BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017D04 447 bp,:Filtered

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II  97.4    4e-37   Ipomoea batatas [batate]
gb|AAK27969.1|AF242373_1  cysteine protease                           97.8    4e-37   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I   97.4    4e-37   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I   97.4    4e-37   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...  97.4    5e-37   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II  97.4    2e-36   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                       91.7    1e-35   Jatropha curcas
ref|XP_002512963.1|  cysteine protease, putative                      91.7    2e-35   Ricinus communis
gb|KHG24064.1|  Cysteinease RD19a -like protein                       91.3    5e-35   Gossypium arboreum [tree cotton]
gb|AIB06024.1|  CP2                                                   90.1    7e-35   Hevea brasiliensis [jebe]
gb|AAX19661.1|  cysteine proteinase                                   91.7    9e-35   Populus tomentosa [Chinese white poplar]
gb|KJB32561.1|  hypothetical protein B456_005G247000                  90.1    1e-34   Gossypium raimondii
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a             91.3    1e-34   Populus euphratica
gb|ABQ10201.1|  cysteine protease Cp3                                 89.4    2e-34   Actinidia deliciosa [Chinese gooseberry]
emb|CDP20652.1|  unnamed protein product                              89.7    2e-34   Coffea canephora [robusta coffee]
gb|KJB79047.1|  hypothetical protein B456_013G033800                  90.1    3e-34   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase             90.1    3e-34   Gossypium hirsutum [American cotton]
gb|KHG15253.1|  Cysteinease RD19a -like protein                       90.1    3e-34   Gossypium arboreum [tree cotton]
gb|ABK92536.1|  unknown                                               91.3    4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002313770.1|  cysteine proteinase A494 precursor               91.3    4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_007042077.1|  Papain family cysteine protease                  91.7    4e-34   Theobroma cacao [chocolate]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                 88.2    5e-34   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like        88.2    5e-34   Citrus sinensis [apfelsine]
ref|XP_003606998.1|  Cysteine proteinase                              92.8    5e-34   Medicago truncatula
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like        89.4    5e-34   Pyrus x bretschneideri [bai li]
ref|NP_001267989.1|  cysteine protease precursor                      89.4    6e-34   Vitis vinifera
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a             89.0    6e-34   Pyrus x bretschneideri [bai li]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like        89.4    7e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a             89.0    7e-34   Malus domestica [apple tree]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg           87.4    8e-34   Citrus clementina
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494     89.4    9e-34   Fragaria vesca subsp. vesca
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a             89.4    1e-33   Prunus mume [ume]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg           89.4    1e-33   Prunus persica
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like        91.3    1e-33   Glycine max [soybeans]
gb|ACI04578.1|  cysteine protease-like protein                        91.3    1e-33   Robinia pseudoacacia [black locust]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like        88.2    1e-33   Pyrus x bretschneideri [bai li]
gb|KHN39817.1|  Cysteine proteinase RD19a                             90.9    2e-33   Glycine soja [wild soybean]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  92.4    2e-33   Sesamum indicum [beniseed]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like        87.4    2e-33   Eucalyptus grandis [rose gum]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like        89.0    2e-33   Populus euphratica
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like            92.4    2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002305451.2|  cysteine proteinase A494 precursor               87.8    2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like        90.9    3e-33   Cicer arietinum [garbanzo]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like          88.6    3e-33   Populus euphratica
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like        88.2    3e-33   Sesamum indicum [beniseed]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494     88.6    4e-33   Eucalyptus grandis [rose gum]
gb|ABK96580.1|  unknown                                               87.4    5e-33   Populus trichocarpa x Populus deltoides
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g           87.4    5e-33   Populus trichocarpa [western balsam poplar]
gb|ABK96252.1|  unknown                                               87.0    5e-33   Populus trichocarpa x Populus deltoides
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...  88.2    6e-33   Carica papaya [mamon]
gb|ABK94801.1|  unknown                                               87.4    6e-33   Populus trichocarpa [western balsam poplar]
gb|AAR92156.1|  putative cysteine protease 3                          87.8    6e-33   Iris x hollandica [Dutch iris]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like        88.2    1e-32   Eucalyptus grandis [rose gum]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g           92.0    1e-32   Phaseolus vulgaris [French bean]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like        90.1    2e-32   Glycine max [soybeans]
ref|XP_002510469.1|  cysteine protease, putative                      87.0    2e-32   Ricinus communis
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I             85.5    2e-32   Cucumis sativus [cucumbers]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like        85.5    2e-32   
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  85.5    2e-32   
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like        88.6    3e-32   Cucumis sativus [cucumbers]
gb|ABF46642.1|  papain-like cysteine proteinase                       87.0    3e-32   Pachysandra terminalis
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like        89.0    4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like            85.1    6e-32   Elaeis guineensis
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a             84.0    6e-32   Tarenaya hassleriana [spider flower]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor   89.0    6e-32   Glycine max [soybeans]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like          89.0    7e-32   Glycine max [soybeans]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like        90.1    7e-32   Nicotiana tomentosiformis
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg              88.6    7e-32   Erythranthe guttata [common monkey flower]
gb|KHN45894.1|  Cysteine proteinase RD19a                             89.0    8e-32   Glycine soja [wild soybean]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494     85.5    8e-32   Tarenaya hassleriana [spider flower]
gb|KHN25410.1|  Cysteine proteinase RD19a                             87.8    8e-32   Glycine soja [wild soybean]
dbj|BAC41322.1|  hypothetical protein                                 89.7    8e-32   Lotus japonicus
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like            87.8    9e-32   Phoenix dactylifera
dbj|BAJ53178.1|  JHL18I08.12                                          84.3    9e-32   Jatropha curcas
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg              87.8    1e-31   Erythranthe guttata [common monkey flower]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1       89.7    1e-31   Lotus japonicus
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like        90.5    1e-31   Solanum tuberosum [potatoes]
gb|KJB07487.1|  hypothetical protein B456_001G026600                  86.7    1e-31   Gossypium raimondii
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                88.2    1e-31   Narcissus pseudonarcissus
gb|AAU81591.1|  cysteine proteinase                                   89.4    1e-31   Petunia x hybrida [garden petunia]
dbj|BAF98584.1|  CM0216.500.nc                                        89.4    1e-31   Lotus japonicus
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a             88.2    1e-31   Vitis vinifera
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like          87.4    1e-31   Citrus sinensis [apfelsine]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a             90.5    1e-31   Solanum lycopersicum
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like        87.0    1e-31   Brassica rapa
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like        87.0    1e-31   Pyrus x bretschneideri [bai li]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like        87.0    2e-31   Pyrus x bretschneideri [bai li]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like          85.1    2e-31   Populus euphratica
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2       89.0    2e-31   Lotus japonicus
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like        84.3    2e-31   Cucumis melo [Oriental melon]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like            86.3    2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                 87.0    2e-31   Citrus sinensis [apfelsine]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor               85.1    2e-31   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like        88.6    2e-31   Cucumis melo [Oriental melon]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A               89.7    2e-31   Vitis vinifera
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg           87.0    2e-31   Citrus clementina
gb|AAU81589.1|  cysteine proteinase                                   87.8    2e-31   Petunia x hybrida [garden petunia]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g           84.7    2e-31   Populus trichocarpa [western balsam poplar]
gb|KHN22211.1|  Cysteine proteinase 15A                               87.0    2e-31   Glycine soja [wild soybean]
ref|NP_568052.1|  cysteine proteinase RD19a                           86.3    2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65162.1|  cysteine proteinase RD19A                             86.3    2e-31   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF98585.1|  CM0216.510.nc                                        89.0    2e-31   Lotus japonicus
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210        84.3    3e-31   Amborella trichopoda
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like          88.6    3e-31   Fragaria vesca subsp. vesca
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg           85.1    3e-31   Eutrema salsugineum
ref|XP_007017672.1|  Papain family cysteine protease                  87.8    3e-31   Theobroma cacao [chocolate]
ref|XP_010105270.1|  Cysteine proteinase 15A                          87.4    4e-31   Morus notabilis
gb|ABK93575.1|  unknown                                               84.0    4e-31   Populus trichocarpa [western balsam poplar]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                87.4    4e-31   Phaseolus vulgaris [French bean]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g           87.4    4e-31   Phaseolus vulgaris [French bean]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like          84.3    4e-31   Brassica rapa
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A               82.8    4e-31   Malus domestica [apple tree]
emb|CDY34441.1|  BnaC01g21920D                                        84.3    4e-31   Brassica napus [oilseed rape]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                  84.7    4e-31   Arabis alpina [alpine rockcress]
emb|CDY71205.1|  BnaCnng71840D                                        85.1    4e-31   Brassica napus [oilseed rape]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease     85.1    5e-31   Brassica oleracea
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg           84.0    5e-31   Capsella rubella
emb|CDQ51995.1|  Cysteine proteinase                                  87.4    5e-31   Fagus sylvatica
gb|AJP16692.1|  cysteine protease                                     85.1    6e-31   Striga hermonthica [purple witchweed]
emb|CDY09707.1|  BnaC07g33540D                                        86.3    7e-31   Brassica napus [oilseed rape]
gb|AIB06025.1|  CP3                                                   84.7    7e-31   Hevea brasiliensis [jebe]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677           83.6    7e-31   Arabidopsis lyrata subsp. lyrata
dbj|BAF46302.1|  cysteine proteinase precursor                        84.3    7e-31   Ipomoea nil [qian niu]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g           87.4    8e-31   Phaseolus vulgaris [French bean]
emb|CDY41960.1|  BnaA01g05320D                                        83.2    1e-30   Brassica napus [oilseed rape]
dbj|BAF03553.1|  cysteine proteinase CP2                              87.0    1e-30   Phaseolus vulgaris [French bean]
gb|ACX54787.2|  cysteine protease                                     82.8    1e-30   Arachis diogoi
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a             82.4    1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a             82.8    1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like        82.4    2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A               88.2    2e-30   
dbj|BAA92495.1|  cysteine protease                                    83.6    2e-30   Vigna mungo [urad dal]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a             82.0    2e-30   Brassica rapa
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like          88.2    2e-30   Glycine max [soybeans]
gb|ACM80348.1|  cysteine proteinase                                   85.9    2e-30   Solanum lycopersicum
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like        80.9    2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like          80.5    3e-30   Camelina sativa [gold-of-pleasure]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...  84.0    3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAB62937.1|  stress-induced cysteine proteinase                    83.2    3e-30   Lavatera thuringiaca
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like        84.0    3e-30   Brassica rapa
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like          80.5    3e-30   Camelina sativa [gold-of-pleasure]
emb|CDX90537.1|  BnaA03g42440D                                        84.0    3e-30   Brassica napus [oilseed rape]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like          79.3    3e-30   Sesamum indicum [beniseed]
gb|KHN12668.1|  Cysteine proteinase 15A                               87.0    4e-30   Glycine soja [wild soybean]
gb|ACK57563.1|  cysteine protease-like protein                        83.2    4e-30   Arachis hypogaea [goober]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like            81.6    5e-30   Phoenix dactylifera
gb|AAQ81938.1|  cysteine proteinase precursor                         84.0    5e-30   Ipomoea batatas [batate]
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A               80.1    5e-30   Pyrus x bretschneideri [bai li]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like            79.0    6e-30   
