ ++  KE  DSA F    + Y RR R
Sbjct  129  TSESQRSSKVNHSRDKKETEDSAIF----RPYARRNR  161


 Score = 41.2 bits (95),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  498  LFSLQGGDPLEFKYGNAASVSVQSTSPTDQQ  406
            +F   GG+PL+FK+G A S SVQSTS TD+Q
Sbjct  36   VFLENGGNPLDFKFGYATSQSVQSTSLTDKQ  66



>ref|XP_004961004.1| PREDICTED: uncharacterized protein LOC101757003 isoform X8 [Setaria 
italica]
Length=1811

 Score = 74.3 bits (181),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>ref|XP_004960999.1| PREDICTED: uncharacterized protein LOC101757003 isoform X3 [Setaria 
italica]
Length=1853

 Score = 74.3 bits (181),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>ref|XP_004960998.1| PREDICTED: uncharacterized protein LOC101757003 isoform X2 [Setaria 
italica]
Length=1853

 Score = 74.3 bits (181),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>ref|XP_004961003.1| PREDICTED: uncharacterized protein LOC101757003 isoform X7 [Setaria 
italica]
Length=1829

 Score = 74.3 bits (181),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>ref|XP_004960997.1| PREDICTED: uncharacterized protein LOC101757003 isoform X1 [Setaria 
italica]
Length=1855

 Score = 74.3 bits (181),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>ref|XP_004961002.1| PREDICTED: uncharacterized protein LOC101757003 isoform X6 [Setaria 
italica]
Length=1843

 Score = 74.3 bits (181),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>ref|XP_004961000.1| PREDICTED: uncharacterized protein LOC101757003 isoform X4 [Setaria 
italica]
Length=1852

 Score = 74.3 bits (181),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF   ASP+ DSVES  +PG++L  E N+ADNLML DG N  +  E+ + R   R
Sbjct  89   SDAKGSFP--ASPYGDSVESTGKPGSSLCRETNTADNLMLLDGSNNGIAEEKFVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKE--------LGDSAAFEVPRKAYKRRVR  2
             + A P+QS   DG+++AK+        LGD +      +AY RR R
Sbjct  147  LNAAQPKQSLPNDGHKNAKKPVVSGLSRLGDKS------QAYVRRNR  187


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            +GG+PL+FK+ +  +VSV S S T+Q   Q V
Sbjct  56   KGGNPLDFKFVHVETVSVHSASLTNQTEAQNV  87



>ref|XP_006840249.1| hypothetical protein AMTR_s00045p00023420 [Amborella trichopoda]
 gb|ERN01924.1| hypothetical protein AMTR_s00045p00023420 [Amborella trichopoda]
Length=710

 Score = 62.4 bits (150),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 54/96 (56%), Gaps = 10/96 (10%)
 Frame = -1

Query  304  HC--SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISR  131
            HC  SEA+GSF  TASP+ DS ES  R GA L  EPN+ADNL+LF G+N+ +  E     
Sbjct  84   HCLASEARGSFVLTASPNGDSAESSGRLGALLGGEPNTADNLLLFVGDNDILARE-----  138

Query  130  NLSRTSTATPEQSTRMDGNQSAKELGDSAAFEVPRK  23
               ++S++  +       N +AKE  DS    +  K
Sbjct  139  ---KSSSSKKDNVEGSQNNNNAKESEDSVGVRLGFK  171


 Score = 43.9 bits (102),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQ  397
            +GG+PL++K G AASVS+QSTS TDQ P+ 
Sbjct  55   KGGNPLDYKLGLAASVSLQSTSLTDQPPEH  84



>ref|XP_010036816.1| PREDICTED: uncharacterized protein LOC104425727 isoform X3 [Eucalyptus 
grandis]
Length=1926