ref|XP_003589348.1|  Cysteine proteinase                              87.0    6e-30   Medicago truncatula
emb|CDP07452.1|  unnamed protein product                              80.1    6e-30   Coffea canephora [robusta coffee]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like            81.3    7e-30   Elaeis guineensis
emb|CAB17075.1|  cysteine proteinase precursor                        84.3    7e-30   Phaseolus vulgaris [French bean]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like        84.3    9e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg           80.5    1e-29   Eutrema salsugineum
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg           79.3    1e-29   Capsella rubella
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...  87.0    2e-29   Pisum sativum [garden pea]
gb|KJB29611.1|  hypothetical protein B456_005G110200                  83.6    2e-29   Gossypium raimondii
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830        80.9    2e-29   Sorghum bicolor [broomcorn]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like          80.9    2e-29   Prunus mume [ume]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A               85.1    2e-29   Vitis vinifera
gb|AAB67878.1|  pre-pro-cysteine proteinase                           86.7    2e-29   Vicia faba [broad bean]
gb|AAO11786.1|  pre-pro cysteine proteinase                           86.7    2e-29   Vicia faba [broad bean]
emb|CAB53397.1|  cysteine protease                                    85.5    2e-29   Medicago sativa [alfalfa]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor               84.0    2e-29   Solanum melongena [aubergine]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like            79.0    2e-29   Setaria italica
gb|AJA74415.1|  cysteine protease                                     88.6    2e-29   Cicer arietinum [garbanzo]
emb|CAD40319.2|  OSJNBb0054B09.3                                      79.3    2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg           80.5    2e-29   Prunus persica
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor   88.6    2e-29   Cicer arietinum [garbanzo]
gb|EMT16425.1|  Cysteine proteinase 1                                 79.0    2e-29   Aegilops tauschii
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like        80.1    3e-29   Cucumis melo [Oriental melon]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like            79.3    3e-29   Brachypodium distachyon [annual false brome]
gb|KJB58164.1|  hypothetical protein B456_009G197400                  81.6    3e-29   Gossypium raimondii
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like            78.6    3e-29   
gb|EEE60725.1|  hypothetical protein OsJ_14236                        79.0    3e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KHG15062.1|  Cysteinease RD19a -like protein                       82.4    3e-29   Gossypium arboreum [tree cotton]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200             79.3    4e-29   Arabis alpina [alpine rockcress]
gb|EAY93546.1|  hypothetical protein OsI_15336                        79.0    4e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001052440.1|  Os04g0311400                                     78.6    5e-29   
gb|AAK07731.1|  CPR2-like cysteine proteinase                         81.6    5e-29   Nicotiana tabacum [American tobacco]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like          81.6    5e-29   Nicotiana tomentosiformis
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                  81.6    5e-29   Nicotiana tabacum [American tobacco]
gb|EMS53996.1|  Cysteine proteinase 1                                 78.2    5e-29   Triticum urartu
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                  81.6    5e-29   Nicotiana tabacum [American tobacco]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like          81.3    6e-29   Nicotiana sylvestris
ref|XP_003607110.1|  Cysteine proteinase                              90.5    6e-29   Medicago truncatula
emb|CAA82995.1|  cysteine proteinase                                  87.0    6e-29   Vicia sativa [spring vetch]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like            77.4    8e-29   Setaria italica
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like            82.4    8e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH30505.1|  papain family cysteine protease                       90.1    8e-29   Medicago truncatula
ref|NP_567489.1|  papain family cysteine protease                     77.4    8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142           77.4    8e-29   Arabidopsis lyrata subsp. lyrata
gb|ACF86683.1|  unknown                                               79.3    1e-28   Zea mays [maize]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                  79.3    1e-28   Zea mays [maize]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like            82.4    1e-28   Brachypodium distachyon [annual false brome]
gb|AAB16996.1|  thiol protease isoform B                              82.4    1e-28   Glycine max [soybeans]
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg              82.8    2e-28   Erythranthe guttata [common monkey flower]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like        78.2    2e-28   Cucumis sativus [cucumbers]
emb|CAH59428.1|  cysteine protease 2                                  83.2    2e-28   Plantago major [cart-track plant]
gb|ABK24153.1|  unknown                                               82.4    3e-28   Picea sitchensis
ref|NP_001046828.1|  Os02g0469600                                     77.4    4e-28   
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A               82.8    4e-28   
gb|AES89347.2|  papain family cysteine protease                       88.6    6e-28   Medicago truncatula
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like          82.8    6e-28   Solanum tuberosum [potatoes]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor          79.0    7e-28   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003607150.1|  Cysteine proteinase                              88.6    7e-28   
dbj|BAG16515.1|  putative cysteine proteinase                         79.3    8e-28   Capsicum chinense [bonnet pepper]
emb|CAA57675.1|  cysteine proteinase                                  77.4    8e-28   Zea mays [maize]
gb|EMT10192.1|  Cysteine proteinase 1                                 78.2    1e-27   Aegilops tauschii
gb|AAZ32411.1|  cysteine proteinase glycinain type                    77.0    1e-27   Nicotiana benthamiana
dbj|BAD10859.1|  cysteine protease                                    75.9    1e-27   Tripolium pannonicum [sea starwort]
gb|AAW21813.1|  cysteine protease                                     78.2    1e-27   Triticum aestivum [Canadian hard winter wheat]
gb|ABK21238.1|  unknown                                               77.0    1e-27   Picea sitchensis
gb|ABK24688.1|  unknown                                               77.0    1e-27   Picea sitchensis
gb|ACN40679.1|  unknown                                               77.4    1e-27   Picea sitchensis
gb|EMS64962.1|  Cysteine proteinase 1                                 78.2    1e-27   Triticum urartu
gb|AEX97108.1|  cysteine proteinase                                   75.1    1e-27   Malus domestica [apple tree]
gb|AGS43121.1|  cysteine protease 1                                   76.3    2e-27   Zea mays [maize]
emb|CAA78403.1|  pre-pro-cysteine proteinase                          80.5    2e-27   Solanum lycopersicum
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like        76.3    2e-27   Nicotiana sylvestris
emb|CAQ00101.1|  papain-like cysteine proteinase                      79.0    5e-27   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a             75.5    5e-27   Vitis vinifera
gb|EPS70818.1|  cysteine proteinase                                   82.4    6e-27   Genlisea aurea
gb|AAB16997.1|  thiol protease isoform A                              77.4    7e-27   Glycine max [soybeans]
gb|EPS65881.1|  cysteine proteinase                                   78.6    2e-26   Genlisea aurea
gb|ADY04293.1|  cysteine protease                                     79.7    5e-26   Clarkia xantiana subsp. xantiana
gb|ADY04482.1|  cysteine protease                                     78.2    5e-26   Clarkia xantiana subsp. xantiana
gb|ADY04361.1|  cysteine protease                                     79.0    7e-26   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                       72.4    7e-26   Tripolium pannonicum [sea starwort]
gb|ADY04342.1|  cysteine protease                                     79.0    8e-26   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                     79.0    8e-26   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                     79.0    8e-26   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                     79.0    9e-26   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                     78.6    1e-25   Clarkia xantiana subsp. xantiana
gb|ADY04359.1|  cysteine protease                                     79.0    1e-25   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                     79.0    1e-25   Clarkia xantiana subsp. xantiana
gb|ADY04480.1|  cysteine protease                                     77.8    2e-25   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                     77.8    2e-25   Clarkia xantiana subsp. xantiana
gb|ADY04295.1|  cysteine protease                                     76.6    3e-25   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                     78.6    4e-25   Clarkia xantiana subsp. xantiana
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274            73.6    5e-25   Selaginella moellendorffii
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           73.6    6e-25   Selaginella moellendorffii
gb|AAB53103.1|  cysteine protease                                     69.7    2e-24   Brassica napus [oilseed rape]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          73.9    3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           73.9    3e-23   Capsella rubella
gb|KEH43476.1|  papain family cysteine protease                       73.2    3e-23   Medicago truncatula
emb|CAB41090.1|  cysteine proteinase precursor-like protein           73.9    3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           73.6    4e-23   Arabidopsis lyrata subsp. lyrata
ref|NP_567010.5|  Papain family cysteine protease                     73.6    4e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  72.8    8e-23   Arabis alpina [alpine rockcress]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          72.8    9e-23   Cicer arietinum [garbanzo]
gb|KHN00877.1|  Cysteine proteinase 15A                               71.2    1e-22   Glycine soja [wild soybean]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               70.1    2e-22   Tarenaya hassleriana [spider flower]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        78.6    2e-22   Sorghum bicolor [broomcorn]
emb|CCA95098.1|  putative responsive to dehydration 19                75.5    2e-22   Liriodendron tulipifera
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a             74.3    3e-22   Beta vulgaris subsp. vulgaris [field beet]
emb|CAB16316.1|  cysteine proteinase precursor                        71.6    3e-22   Vicia sativa [spring vetch]
ref|NP_001059639.1|  Os07g0480900                                     78.2    4e-22   
gb|KHN37802.1|  Cysteine proteinase 1                                 69.7    4e-22   Glycine soja [wild soybean]
ref|NP_001236888.1|  cysteine proteinase precursor                    69.7    4e-22   Glycine max [soybeans]
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           73.6    4e-22   Phaseolus vulgaris [French bean]
gb|EMS59778.1|  Cysteine proteinase 15A                               77.0    4e-22   Triticum urartu
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            76.6    5e-22   Setaria italica
gb|ADY04490.1|  cysteine protease                                     79.0    5e-22   Clarkia xantiana subsp. xantiana
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         69.3    5e-22   Glycine max [soybeans]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               77.4    5e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 71.6    6e-22   Brachypodium distachyon [annual false brome]
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       75.9    7e-22   Zea mays [maize]
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     67.8    8e-22   Brassica rapa
emb|CDX73424.1|  BnaC08g25790D                                        67.8    8e-22   Brassica napus [oilseed rape]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     75.9    8e-22   Phoenix dactylifera
emb|CDY56961.1|  BnaA09g55030D                                        67.8    8e-22   Brassica napus [oilseed rape]
emb|CAQ00102.1|  papain-like cysteine proteinase                      76.3    1e-21   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               72.0    1e-21   Malus domestica [apple tree]
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               71.2    1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     72.4    2e-21   Brassica rapa
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        75.1    2e-21   Phoenix dactylifera
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              75.1    2e-21   Phoenix dactylifera
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          71.2    2e-21   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           68.6    2e-21   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              69.3    2e-21   
ref|XP_001781954.1|  predicted protein                                69.7    3e-21   
gb|AEQ54770.1|  cysteine proteinase CP1                               68.6    4e-21   
gb|EEC82027.1|  hypothetical protein OsI_25996                        73.6    6e-21   
gb|KJB73490.1|  hypothetical protein B456_011G235500                  68.9    8e-21   
ref|XP_001761980.1|  predicted protein                                67.8    8e-21   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               67.4    8e-21   
emb|CDO99795.1|  unnamed protein product                              66.6    9e-21   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               67.4    9e-21   
emb|CDX98179.1|  BnaC07g09190D                                        82.8    9e-21   
emb|CDY13816.1|  BnaA09g43180D                                        70.1    9e-21   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               67.8    1e-20   
gb|KHG08355.1|  Cysteinease 1                                         68.2    1e-20   
emb|CAB17077.1|  cysteine proteinase precursor                        68.9    1e-20   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           69.7    1e-20   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               69.7    1e-20   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               68.9    1e-20   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     73.9    2e-20   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               67.8    2e-20   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               67.0    2e-20   
gb|ABO93617.1|  papain-like cysteine proteinase                       73.9    3e-20   
emb|CBI31400.3|  unnamed protein product                              67.4    5e-20   
gb|ADE76932.1|  unknown                                               63.5    5e-20   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       66.2    5e-20   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 65.5    6e-20   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          64.7    7e-20   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               66.6    7e-20   
ref|XP_002533377.1|  cysteine protease, putative                      66.6    7e-20   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           66.2    8e-20   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           65.5    9e-20   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          66.2    9e-20   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          66.2    9e-20   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               65.5    1e-19   
emb|CCA95082.1|  putative responsive to dehydration 19                77.0    1e-19   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        63.2    2e-19   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   65.1    2e-19   
ref|XP_010103534.1|  putative cysteine proteinase A494                67.8    2e-19   
ref|XP_007010012.1|  Papain family cysteine protease                  66.2    2e-19   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             62.8    1e-18   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            62.4    2e-18   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  64.7    4e-18   
ref|NP_565512.1|  Papain family cysteine protease                     87.4    1e-17   
emb|CAA52403.1|  putative thiol protease                              87.0    1e-17   
dbj|BAD43619.1|  putative cysteine proteinase                         87.4    1e-17   
gb|AFW72358.1|  putative cysteine protease family protein             65.1    1e-17   
ref|XP_001419933.1|  predicted protein                                59.3    2e-17   
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg           85.5    5e-17   
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008           85.5    6e-17   
gb|EPS63354.1|  hypothetical protein M569_11429                       63.9    6e-17   
emb|CDX99593.1|  BnaC04g33500D                                        84.7    8e-17   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          63.2    9e-17   
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494     84.3    1e-16   
emb|CDY15894.1|  BnaA04g12170D                                        84.3    1e-16   
ref|XP_003057227.1|  predicted protein                                61.6    1e-16   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   65.1    6e-16   
ref|XP_002505924.1|  cysteine endopeptidase                           57.0    9e-16   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  66.6    9e-16   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  77.8    2e-15   
gb|EZA58965.1|  Putative cysteine proteinase                          64.7    2e-15   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  65.1    3e-15   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  69.3    4e-15   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  64.3    4e-15   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  65.9    5e-15   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  65.9    5e-15   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  65.9    6e-15   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  64.3    6e-15   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  66.2    7e-15   
emb|CAC94443.1|  cysteine proteinase                                  76.6    9e-15   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  63.2    1e-14   
gb|ABY75169.1|  cysteine protease                                     74.3    1e-14   
ref|XP_001844355.1|  conserved hypothetical protein                   64.7    1e-14   
gb|KFB38327.1|  AGAP002879-PB-like protein                            66.2    1e-14   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  63.9    2e-14   
gb|AJF94882.1|  C1 family cathepsin F10                               61.6    3e-14   
ref|XP_011493714.1|  AAEL017153-PA                                    64.7    3e-14   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.8    3e-14   
gb|EGI66903.1|  Putative cysteine proteinase                          67.4    3e-14   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           62.8    5e-14   
ref|XP_002000409.1|  GI10216                                          62.8    5e-14   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   63.2    5e-14   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           62.4    7e-14   
emb|CBY11269.1|  unnamed protein product                              62.8    7e-14   
gb|ETN61472.1|  hypothetical protein AND_006867                       64.3    8e-14   
ref|XP_002017233.1|  GL22196                                          62.4    8e-14   
ref|XP_001994049.1|  GH22731                                          62.4    8e-14   
ref|XP_002137768.1|  GA27408, isoform A                               62.4    8e-14   
emb|CAC94444.1|  cysteine proteinase                                  73.9    8e-14   
ref|XP_002056575.1|  GJ11017                                          62.4    9e-14   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  60.1    9e-14   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  67.8    1e-13   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  60.1    1e-13   
ref|XP_003436277.1|  AGAP002879-PB                                    66.2    1e-13   
ref|XP_002096026.1|  GE25302                                          62.4    1e-13   
ref|XP_002038380.1|  GM10654                                          62.4    1e-13   
ref|NP_730901.1|  CG12163, isoform A                                  62.4    1e-13   
ref|XP_312034.5|  AGAP002879-PA                                       65.9    1e-13   
gb|KDR17524.1|  Putative cysteine proteinase                          63.5    2e-13   
ref|XP_001955780.1|  GF16067                                          62.0    2e-13   
ref|XP_001978897.1|  GG11133                                          62.4    2e-13   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  63.2    2e-13   
ref|XP_003736743.1|  GA27408, isoform B                               61.6    2e-13   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   61.2    3e-13   
gb|AFQ01139.1|  cathepsin F-like protease                             60.8    3e-13   
gb|ENN81374.1|  hypothetical protein YQE_02191                        60.8    3e-13   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  62.8    3e-13   
ref|NP_649521.1|  CG12163, isoform B                                  61.6    4e-13   
ref|XP_002073772.1|  GK14287                                          62.8    4e-13   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   60.5    4e-13   
emb|CBY31096.1|  unnamed protein product                              60.8    5e-13   
ref|XP_003436276.1|  AGAP002879-PC                                    63.5    5e-13   
gb|ACU18072.1|  unknown                                               70.5    2e-12   
gb|ABE72973.1|  cathepsin L                                           59.3    2e-12   
gb|KFM67613.1|  putative cysteine proteinase                          60.8    2e-12   
emb|CBI23088.3|  unnamed protein product                              58.2    2e-12   
dbj|BAN20819.1|  cysteine-type endopeptidase                          57.4    3e-12   
gb|ERL92611.1|  hypothetical protein D910_09924                       58.5    3e-12   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               60.5    4e-12   
ref|XP_002682087.1|  predicted protein                                62.0    4e-12   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           58.9    5e-12   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          58.5    6e-12   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  57.8    7e-12   
gb|ABC48936.1|  cathepsin F like protease                             60.5    1e-11   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                58.2    1e-11   
emb|CDX82031.1|  BnaC08g35700D                                        58.5    1e-11   
dbj|BAF94154.1|  cathepsin F-like cysteine protease                   53.1    3e-11   
ref|XP_003115597.1|  CRE-TAG-196 protein                              69.3    6e-11   
gb|AII16490.1|  cathepsin F                                           55.5    8e-11   
ref|NP_505215.2|  Protein TAG-196                                     68.6    1e-10   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        63.2    2e-10   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     53.9    2e-10   
ref|XP_009035714.1|  hypothetical protein AURANDRAFT_53321            53.1    2e-10   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            48.5    3e-10   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  67.4    3e-10   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056           48.5    3e-10   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     54.7    5e-10   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  67.0    7e-10   
dbj|BAD94378.1|  hypothetical protein                                 61.2    8e-10   
ref|XP_003375070.1|  viral cathepsin                                  62.8    9e-10   
gb|KIH48456.1|  cysteine proteinase family protein                    61.2    9e-10   
ref|XP_007510080.1|  unknown                                          65.9    1e-09   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  66.2    1e-09   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   61.6    1e-09   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  65.9    1e-09   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  65.1    2e-09   
ref|XP_008472006.1|  PREDICTED: putative cysteine proteinase CG12163  51.6    2e-09   
ref|XP_005101894.1|  PREDICTED: cathepsin F-like isoform X2           53.1    2e-09   
gb|ERG79645.1|  cysteine proteinase                                   61.2    2e-09   
gb|KHN72698.1|  Putative cysteine proteinase                          61.6    2e-09   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              65.9    2e-09   
ref|XP_002604925.1|  hypothetical protein BRAFLDRAFT_77225            58.2    2e-09   
ref|XP_635374.1|  cysteine protease                                   52.8    2e-09   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      57.0    3e-09   
ref|XP_007462039.1|  PREDICTED: cathepsin W                           59.3    3e-09   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  62.0    3e-09   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  65.1    3e-09   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  65.1    3e-09   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       62.0    3e-09   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  64.7    4e-09   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  64.7    4e-09   
emb|CDP90584.1|  Protein BM-TAG-196                                   63.9    4e-09   
ref|XP_005109777.1|  PREDICTED: cysteine proteinase RD19a-like        57.4    5e-09   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            54.3    6e-09   
gb|ABQ23398.1|  cathepsin L isotype 1                                 55.5    6e-09   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  63.5    6e-09   
gb|ABQ23399.1|  cathepsin L isotype 2                                 55.5    6e-09   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     63.9    6e-09   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            57.0    7e-09   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    63.5    7e-09   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    63.2    8e-09   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           61.6    8e-09   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  63.5    8e-09   
gb|AAO12867.1|  papain-like cysteine proteinase                       58.2    9e-09   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  63.5    9e-09   
gb|EKC42097.1|  Cathepsin F                                           63.2    1e-08   
ref|XP_005765534.1|  hypothetical protein EMIHUDRAFT_437163           52.8    1e-08   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             59.7    1e-08   
ref|XP_003378245.1|  cathepsin F                                      62.0    1e-08   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  62.4    1e-08   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  62.4    1e-08   
ref|XP_003151185.1|  hypothetical protein LOAG_15647                  57.8    2e-08   
sp|P56202.2|CATW_HUMAN  RecName: Full=Cathepsin W; AltName: Full=...  56.2    2e-08   
ref|NP_034115.2|  cathepsin W preproprotein                           58.2    2e-08   
gb|AAB82455.1|  lymphopain                                            58.2    2e-08   
ref|NP_001326.2|  cathepsin W preproprotein                           56.2    2e-08   
gb|AAB82449.1|  lymphopain                                            56.2    2e-08   
ref|XP_008479908.1|  PREDICTED: putative cysteine proteinase CG12163  55.5    2e-08   
ref|XP_008479905.1|  PREDICTED: cathepsin L-like                      55.1    2e-08   
ref|XP_805951.1|  cysteine peptidase                                  48.9    2e-08   
ref|XP_007979196.1|  PREDICTED: cathepsin W                           55.5    2e-08   
emb|CCD12272.1|  unnamed protein product                              47.0    2e-08   
ref|XP_010364756.1|  PREDICTED: cathepsin W                           56.6    2e-08   
gb|AAL96762.1|AC104496_8  Tcc1l8.8                                    48.9    2e-08   
ref|XP_002821545.1|  PREDICTED: cathepsin W                           57.0    2e-08   
gb|ABI13158.1|  putative cysteine protease                            50.8    2e-08   
ref|XP_820174.1|  cysteine peptidase                                  48.5    2e-08   
ref|XP_001112560.1|  PREDICTED: cathepsin W-like isoform 2            55.5    3e-08   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      61.6    3e-08   
ref|XP_005577276.1|  PREDICTED: cathepsin W isoform X2                55.5    3e-08   
gb|EQB77684.1|  Cathepsin F precursor (CATSF)-like protein            54.3    3e-08   
gb|AAF75546.1|  cruzipain                                             48.5    3e-08   
gb|ACR08662.1|  cathepsin F                                           59.3    3e-08   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            61.2    3e-08   
ref|XP_003909601.1|  PREDICTED: cathepsin W isoform X2                55.1    3e-08   
gb|AAP33049.1|  cysteine proteinase 1                                 60.8    3e-08   
ref|XP_005577275.1|  PREDICTED: cathepsin W isoform X1                55.1    3e-08   
gb|AAB41118.1|  cruzipain                                             48.5    3e-08   
ref|XP_009037801.1|  hypothetical protein AURANDRAFT_2413             50.8    3e-08   
gb|AAG35357.1|AF314929_1  cruzipain                                   48.5    3e-08   
sp|P25779.1|CYSP_TRYCR  RecName: Full=Cruzipain; AltName: Full=Cr...  48.5    3e-08   
ref|XP_818579.1|  cruzipain precursor                                 48.5    3e-08   
ref|XP_818578.1|  cysteine peptidase                                  48.5    3e-08   
pdb|4PI4|A  Chain A, Crystal Structure Analysis Of Cruzain Bound ...  48.1    3e-08   
gb|EKC21001.1|  Cathepsin F                                           52.0    3e-08   
emb|CCD15484.1|  unnamed protein product                              53.9    3e-08   
ref|XP_004618593.1|  PREDICTED: cathepsin W                           57.8    3e-08   
gb|AFM37363.1|  cathepsin F1                                          61.2    3e-08   
ref|XP_011449944.1|  PREDICTED: cathepsin L1-like                     51.6    4e-08   
gb|AAS20591.1|  digestive cysteine proteinase intestain               47.0    4e-08   
ref|XP_007171029.1|  PREDICTED: cathepsin W                           57.4    4e-08   