 Score = 62.8 bits (151),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASP  DS+ES  RP   L+   N  DN +  +GE   VEGE+   R   R
Sbjct  100  SEARGSFALAASPQGDSLESSDRP--RLLRGSNCPDNQLDSNGEGHLVEGEKNSIRGGRR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A+ +QS++ DG+++AK+  +SA F    + Y RR R
Sbjct  158  NKFASSKQSSQFDGSKNAKDSEESAIF----RPYARRNR  192


 Score = 43.5 bits (101),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+G A S SVQSTS TDQ  +Q  T
Sbjct  64   FLEKGGNPLDFKHGTATSASVQSTSLTDQHLEQVAT  99



>ref|XP_010036814.1| PREDICTED: uncharacterized protein LOC104425727 isoform X1 [Eucalyptus 
grandis]
Length=1965

 Score = 62.4 bits (150),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASP  DS+ES  RP   L+   N  DN +  +GE   VEGE+   R   R
Sbjct  100  SEARGSFALAASPQGDSLESSDRP--RLLRGSNCPDNQLDSNGEGHLVEGEKNSIRGGRR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A+ +QS++ DG+++AK+  +SA F    + Y RR R
Sbjct  158  NKFASSKQSSQFDGSKNAKDSEESAIF----RPYARRNR  192


 Score = 43.1 bits (100),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+G A S SVQSTS TDQ  +Q  T
Sbjct  64   FLEKGGNPLDFKHGTATSASVQSTSLTDQHLEQVAT  99



>ref|XP_010036815.1| PREDICTED: uncharacterized protein LOC104425727 isoform X2 [Eucalyptus 
grandis]
 gb|KCW48468.1| hypothetical protein EUGRSUZ_K02162 [Eucalyptus grandis]
Length=1963

 Score = 62.4 bits (150),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            SEA+GSFA  ASP  DS+ES  RP   L+   N  DN +  +GE   VEGE+   R   R
Sbjct  100  SEARGSFALAASPQGDSLESSDRP--RLLRGSNCPDNQLDSNGEGHLVEGEKNSIRGGRR  157

Query  118  TSTATPEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
               A+ +QS++ DG+++AK+  +SA F    + Y RR R
Sbjct  158  NKFASSKQSSQFDGSKNAKDSEESAIF----RPYARRNR  192


 Score = 43.1 bits (100),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK+G A S SVQSTS TDQ  +Q  T
Sbjct  64   FLEKGGNPLDFKHGTATSASVQSTSLTDQHLEQVAT  99



>ref|XP_006586243.1| PREDICTED: uncharacterized protein LOC100779997 isoform X4 [Glycine 
max]
Length=1989

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = -1

Query  283  SFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTSTAT  104
            S + T    E  V S  RPG   + EPN+ADNL+LFDG+NE +EGE+R   +  R + A 
Sbjct  85   STSLTDQHQEQFVTSSARPGVPSLSEPNTADNLLLFDGDNELLEGEKRSLHSNKRNNIAP  144

Query  103  PEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  145  SEQSSRIGGNQNAKETEDSAIF----RPYARRNR  174


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            F  +GG+PL+FK GN ASVSVQSTS TDQ  +QFVT
Sbjct  63   FLEKGGNPLDFKLGNGASVSVQSTSLTDQHQEQFVT  98



>ref|XP_006602524.1| PREDICTED: uncharacterized protein LOC100819248 isoform X8 [Glycine 
max]
Length=1972

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 56/94 (60%), Gaps = 4/94 (4%)
 Frame = -1

Query  283  SFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTSTAT  104
            S + T    E  V S  RPG   + EPN+ADNL+LFDGENE +EGE+R        + A 
Sbjct  85   STSLTDQHQEQFVTSSARPGVPSLSEPNTADNLLLFDGENELLEGEKRSLHPNKSNNIAP  144

Query  103  PEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             EQS+R+ GNQ+AKE  DSA F    + Y RR R
Sbjct  145  SEQSSRIGGNQNAKETEDSAIF----RPYARRNR  174