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score = 97.4 bits (241),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  319  MKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368


 Score = 84.0 bits (206),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  321



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score = 97.8 bits (242),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  317  MKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366


 Score = 84.0 bits (206),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  281  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  319



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 97.4 bits (241),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  319  MKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368


 Score = 84.0 bits (206),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  321



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 97.4 bits (241),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  319  MKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368


 Score = 84.0 bits (206),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  321



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score = 97.4 bits (241),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  317  MKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366


 Score = 84.0 bits (206),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  281  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  319



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score = 97.4 bits (241),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  317  MKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366


 Score = 81.6 bits (200),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            +QTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  281  VQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  319



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score = 91.7 bits (226),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAAV T +
Sbjct  322  LKEKPYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS  369


 Score = 84.7 bits (208),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIRLKE
Sbjct  286  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKE  324



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score = 91.7 bits (226),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV T +
Sbjct  325  MKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVQTAS  372


 Score = 84.3 bits (207),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  327



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score = 91.3 bits (225),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDS+VSTVAAVNT
Sbjct  326  LKDKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSLVSTVAAVNT  371


 Score = 83.2 bits (204),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIRLK+
Sbjct  290  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKD  328



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score = 90.1 bits (222),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA-VNTPT  253
            ++ KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA V TP+
Sbjct  323  LKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVVQTPS  371


 Score = 84.0 bits (206),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+AP+RLKE
Sbjct  287  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRLKE  325



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score = 91.7 bits (226),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T +
Sbjct  326  MKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTSS  373


 Score = 82.0 bits (201),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG+AP+R+KE
Sbjct  290  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKE  328



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score = 90.1 bits (222),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  326  LKDKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVAAVNT  371


 Score = 83.2 bits (204),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIRLK+
Sbjct  290  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKD  328



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score = 91.3 bits (225),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T +
Sbjct  320  MKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTNS  367


 Score = 82.0 bits (201),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG+AP+R+KE
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKE  322



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score = 89.4 bits (220),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGESWGE G+YKIC+GRN+CGVDSMVSTVAAV+T ++
Sbjct  317  MKEKPYWIIKNSWGESWGENGFYKICQGRNVCGVDSMVSTVAAVHTTSN  365


 Score = 82.8 bits (203),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSAG+APIR+KE
Sbjct  281  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKE  319



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 89.7 bits (221),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE WGE GYYKICRG NICGVDSMVSTVAAV+T T
Sbjct  325  MKEKPYWIIKNSWGEHWGENGYYKICRGHNICGVDSMVSTVAAVHTST  372


 Score = 82.4 bits (202),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGS+G+APIR+KE
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSSGYAPIRMKE  327



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score = 90.1 bits (222),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  325  MKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370


 Score = 82.0 bits (201),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+AP+R+K+
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKD  327



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score = 90.1 bits (222),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  325  MKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370


 Score = 81.6 bits (200),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+AP+R+K+
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKD  327



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score = 90.1 bits (222),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  325  MKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370


 Score = 81.6 bits (200),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+AP+R+K+
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKD  327



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score = 91.3 bits (225),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  320  MKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365


 Score = 80.1 bits (196),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSA +AP+R+KE
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKE  322



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 91.3 bits (225),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  320  MKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365


 Score = 80.1 bits (196),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSA +AP+R+KE
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKE  322



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score = 91.7 bits (226),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV+T
Sbjct  347  MKDKPYWIIKNSWGESWGEDGFYKICRGRNICGVDSMVSTVAAVDT  392


 Score = 79.7 bits (195),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCPYICSKRLDHGVLLVGYGSAG+AP+R+K+
Sbjct  311  MQTYIKGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKD  349



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score = 88.2 bits (217),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  329  LKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAA  372


 Score = 82.8 bits (203),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG+APIRLKE
Sbjct  293  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKE  331



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score = 88.2 bits (217),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA 
Sbjct  329  LKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAA  372


 Score = 82.8 bits (203),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG+APIRLKE
Sbjct  293  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKE  331



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score = 92.8 bits (229),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  315  LKEKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362


 Score = 78.6 bits (192),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS  ++PIRLKE
Sbjct  279  MQTYVGGVSCPYICSKRLDHGVLLVGYGSGAYSPIRLKE  317



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score = 89.4 bits (220),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  321  LKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369


 Score = 81.6 bits (200),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AG++PIRLKE
Sbjct  285  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKE  323



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score = 89.4 bits (220),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDSMVSTVAAV+T ++
Sbjct  329  MKDKPYWIIKNSWGENWGENGFYKICRGRNVCGVDSMVSTVAAVHTTSN  377


 Score = 81.6 bits (200),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSAG+APIR+K+
Sbjct  293  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKD  331



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score = 89.0 bits (219),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  321  LKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369


 Score = 81.6 bits (200),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AG++PIRLKE
Sbjct  285  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKE  323



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score = 89.4 bits (220),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            ++ KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAVN
Sbjct  322  LKDKPYWIIKNSWGEGWGENGYYKICRGRNVCGVDSMVSTVAAVN  366


 Score = 81.3 bits (199),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGS G+APIRLK+
Sbjct  286  MQTYIGGVSCPYICSKRLDHGVLLVGYGSEGYAPIRLKD  324



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score = 89.0 bits (219),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  321  LKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369


 Score = 81.6 bits (200),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AG++PIRLKE
Sbjct  285  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKE  323



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score = 87.4 bits (215),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVST+AA 
Sbjct  329  LKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAAA  372


 Score = 82.8 bits (203),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG+APIRLKE
Sbjct  293  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKE  331



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score = 89.4 bits (220),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYWIIKNSWGE+WGEKG+YKICRGRNICGVDSMVSTVAAV
Sbjct  327  MKEKPYWIIKNSWGENWGEKGFYKICRGRNICGVDSMVSTVAAV  370


 Score = 80.9 bits (198),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSAG++P+R+KE
Sbjct  291  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYSPVRMKE  329



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score = 89.4 bits (220),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGE+WGEKG+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  317  MKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365


 Score = 80.9 bits (198),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AG++PIR+KE
Sbjct  281  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKE  319



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score = 89.4 bits (220),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGE+WGEKG+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  317  MKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365


 Score = 80.5 bits (197),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AG++PIR+KE
Sbjct  281  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKE  319



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score = 91.3 bits (225),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  315  MKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362


 Score = 78.6 bits (192),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGS  +APIR+KE
Sbjct  279  MQTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKE  317



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score = 91.3 bits (225),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T
Sbjct  287  LKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVHT  332


 Score = 78.6 bits (192),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYG AG+APIRLKE
Sbjct  251  MQTYIGGVSCPYICGKNLDHGVLLVGYGKAGYAPIRLKE  289



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score = 88.2 bits (217),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  232  LKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  280


 Score = 81.3 bits (199),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AG++PIRLKE
Sbjct  196  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKE  234



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score = 90.9 bits (224),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  284  MKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  331


 Score = 78.2 bits (191),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGS  +APIR+KE
Sbjct  248  MQTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKE  286



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score = 92.4 bits (228),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 2/49 (4%)
 Frame = +2

Query  107  PVERK--PYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            P+ RK  PYWIIKNSWGE WGEKGYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  329  PIRRKEKPYWIIKNSWGEKWGEKGYYKICRGRNICGVDSMVSTVAAVST  377


 Score = 77.0 bits (188),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP ICSKRLDHGVLLVGYG AG+APIR KE
Sbjct  296  MQTYIGGVSCPLICSKRLDHGVLLVGYGEAGYAPIRRKE  334



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score = 87.4 bits (215),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV--NTPTS  256
            ++ KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA    TP S
Sbjct  319  MKDKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAVHTTPGS  369


 Score = 81.6 bits (200),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAG+APIR+K+
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKD  321



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score = 89.0 bits (219),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  320  MKDKPYWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTTS  367


 Score = 80.1 bits (196),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG++PIR+K+
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPIRMKD  322



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score = 92.4 bits (228),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            +++KP+WIIKNSWGE+WGEKGYYKICRGRN+CGVDSMVSTV A+NT
Sbjct  323  LKQKPFWIIKNSWGETWGEKGYYKICRGRNVCGVDSMVSTVTAINT  368


 Score = 76.3 bits (186),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAG++PIRLK+
Sbjct  287  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKQ  325



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 87.8 bits (216),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  320  MKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  367


 Score = 80.9 bits (198),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG++P+R+KE
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKE  322



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score = 90.9 bits (224),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  315  MKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAVHTTT  362


 Score = 77.8 bits (190),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICS+RLDHGVLLVGYGS  +APIR+KE
Sbjct  279  MQTYVGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKE  317



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 88.6 bits (218),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  320  KEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAIHT  364


 Score = 80.1 bits (196),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAG+APIR KE
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKE  321



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score = 88.2 bits (217),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTVAAV+T
Sbjct  331  LKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVDSMVSTVAAVST  376


 Score = 80.1 bits (196),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+ICSKRLDHGVLLVGYG+A +APIRLKE
Sbjct  295  MQTYIGGVSCPFICSKRLDHGVLLVGYGAASYAPIRLKE  333



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score = 88.6 bits (218),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA++T
Sbjct  328  MKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAIHT  373


 Score = 79.3 bits (194),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSA ++PIR+KE
Sbjct  292  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAAYSPIRMKE  330



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score = 87.4 bits (215),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  320  KEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364


 Score = 80.1 bits (196),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAG+APIR KE
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKE  321



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score = 87.4 bits (215),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  320  KEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364


 Score = 80.1 bits (196),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAG+APIR KE
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKE  321



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score = 87.0 bits (214),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  109  MKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  156


 Score = 80.9 bits (198),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAG++P+R+KE
Sbjct  73   MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKE  111



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score = 88.2 bits (217),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYW+IKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T +
Sbjct  48   LKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTS  95


 Score = 79.7 bits (195),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG+APIRLKE
Sbjct  12   MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPIRLKE  50



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score = 87.4 bits (215),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  320  KEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364


 Score = 80.1 bits (196),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAG+APIR KE
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKE  321



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score = 87.8 bits (216),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++T
Sbjct  242  LKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSMVSTVTAIHT  287


 Score = 79.3 bits (194),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAG+APIRLKE
Sbjct  206  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRLKE  244



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score = 88.2 bits (217),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVAA++T
Sbjct  322  KEKPYWIIKNSWGENWGENGYYKICRGRDICGVDSMVSTVAAIHT  366


 Score = 78.2 bits (191),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAG+APIR KE 
Sbjct  285  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEK  324



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score = 92.0 bits (227),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  313  MKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  360


 Score = 74.3 bits (181),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYICS+RLDHGVLLVGYGS  +APIR+KE
Sbjct  277  MQTYMHGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKE  315



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score = 90.1 bits (222),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVA+V+T T
Sbjct  317  MKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVASVHTTT  364


 Score = 75.9 bits (185),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CS+RL+HGVLLVGYGS  +APIR+KE
Sbjct  281  MQTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKE  319



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score = 87.0 bits (214),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KP+WIIKNSWGE+WGE GYYKICRGRN+CGVD+MVSTVAA++T
Sbjct  318  LKDKPFWIIKNSWGENWGENGYYKICRGRNVCGVDAMVSTVAAIHT  363


 Score = 78.6 bits (192),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKR DHGV+LVGYGSAG+AP+RLK+
Sbjct  282  MQTYIGGVSCPYICSKRQDHGVVLVGYGSAGYAPVRLKD  320



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score = 85.5 bits (210),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  332  KDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAV  372


 Score = 80.1 bits (196),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+ICSKRLDHGVLLVGYGSAG+APIR+++
Sbjct  293  MQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRD  331



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score = 85.5 bits (210),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  332  KDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAV  372


 Score = 80.1 bits (196),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+ICSKRLDHGVLLVGYGSAG+APIR+++
Sbjct  293  MQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRD  331



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score = 85.5 bits (210),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  326  KDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAV  366


 Score = 80.1 bits (196),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+ICSKRLDHGVLLVGYGSAG+APIR+++
Sbjct  287  MQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRD  325



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score = 88.6 bits (218),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T  +
Sbjct  329  LKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHTAAN  377


 Score = 76.6 bits (187),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCPYICSK LDHGVLLVGYGS G+APIRLK+
Sbjct  293  MQTYIKGVSCPYICSKHLDHGVLLVGYGSDGYAPIRLKD  331



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score = 87.0 bits (214),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGESWGEKGYYKICRGRNICG+DSMVS VAA 
Sbjct  327  KEKPYWIIKNSWGESWGEKGYYKICRGRNICGMDSMVSAVAAA  369


 Score = 78.2 bits (191),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRL-DHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKRL DHGVLLVGYGSAG APIR KE
Sbjct  289  MQTYIGGVSCPYICSKRLLDHGVLLVGYGSAGFAPIRFKE  328



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score = 89.0 bits (219),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGESWGE GYYKICRGR++CGVDSMVSTVAA++T
Sbjct  321  MKDKPYWIIKNSWGESWGENGYYKICRGRDVCGVDSMVSTVAAIHT  366


 Score = 75.9 bits (185),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RL+HGVLLVGYGS G++PIR+K+
Sbjct  285  MQTYIGGVSCPYICSRRLNHGVLLVGYGSEGYSPIRMKD  323



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score = 85.1 bits (209),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKIC+GRN+CGVDSMVSTV AV +
Sbjct  329  KEKPYWIIKNSWGENWGEDGYYKICKGRNVCGVDSMVSTVTAVRS  373


 Score = 79.0 bits (193),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAG+APIR KE
Sbjct  292  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKE  330



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score = 84.0 bits (206),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG +WGE+GYYKIC GRN+CG+D+MVS+VAAV+T T
Sbjct  322  LKEKPYWIIKNSWGANWGEEGYYKICHGRNLCGMDTMVSSVAAVHTST  369


 Score = 80.1 bits (196),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKR DHGVLLVGYGSAG++PIRLKE
Sbjct  286  MQTYIGGVSCPYICSKRQDHGVLLVGYGSAGYSPIRLKE  324



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score = 89.0 bits (219),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA++   +
Sbjct  319  KEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIHVSNN  366


 Score = 75.1 bits (183),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  +APIR KE
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKE  320



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score = 89.0 bits (219),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            + KPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  319  KEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362


 Score = 75.1 bits (183),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  +APIR KE
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKE  320



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score = 90.1 bits (222),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  321  MKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368


 Score = 73.6 bits (179),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+ G +PIR+KE
Sbjct  286  MQTYVGGVSCPYICSKRLDHGVLLVGYGT-GFSPIRMKE  323



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score = 88.6 bits (218),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T +
Sbjct  332  MKEKPYWIIKNSWGPNWGEDGYYKICRGRNICGVDSMVSTVAAVSTTS  379


 Score = 75.1 bits (183),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC+KRLDHGVLLVGYG  G++PIR+KE
Sbjct  296  MQTYMKGVSCPYICTKRLDHGVLLVGYGETGYSPIRMKE  334



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score = 89.0 bits (219),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            + KPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  319  KEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362


 Score = 75.1 bits (183),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  +APIR KE
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKE  320



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score = 85.5 bits (210),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            ++ KP+WIIKNSWGE+WGEKG+YKICRGRNICGVDS+VSTVAA
Sbjct  318  MKEKPFWIIKNSWGENWGEKGFYKICRGRNICGVDSLVSTVAA  360


 Score = 78.2 bits (191),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG+AP R+KE
Sbjct  282  MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPARMKE  320



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score = 87.8 bits (216),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KP+WIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVA+V+T T
Sbjct  317  MKEKPFWIIKNSWGENWGENGYYKICRGRSICGVDSMVSTVASVHTTT  364


 Score = 75.9 bits (185),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CS+RL+HGVLLVGYGS  +APIR+KE
Sbjct  281  MQTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKE  319



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score = 89.7 bits (221),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            +++KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  312  MKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357


 Score = 73.9 bits (180),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  +APIR+K+
Sbjct  276  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQ  314



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score = 87.8 bits (216),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV +
Sbjct  326  KEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVRS  370


 Score = 75.9 bits (185),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYGSA +APIR KE
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAAYAPIRFKE  327



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score = 84.3 bits (207),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            ++ KP+WIIKNSWGESWGE GYY+ICRGRNICGVD+MVS+VAA++
Sbjct  319  LKDKPFWIIKNSWGESWGENGYYRICRGRNICGVDAMVSSVAAIH  363


 Score = 79.0 bits (193),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAG+APIRLK+
Sbjct  283  MQTYMGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRLKD  321



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score = 87.8 bits (216),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG +WGEKGYYKIC+GRN+CGVDSMVSTVAAV T
Sbjct  331  MKEKPYWIIKNSWGPNWGEKGYYKICQGRNLCGVDSMVSTVAAVTT  376


 Score = 75.5 bits (184),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP+IC+KRLDHGVLLVGYG+   APIR+KE
Sbjct  295  MQTYVGGVSCPFICAKRLDHGVLLVGYGAGAFAPIRMKE  333



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score = 89.7 bits (221),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            +++KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  313  MKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  358


 Score = 73.6 bits (179),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  +APIR+K+
Sbjct  277  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQ  315



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score = 90.5 bits (223),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  321  MKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368


 Score = 72.8 bits (177),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G +PIR+KE
Sbjct  286  MQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKE  323



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score = 86.7 bits (213),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE+WGE GYYKICRG N+CGVDS+VSTV A+NT +
Sbjct  329  LKDKPYWIIKNSWGENWGENGYYKICRGSNVCGVDSLVSTVVALNTKS  376


 Score = 76.6 bits (187),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+ICSK LDHGVLLVGYGSAG++PI LK+
Sbjct  293  MQTYIGGVSCPFICSKHLDHGVLLVGYGSAGYSPIHLKD  331



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score = 88.2 bits (217),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            + KPYWIIKNSWGE+WGEKGYYKIC+GRN+CGVDSMVSTV A++T   D
Sbjct  88   KEKPYWIIKNSWGENWGEKGYYKICKGRNVCGVDSMVSTVTAIHTTPKD  136