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVT  388
            +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT
Sbjct  66   KGGNPLDFKLGNAASVSVQSTSLTDQHQEQFVT  98



>ref|XP_006848239.1| hypothetical protein AMTR_s00029p00248620 [Amborella trichopoda]
 gb|ERN09820.1| hypothetical protein AMTR_s00029p00248620 [Amborella trichopoda]
Length=810

 Score = 58.5 bits (140),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = -1

Query  304  HC--SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENE  161
            HC  SEA+GSF  TASP+ DS ES  R GA L  EPN+ADNL LF G+N+
Sbjct  82   HCLASEARGSFVLTASPNGDSAESSGRLGALLGGEPNTADNLSLFVGDND  131


 Score = 40.8 bits (94),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQ  397
            F  +GG+PL++K   AASVS+QSTS TDQ P+ 
Sbjct  50   FLEKGGNPLDYKLRLAASVSLQSTSLTDQPPEH  82



>gb|KEH22726.1| helicase/SANT-associated, DNA-binding protein, putative [Medicago 
truncatula]
Length=1974

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 55/94 (59%), Gaps = 4/94 (4%)
 Frame = -1

Query  283  SFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTSTAT  104
            S + T    E  V S  RPGA  I EPNSADNL+LFDGENE  EGE+R   +  R   A 
Sbjct  85   STSLTDQHQEQFVTSSARPGAPSINEPNSADNLLLFDGENELPEGEKRSLHSYKRNKIAP  144

Query  103  PEQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             EQS+++ G Q+AKE  +SA F      Y RR R
Sbjct  145  SEQSSQIGGGQNAKETEESAIF----TPYARRNR  174


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFVTRYFSRVVLVACDHPYIFYYSSNRL  316
            F  +GG+PL+FK GNAASVSVQSTS TDQ  +QFVT   +R    + + P     S++ L
Sbjct  63   FLEKGGNPLDFKSGNAASVSVQSTSLTDQHQEQFVT-SSARPGAPSINEP----NSADNL  117

Query  315  FL----NFIAVKQKVVLHS  271
             L    N +   +K  LHS
Sbjct  118  LLFDGENELPEGEKRSLHS  136



>gb|AFW81334.1| hypothetical protein ZEAMMB73_834326 [Zea mays]
Length=957

 Score = 64.7 bits (156),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 4/101 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF  +ASP  DSVES  +PG ++  E N+ADNLML  G    +  E+ + R   R
Sbjct  94   SDAKGSF--SASPLGDSVESTDKPGGSMCRETNTADNLMLLGGGKNDIAEEKVVKRGTKR  151

Query  118  TSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
             + A P+ S   DG+++ K+   S      V  +AY RR R
Sbjct  152  LNAAQPKHSLPSDGHKNTKKPAASGLSHLGVKSQAYVRRNR  192


 Score = 32.0 bits (71),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = -2

Query  486  QGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            QGG+PL+F + +  +V V S S T+Q   Q V
Sbjct  61   QGGNPLDFNFAHLETVGVHSASLTNQVEAQTV  92



>ref|XP_008657537.1| PREDICTED: uncharacterized protein LOC103637041 [Zea mays]
Length=1320

 Score = 64.7 bits (156),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 4/101 (4%)
 Frame = -1

Query  298  SEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSR  119
            S+AKGSF  +ASP  DSVES  +PG ++  E N+ADNLML  G    +  E+ + R   R
Sbjct  89   SDAKGSF--SASPLGDSVESTDKPGGSMCRETNTADNLMLLGGGKNDIAEEKVVKRGTKR  146

Query  118  TSTATPEQSTRMDGNQSAKELGDSAA--FEVPRKAYKRRVR  2
             + A P+ S   DG+++ K+   S      V  +AY RR R
Sbjct  147  LNAAQPKHSLPSDGHKNTKKPAASGLSHLGVKSQAYVRRNR  187