 Score = 75.1 bits (183),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGS+G APIR KE
Sbjct  51   MQTYIGGVSCPYICGKHLDHGVLLVGYGSSGWAPIRFKE  89



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score = 89.4 bits (220),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  143  MKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  190


 Score = 73.6 bits (179),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKR DHGVLLVGYGS G APIR+KE
Sbjct  108  MQTYVGGVSCPYICSKRQDHGVLLVGYGS-GFAPIRMKE  145



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score = 89.4 bits (220),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            +++KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  312  MKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357


 Score = 73.6 bits (179),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  +APIR+K+
Sbjct  276  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQ  314



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 88.2 bits (217),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KPYWIIKNSWGESWGE GYYKICRG N CGVDSMVSTVAA+ T T
Sbjct  320  KEKPYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAIQTTT  366


 Score = 74.7 bits (182),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYICS+ LDHGV+LVGYGSAG+APIR KE
Sbjct  283  MQTYMKGVSCPYICSRNLDHGVVLVGYGSAGYAPIRFKE  321



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score = 87.4 bits (215),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAAV+T +S
Sbjct  322  KEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAVHTTSS  369


 Score = 75.5 bits (184),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVL+VGYGS+G APIR KE
Sbjct  285  MQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKE  323



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score = 90.5 bits (223),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  321  MKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  368


 Score = 72.4 bits (176),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G +PIR+KE
Sbjct  286  MQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKE  323



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score = 87.0 bits (214),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +PT+
Sbjct  321  KEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVTAAVSPTA  368


 Score = 75.9 bits (185),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC +RL+HGVLLVGYGSAG+AP R KE
Sbjct  284  MQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKE  322



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score = 87.0 bits (214),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  397  LKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  445


 Score = 75.9 bits (185),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVS PYICS+RLDHGVLLVGYG+AG++PIRLKE
Sbjct  361  MQTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKE  399



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score = 87.0 bits (214),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  395  LKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  443


 Score = 75.9 bits (185),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVS PYICS+RLDHGVLLVGYG+AG++PIRLKE
Sbjct  359  MQTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKE  397



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 85.1 bits (209),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA+
Sbjct  320  KEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAI  362


 Score = 77.4 bits (189),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AG+APIR KE
Sbjct  283  MQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKE  321



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score = 89.0 bits (219),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            +++KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  313  MKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  358


 Score = 73.6 bits (179),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  +APIR+K+
Sbjct  277  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQ  315



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score = 84.3 bits (207),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            K YWIIKNSWGE+WGE GYYKICRGRNICGVDS+VSTVAAV
Sbjct  330  KDYWIIKNSWGENWGENGYYKICRGRNICGVDSLVSTVAAV  370


 Score = 78.2 bits (191),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+ICS RLDHGVLLVGYGSAG+APIR+++
Sbjct  291  MQTYIGGVSCPFICSNRLDHGVLLVGYGSAGYAPIRMRD  329



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score = 86.3 bits (212),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V+A++T
Sbjct  320  LKDKPFWIIKNSWGENWGEHGYYKICRGRNICGVDSMVSSVSAIHT  365


 Score = 76.3 bits (186),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAG++PIRLK+
Sbjct  284  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKD  322



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score = 87.0 bits (214),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  322  KEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369


 Score = 75.5 bits (184),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVL+VGYGS+G APIR KE
Sbjct  285  MQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKE  323



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score = 85.1 bits (209),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVS+V+A +T
Sbjct  314  KEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSSVSAFHT  358


 Score = 77.4 bits (189),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC K LDHGVLLVGYGSAG APIR KE
Sbjct  277  MQTYVGGVSCPYICGKHLDHGVLLVGYGSAGFAPIRFKE  315



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score = 88.6 bits (218),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T  +
Sbjct  329  MKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHTAAN  377


 Score = 73.9 bits (180),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCPYICS+ LDHGVLLVGYGS G+APIR+K+
Sbjct  293  MQTYIRGVSCPYICSRHLDHGVLLVGYGSEGYAPIRMKD  331



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score = 89.7 bits (221),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGESWGE+GYYKICRG NICGVDSMVSTVAA++T
Sbjct  324  KEKPYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAIHT  368


 Score = 72.8 bits (177),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY  GVSCPYICS  LDHGVLLVGYGSAG++PIR KE
Sbjct  287  MQTYKSGVSCPYICSSTLDHGVLLVGYGSAGYSPIRFKE  325



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score = 87.0 bits (214),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  322  KEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369


 Score = 75.5 bits (184),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVL+VGYGS+G APIR KE
Sbjct  285  MQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKE  323



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score = 87.8 bits (216),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGESWGE+GYYKICRGRNICGVD+MVSTV A +T
Sbjct  207  LKEKPYWIIKNSWGESWGEQGYYKICRGRNICGVDAMVSTVTAAHT  252


 Score = 74.7 bits (182),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP IC KR DHGVLLVGYGSAG APIRLKE
Sbjct  171  MQTYVGGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKE  209



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score = 84.7 bits (208),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA+
Sbjct  320  KEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAI  362


 Score = 77.4 bits (189),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AG+APIR KE
Sbjct  283  MQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKE  321



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score = 87.0 bits (214),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGESWGE+GYY ICRGRN+CGVDSMVSTVAA++   +
Sbjct  319  KEKPYWIIKNSWGESWGEEGYYNICRGRNVCGVDSMVSTVAAIHVSNN  366


 Score = 75.1 bits (183),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  +APIR KE
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKE  320



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score = 86.3 bits (212),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  320  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367


 Score = 75.9 bits (185),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYG+AG+AP R KE
Sbjct  283  MQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKE  321



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score = 86.3 bits (212),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  320  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367


 Score = 75.9 bits (185),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYG+AG+AP R KE
Sbjct  283  MQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKE  321



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score = 89.0 bits (219),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            +++KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  312  MKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  357


 Score = 73.6 bits (179),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  +APIR+K+
Sbjct  276  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQ  314



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score = 84.3 bits (207),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ K YWIIKNSWGE+WGEKGYYKICRG NICGVDSMVSTVA++ +
Sbjct  320  LKDKAYWIIKNSWGETWGEKGYYKICRGHNICGVDSMVSTVASIQS  365


 Score = 77.4 bits (189),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKR LDHGVL+VGYGSAG+APIRLK+
Sbjct  283  MQTYIGGVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKD  322



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score = 88.6 bits (218),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWG+SWGE+GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  321  KEKPYWIIKNSWGQSWGEEGYYKICRGRNVCGVDSMVSTVAAMHT  365


 Score = 73.2 bits (178),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K  LDHGVLLVGYGS+G+APIR KE
Sbjct  283  MQTYIGGVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKE  322



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score = 85.1 bits (209),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  325  KEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  372


 Score = 76.6 bits (187),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  288  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKE  326



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score = 87.8 bits (216),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KPYWIIKNSWGE+WGE+GYYKICRGRN+CGVDSMVS+VAA+ T +
Sbjct  354  KEKPYWIIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSVAALQTKS  400


 Score = 73.6 bits (179),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC + LDHGVLLVGYGSAG+APIR KE
Sbjct  317  MQTYMKGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKE  355



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score = 87.4 bits (215),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            KPYWIIKNSWGE+WGE+GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  322  KPYWIIKNSWGENWGEQGYYKICRGRNVCGVDSMVSTVAAL  362


 Score = 74.3 bits (181),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  LDHGVLLVGYG+AG+APIR K+
Sbjct  282  MQTYIGGVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKD  321



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score = 84.0 bits (206),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA++   
Sbjct  110  KEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIHATA  156


 Score = 77.4 bits (189),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AG+APIR KE
Sbjct  73   MQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKE  111



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score = 87.4 bits (215),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  319  KEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365


 Score = 73.9 bits (180),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYG+  +APIR KE
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKE  320



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score = 87.4 bits (215),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  319  KEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365


 Score = 73.9 bits (180),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYG+  +APIR KE
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKE  320



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score = 84.3 bits (207),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAAV+T T
Sbjct  319  LKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367


 Score = 77.0 bits (188),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  DHGVLLVG+GS+G+APIRLKE
Sbjct  283  MQTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKE  321



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score = 82.8 bits (203),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVAA++T
Sbjct  317  LKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALHT  362


 Score = 78.6 bits (192),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC KR+DHGVLLVGYGS+G APIRLKE
Sbjct  281  MQTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRLKE  319



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score = 84.3 bits (207),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAAV+T T
Sbjct  319  LKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367


 Score = 77.0 bits (188),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  DHGVLLVG+GS+G+APIRLKE
Sbjct  283  MQTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKE  321



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score = 84.7 bits (208),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTVAA  + T+
Sbjct  319  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVAATVSTTA  366


 Score = 76.6 bits (187),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  282  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKE  320



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score = 85.1 bits (209),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  320  KEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367


 Score = 75.9 bits (185),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC +RL+HGVLLVGYGSAG+AP R KE
Sbjct  283  MQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKE  321



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score = 85.1 bits (209),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  320  KEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367


 Score = 75.9 bits (185),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC +RL+HGVLLVGYGSAG+AP R KE
Sbjct  283  MQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKE  321



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score = 84.0 bits (206),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  320  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  367


 Score = 77.0 bits (188),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  283  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKE  321



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score = 87.4 bits (215),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            ++ KP+WIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA+N
Sbjct  120  LKEKPFWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAIN  164


 Score = 73.6 bits (179),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC + LDHGVLLVG+GSAG+APIRLKE
Sbjct  84   MQTYMKGVSCPYICGRHLDHGVLLVGFGSAGYAPIRLKE  122



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score = 85.1 bits (209),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            ++ KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  106  MKDKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA  148


 Score = 75.9 bits (185),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYICSKRLDHGVLLVGYG +G+APIR+K+
Sbjct  70   MQTYMKGVSCPYICSKRLDHGVLLVGYGESGYAPIRMKD  108



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score = 86.3 bits (212),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  247
            +E KPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAAVNT
Sbjct  317  LEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVNT  363


 Score = 74.3 bits (181),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCPY+CSK  DHGVLLVG+GSAG+AP+RL+E
Sbjct  281  MQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEE  319



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score = 84.7 bits (208),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            KP+WIIKNSWGE+WGE GYYKICRGRNICG+D+MVS+VAA++T
Sbjct  321  KPFWIIKNSWGENWGENGYYKICRGRNICGMDAMVSSVAAIHT  363


 Score = 75.9 bits (185),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AG+APIR K+
Sbjct  282  MQTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRFKD  320



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 83.6 bits (205),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  320  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  367


 Score = 77.0 bits (188),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  283  MQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKE  321



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score = 84.3 bits (207),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            KPYWI+KNSWGE+WGE+GYYKICRG NICG+DSMVSTV A +T
Sbjct  324  KPYWIVKNSWGENWGEEGYYKICRGNNICGIDSMVSTVTAAST  366


 Score = 76.3 bits (186),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSKR LDHGVLLVGYG+AG+APIR K+
Sbjct  284  MQTYIGGVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFKD  323



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score = 87.4 bits (215),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++  T 
Sbjct  318  KEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHASTQ  365


 Score = 73.2 bits (178),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC K LDHGVLLVGYG   +APIR KE
Sbjct  281  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKE  319



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score = 83.2 bits (204),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  319  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366


 Score = 76.6 bits (187),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  282  MQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKE  320



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score = 87.0 bits (214),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++  T 
Sbjct  318  KEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHASTQ  365


 Score = 72.8 bits (177),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC K LDHGVLLVGYG   +APIR KE
Sbjct  281  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKE  319



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score = 82.8 bits (203),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            + KP+WIIKNSWGESWGE GYYKICRG+N+CGVDSMVS+V A    +S+
Sbjct  311  KDKPFWIIKNSWGESWGEDGYYKICRGKNVCGVDSMVSSVVATTFTSSN  359


 Score = 77.0 bits (188),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYG+AG+APIR K+
Sbjct  274  MQTYIGGVSCPYICGKNLDHGVLLVGYGAAGYAPIRFKD  312



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 82.4 bits (202),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  319  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSAT  361


 Score = 77.0 bits (188),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  282  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKE  320



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 82.8 bits (203),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  319  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSAT  361


 Score = 77.0 bits (188),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  282  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKE  320



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score = 82.4 bits (202),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A 
Sbjct  320  KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSAT  362


 Score = 77.0 bits (188),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  283  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKE  321



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score = 88.2 bits (217),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  345  KNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  387


 Score = 70.9 bits (172),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLK  116
            MQTY+GGVSCPYIC K LDHGVLLVGYG   +APIR K
Sbjct  308  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFK  345



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score = 83.6 bits (205),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGESWGE GYYKICRG+N CGVDSMVSTV A++ 
Sbjct  317  KEKPYWIIKNSWGESWGENGYYKICRGQNACGVDSMVSTVGAIHA  361


 Score = 75.5 bits (184),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC+KRLDHGV +VGYG +G+APIR KE
Sbjct  280  MQTYIGGVSCPYICAKRLDHGVQIVGYGESGYAPIRFKE  318



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score = 82.0 bits (201),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + +PYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  319  KERPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366


 Score = 76.6 bits (187),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAG+AP R KE
Sbjct  282  MQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKE  320



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score = 88.2 bits (217),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  320  KNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  362


 Score = 70.5 bits (171),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLK  116
            MQTYIGGVSCPYIC K LDHGVL+VGYG   +APIR K
Sbjct  283  MQTYIGGVSCPYICGKHLDHGVLIVGYGEGAYAPIRFK  320



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score = 85.9 bits (211),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWGE WGE GYYKI RGRN+CGVDSMVSTVAAV+T +
Sbjct  321  MKEKPYWIIKNSWGEKWGESGYYKIRRGRNVCGVDSMVSTVAAVSTSS  368


 Score = 72.8 bits (177),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G +PIR+KE
Sbjct  286  MQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKE  323



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score = 80.9 bits (198),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  316  LKEKPYWIIKNSWGSMWGEHGYYKICRGPHNVCGMDSMVSTVAAVHTTT  364


 Score = 77.8 bits (190),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+GSAG+APIRLKE
Sbjct  280  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKE  318



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 80.5 bits (197),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  316  LKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364


 Score = 78.2 bits (191),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+GSAG+APIRLKE
Sbjct  280  MQTYIGGVSCPYVCSKNQDHGVLLVGFGSAGYAPIRLKE  318



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score = 84.0 bits (206),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  38   KEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  85


 Score = 74.3 bits (181),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC++RL+HGVLLVGYG+AG+AP R KE
Sbjct  1    MQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKE  39



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score = 83.2 bits (204),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA+ T +
Sbjct  128  KEKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALQTKS  174


 Score = 75.1 bits (183),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG+AG+AP+R KE
Sbjct  91   MQTYIGGVSCPYICFRSLDHGVLLVGYGAAGYAPVRFKE  129



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score = 84.0 bits (206),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  247
            +E KPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  319  LEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  365


 Score = 74.3 bits (181),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCPY+CSK  DHGVLLVG+GSAG+AP+RL+E
Sbjct  283  MQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEE  321



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 80.5 bits (197),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  316  LKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364


 Score = 77.8 bits (190),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+GSAG+APIRLKE
Sbjct  280  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKE  318



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score = 84.0 bits (206),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  247
            +E KPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  317  LEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  363


 Score = 74.3 bits (181),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCPY+CSK  DHGVLLVG+GSAG+AP+RL+E
Sbjct  281  MQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEE  319



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score = 79.3 bits (194),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            ++ KPYWIIKNSWGE+WGE GYYKICRG N+CGV SMVSTV A +
Sbjct  323  LKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVASMVSTVTAAH  367


 Score = 78.6 bits (192),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYG+AG+APIRLKE
Sbjct  287  MQTYIGGVSCPYICGKHLDHGVLLVGYGAAGYAPIRLKE  325



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score = 87.0 bits (214),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  109  KNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  151


 Score = 70.9 bits (172),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC K LDHGVLLVGYG   +APIR K 
Sbjct  72   MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKN  110



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score = 83.2 bits (204),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTV A++T
Sbjct  317  KEKPYWIIKNSWGENWGENGYYKICRGPNMCGVDSMVSTVIAIHT  361


 Score = 74.7 bits (182),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+IC K LDHGVLLVGYG+ G+APIR KE
Sbjct  280  MQTYIGGVSCPFICGKHLDHGVLLVGYGAGGYAPIRFKE  318



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score = 81.6 bits (200),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            KPYWIIKNSWGE+WGE GYYKICRG NICGV+SMVSTV A+
Sbjct  326  KPYWIIKNSWGENWGEDGYYKICRGHNICGVESMVSTVTAI  366


 Score = 76.3 bits (186),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAG+APIR K+
Sbjct  287  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKD  325



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score = 84.0 bits (206),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE+GYYKICRG NICGVDSMVS+V A +T
Sbjct  324  KDKPYWIIKNSWGENWGEEGYYKICRGNNICGVDSMVSSVTAAST  368


 Score = 73.9 bits (180),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK+ LDHGVL+VGYG+AG+APIR K+
Sbjct  286  MQTYIGGVSCPYICSKKNLDHGVLIVGYGAAGYAPIRFKD  325



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score = 80.1 bits (196),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVAA+
Sbjct  319  KEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAAL  361


 Score = 77.4 bits (189),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC KR+DHGVLLVGYGS+G APIR KE
Sbjct  282  MQTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKE  320



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score = 79.0 bits (193),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAG+APIR KE 
Sbjct  278  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEK  317


 Score = 78.6 bits (192),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  315  KEKPYWIIKNSWGENWGENGYYKICRGPHVQNKCGVDSMVSTVTAIHT  362



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 87.0 bits (214),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  319  LKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  364


 Score = 70.5 bits (171),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC+K RLDHGVLL+G+G  G+APIRLKE
Sbjct  282  MQTYMSGVSCPYICAKARLDHGVLLLGFGQGGYAPIRLKE  321



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 80.1 bits (196),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYK CR  RN+CGVDSMVS+VAAV+T
Sbjct  330  LKDKPYWIIKNSWGENWGENGYYKFCRADRNLCGVDSMVSSVAAVHT  376


 Score = 77.0 bits (188),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AG+APIRLK+
Sbjct  294  MQTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRLKD  332



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score = 81.3 bits (199),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  KPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            KPYWIIKNSWG +WGE GYYKICRG+NICGV+SMVSTV AV T
Sbjct  328  KPYWIIKNSWGGNWGEDGYYKICRGQNICGVESMVSTVTAVRT  370


 Score = 76.3 bits (186),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAG+APIR K+
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKD  327



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score = 84.3 bits (207),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KPYWIIKNSWGE+WG  GYYKICRGRN+CGVDSMVSTV A++  T
Sbjct  318  KEKPYWIIKNSWGENWGGNGYYKICRGRNVCGVDSMVSTVGAIHAST  364


 Score = 72.8 bits (177),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC K LDHGVLLVGYG   +APIR KE
Sbjct  281  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKE  319



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score = 84.3 bits (207),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            + KPYWIIKNSWG +WG++GYYKICRG N+CGVDSMVSTVAAVN
Sbjct  327  KEKPYWIIKNSWGPNWGDQGYYKICRGHNVCGVDSMVSTVAAVN  370


 Score = 72.4 bits (176),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP +C + LDHGV+LVGYGSAG+APIR KE
Sbjct  290  MQTYIGGVSCPLVCLRSLDHGVVLVGYGSAGYAPIRFKE  328



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score = 80.5 bits (197),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG  WGE GYYKICRG  NICG+D+MVSTVAAV T T
Sbjct  318  LKEKPYWIIKNSWGSMWGEHGYYKICRGSHNICGMDTMVSTVAAVQTST  366


 Score = 75.5 bits (184),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+G++PIRLKE
Sbjct  282  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYSPIRLKE  320



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score = 79.3 bits (194),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  253
            ++ KPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T T
Sbjct  316  LKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHTTT  364


 Score = 76.6 bits (187),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+G+APIRLKE
Sbjct  280  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKE  318



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score = 87.0 bits (214),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  316  LKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361


 Score = 68.9 bits (167),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPY+C+K RLDHGVLLVG+G   +APIRLKE
Sbjct  279  MQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKE  318



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score = 83.6 bits (205),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA++T +
Sbjct  323  KDKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALHTKS  369


 Score = 72.4 bits (176),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC + LDHGVLLVGYG+AG++PIR K+
Sbjct  286  MQTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKD  324



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score = 80.9 bits (198),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV T
Sbjct  320  LKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVRT  368


 Score = 75.1 bits (183),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG+AG APIRLK+
Sbjct  284  MQTYIGGVSCPYICGRTLDHGVLLVGYGAAGFAPIRLKD  322



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score = 80.9 bits (198),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVA+++T
Sbjct  319  KEKPYWILKNSWGQSWGEEGYYKICRGHNPCGVDSLVSTVASLHT  363


 Score = 74.7 bits (182),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC KR+DHGVLLVGYGS+G APIR KE
Sbjct  282  MQTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKE  320



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score = 85.1 bits (209),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KPYW++KNSWG++WGE GYYKICRG NICGVDSMVSTVAA+ + T
Sbjct  319  KEKPYWLLKNSWGQNWGEHGYYKICRGHNICGVDSMVSTVAAIQSAT  365