 Score = 30.4 bits (67),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -2

Query  495  FSLQGGDPLEFKYGNAASVSVQSTSPTDQQPDQFV  391
            F  +GG+PL+F + +  +V V S S T+Q   Q V
Sbjct  53   FLEKGGNPLDFNFAHLETVGVHSASLTNQVEAQTV  87



>gb|KEH16078.1| DNA-binding protein, putative [Medicago truncatula]
Length=428

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = -1

Query  241  SIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTSTATPEQSTRMDGNQSAK  62
            S  RPG   I EPN+ADNL+LFDGENE  EGE+R   +  R   A  EQS+++ G Q+AK
Sbjct  5    STARPGPPSINEPNTADNLLLFDGENELPEGEKRSLHSYKRNKIAPSEQSSQIGGGQNAK  64

Query  61   ELGDSAAFEVPRKAYKRRVR  2
            E  +SA F     +Y RR R
Sbjct  65   ETEESAIF----TSYTRRNR  80



>gb|EPS63531.1| hypothetical protein M569_11253, partial [Genlisea aurea]
Length=247

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 58/101 (57%), Gaps = 8/101 (8%)
 Frame = -1

Query  301  CSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLS  122
             +EAKGSFA  AS H DSVES   P      E NSADNL+L D E E+ EG +  SR  S
Sbjct  30   ANEAKGSFAL-ASSHGDSVESTGGPRLAPF-EANSADNLLLIDAETEFSEGGRSSSRPCS  87

Query  121  RTSTATP-EQSTRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
              S   P EQS     NQ+ K  G S A  +PRKAYKRR R
Sbjct  88   --SDFIPVEQSAH--ANQTQKH-GGSTASALPRKAYKRRYR  123



>emb|CAN70776.1| hypothetical protein VITISV_018341 [Vitis vinifera]
Length=629

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 45/85 (53%), Gaps = 10/85 (12%)
 Frame = -1

Query  304  HCSEAKGSFAFTASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRI----  137
            H +EAKGS A TASPH DS+E   RPG +++CEP  ADNL+L   +  Y+ G   I    
Sbjct  521  HHAEAKGSSALTASPHGDSIEGGGRPGESILCEPIGADNLLLLMVKMRYLIGTPYILVGG  580

Query  136  -----SRNLSR-TSTATPEQSTRMD  80
                   N  R      PE+S R D
Sbjct  581  TTLCHQNNHPRWMRVKMPEESRRPD  605



>ref|XP_009139650.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103863649 
[Brassica rapa]
Length=1751

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -1

Query  271  TASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTSTATPEQS  92
            TASP  DSVES  R G   + EPN+ADNL+LFD +N+ +EG++       R+ T+  ++S
Sbjct  76   TASPPGDSVESSGRLG---VSEPNTADNLLLFDSDNKSLEGDRNSQYPNKRSRTSESQRS  132

Query  91   TRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +++ ++  KE  DSA F    + Y RR R
Sbjct  133  LKVNHSRDKKETEDSAIF----RPYARRNR  158



>emb|CDY01111.1| BnaA04g07080D [Brassica napus]
Length=1732

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = -1

Query  271  TASPHEDSVESIRRPGATLICEPNSADNLMLFDGENEYVEGEQRISRNLSRTSTATPEQS  92
            TASP  DSVES  R G   + EPN+ADNL+LFD +N+ +EG++       R+ T+  ++S
Sbjct  92   TASPPGDSVESSGRLG---VSEPNTADNLLLFDSDNKSLEGDRNSQYPNKRSRTSESQRS  148

Query  91   TRMDGNQSAKELGDSAAFEVPRKAYKRRVR  2
             +++ ++  KE  DSA F    + Y RR R
Sbjct  149  LKVNHSRDKKETEDSAIF----RPYARRNR  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515