 Score = 70.9 bits (172),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQ+Y GGVSCP+ICS  L+HGVLLVGYGSAG++PIR KE
Sbjct  282  MQSYAGGVSCPFICSTSLNHGVLLVGYGSAGYSPIRFKE  320



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score = 86.7 bits (213),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWI+KNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  316  LKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361


 Score = 68.9 bits (167),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPY+C+K RLDHGVLLVG+G   +APIRLKE
Sbjct  279  MQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKE  318



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score = 86.7 bits (213),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWI+KNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  316  LKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361


 Score = 68.9 bits (167),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPY+C+K RLDHGVLLVG+G   +APIRLKE
Sbjct  279  MQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKE  318



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score = 85.5 bits (210),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  164  LKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  209


 Score = 70.1 bits (170),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCP+IC+K RLDHGVLLVG+GS G+APIRLKE
Sbjct  127  MQTYMSGVSCPHICAKARLDHGVLLVGFGSGGYAPIRLKE  166



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score = 84.0 bits (206),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  313  LKEKPYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTATHT  358


 Score = 71.2 bits (173),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCP IC KR DHGVLLVGYGSAG APIRLKE
Sbjct  277  MQTYMRGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKE  315



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 79.0 bits (193),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 3/53 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  259
            ++ KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A++    +
Sbjct  322  LKEKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAIHASKEE  374


 Score = 76.6 bits (187),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG+AG APIRLKE
Sbjct  286  MQTYIGGVSCPYICGRHLDHGVLLVGYGAAGFAPIRLKE  324



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score = 88.6 bits (218),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWG++WGE+GYYKICRGRNICGVDSMVSTVAAV+   +
Sbjct  310  LKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVHASNN  358


 Score = 67.0 bits (162),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC+K RLDHGVLLVG+G+ G APIRLKE
Sbjct  274  MQTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKE  312



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score = 79.3 bits (194),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 3/52 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  259
            + KPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T   +
Sbjct  329  KEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHTSKKE  380


 Score = 76.3 bits (186),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAG+APIR KE 
Sbjct  292  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEK  331



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score = 80.5 bits (197),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWI+KNSWG+SWGE+G+YKICRG N CGVDS+VSTVA+++T
Sbjct  320  KEKPYWILKNSWGQSWGEEGFYKICRGHNSCGVDSLVSTVASLHT  364


 Score = 75.1 bits (183),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC KR+DHGVLLVGYGS+G APIR KE
Sbjct  283  MQTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKE  321



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score = 88.6 bits (218),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWG++WGE+GYYKICRGRNICGVDSMVSTVAAV+   +
Sbjct  314  LKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVHASNN  362


 Score = 67.0 bits (162),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC+K RLDHGVLLVG+G+ G APIRLKE
Sbjct  278  MQTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKE  316



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score = 79.0 bits (193),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  328  KEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  375


 Score = 76.6 bits (187),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAG+AP+R KE
Sbjct  291  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKE  329



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score = 80.1 bits (196),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KPYWIIKNSWGE+WGE GYY IC+G+N+CG +SMVS+VAA  TP 
Sbjct  327  KEKPYWIIKNSWGENWGENGYYFICKGKNVCGSESMVSSVAAAATPN  373


 Score = 75.1 bits (183),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYICSKR LDHGVLLVGYGSAG APIR KE
Sbjct  289  MQTYMKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKE  328



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score = 79.3 bits (194),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 3/52 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  259
            + KPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T   +
Sbjct  348  KEKPYWIIKNSWGENWGESGYYKICRGAHVKNKCGVDSMVSTVTAIHTSNKE  399


 Score = 75.5 bits (184),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAG+AP+R KE
Sbjct  311  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPLRFKE  349



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score = 81.6 bits (200),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  244
            + KPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVS+V+A++
Sbjct  323  KNKPYWIIKNSWGENWGENGYYKICRGNNVCGVDSMVSSVSALH  366


 Score = 73.2 bits (178),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLK  116
            MQTYI GVSCPYIC K LDHGVLLVGYGSAG+AP+R K
Sbjct  286  MQTYIHGVSCPYICGKHLDHGVLLVGYGSAGYAPVRFK  323



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score = 78.6 bits (192),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNI---CGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG N+   CGVDSMVSTV A++T
Sbjct  140  LKDKPYWIIKNSWGENWGEHGYYKICRGSNVRDKCGVDSMVSTVTAIHT  188


 Score = 76.3 bits (186),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC K LDHGVLLVGYGS+G APIRLK+
Sbjct  104  MQTYIGGVSCPYICGKHLDHGVLLVGYGSSGFAPIRLKD  142



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score = 79.0 bits (193),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T
Sbjct  312  KEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  359


 Score = 75.9 bits (185),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAG+APIR KE 
Sbjct  275  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEK  314



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score = 82.4 bits (202),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KP+WIIKNSWG +WGE GYY+ICRGRN+CGVDSMVS+VAA++T +
Sbjct  323  KDKPFWIIKNSWGANWGEDGYYRICRGRNVCGVDSMVSSVAALHTKS  369


 Score = 72.4 bits (176),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC + LDHGVLLVGYG+AG++PIR K+
Sbjct  286  MQTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKD  324



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score = 79.3 bits (194),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVN  244
            ++ KPYWIIKNSWG+ WGE GYYKICRGR NICG+D+MVSTVAAV 
Sbjct  323  LKEKPYWIIKNSWGKMWGEHGYYKICRGRHNICGMDTMVSTVAAVQ  368


 Score = 75.5 bits (184),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+G +G+APIRLKE
Sbjct  287  MQTYIGGVSCPYVCSKSQDHGVLLVGFGESGYAPIRLKE  325



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score = 79.0 bits (193),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T
Sbjct  296  KEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  343


 Score = 75.9 bits (185),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAG+APIR KE 
Sbjct  259  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEK  298



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score = 78.6 bits (192),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T
Sbjct  332  KEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  379


 Score = 75.9 bits (185),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAG+APIR KE
Sbjct  295  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKE  333



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 81.6 bits (200),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ K YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  313  LKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358


 Score = 72.8 bits (177),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP IC KR DHGVLLVGYGS G APIRLKE
Sbjct  277  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKE  315



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 81.6 bits (200),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ K YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  313  LKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358


 Score = 72.8 bits (177),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP IC KR DHGVLLVGYGS G APIRLKE
Sbjct  277  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKE  315



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score = 81.6 bits (200),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ K YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  315  LKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360


 Score = 72.8 bits (177),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP IC KR DHGVLLVGYGS G APIRLKE
Sbjct  279  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKE  317



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score = 78.2 bits (191),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  354  KEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  401


 Score = 75.9 bits (185),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAG+AP+R KE 
Sbjct  317  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEK  356



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 81.6 bits (200),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ K YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  313  LKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358


 Score = 72.8 bits (177),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP IC KR DHGVLLVGYGS G APIRLKE
Sbjct  277  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKE  315



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score = 81.3 bits (199),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ K YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  315  LKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360


 Score = 72.8 bits (177),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP IC KR DHGVLLVGYGS G APIRLKE
Sbjct  279  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKE  317



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score = 90.5 bits (223),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA +T T
Sbjct  284  KEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTTT  330


 Score = 63.2 bits (152),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KE
Sbjct  247  MQTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKE  285



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score = 87.0 bits (214),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  311  LKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  356


 Score = 67.0 bits (162),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQ Y+ GVSCPY+C+K RLDHGVLLVG+G   +APIRLKE
Sbjct  274  MQAYMSGVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKE  313



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score = 77.4 bits (189),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAG+APIR KE 
Sbjct  300  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEK  339


 Score = 76.3 bits (186),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  244
            + KPYWIIKNSWGE+WGE GYYK+CRG   +N CGVDSMVSTV A++
Sbjct  337  KEKPYWIIKNSWGENWGENGYYKLCRGPFVKNKCGVDSMVSTVTAIH  383



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score = 82.4 bits (202),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + K YWIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V A+
Sbjct  322  KEKSYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSSVTAI  364


 Score = 71.2 bits (173),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCPYIC K L+HGVLLVGYGSAG+AP R KE
Sbjct  285  MQTYVHGVSCPYICGKHLNHGVLLVGYGSAGYAPARFKE  323



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score = 90.1 bits (222),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
            + KPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA +T T
Sbjct  283  KEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTNT  329


 Score = 63.5 bits (153),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KE
Sbjct  246  MQTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKE  284



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score = 77.4 bits (189),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  324  LKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370


 Score = 76.3 bits (186),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+G+APIRLKE
Sbjct  288  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKE  326



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score = 77.4 bits (189),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  324  LKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370


 Score = 76.3 bits (186),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+G+APIRLKE
Sbjct  288  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKE  326



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score = 79.3 bits (194),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  320  LKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  368


 Score = 74.3 bits (181),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G APIRLK+
Sbjct  284  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKD  322



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score = 79.3 bits (194),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  320  LKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  368


 Score = 73.9 bits (180),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G APIRLK+
Sbjct  284  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKD  322



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score = 82.4 bits (202),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            ++ KPYW+IKNSWGE+WGEKGYYKICRG   RN CGVDSMVSTVAA +T
Sbjct  325  LKNKPYWVIKNSWGENWGEKGYYKICRGSNVRNKCGVDSMVSTVAAAHT  373


 Score = 70.9 bits (172),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLK  116
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G AP RLK
Sbjct  289  MQTYIGGVSCPYICGRSLDHGVLLVGYGASGFAPSRLK  326



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score = 82.4 bits (202),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGESWGE GY +ICRGRN+CGVDSMVSTVAA+
Sbjct  272  KNKPYWIIKNSWGESWGENGYDEICRGRNVCGVDSMVSTVAAI  314


 Score = 70.5 bits (171),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC K LDHGVLLVGYG   +APIR K 
Sbjct  235  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKN  273



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score = 82.8 bits (203),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWI+KNSWGESWGE+GYYKIC+G N+CGV+SMVS+V A++T ++
Sbjct  325  LKNKPYWIVKNSWGESWGEEGYYKICKGHNVCGVESMVSSVNAIHTTSA  373


 Score = 69.7 bits (169),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLK  116
            MQTYIGGVSCPY+C KR LDHGVLLVGYG+AG++ IRLK
Sbjct  288  MQTYIGGVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLK  326



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score = 78.2 bits (191),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYWIIKNSWGE+WGE GYY IC+G+NICG +SMVS+VAA+
Sbjct  326  LKEKPYWIIKNSWGENWGENGYYFICKGKNICGSESMVSSVAAI  369


 Score = 74.3 bits (181),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ G+SCPYICSKR LDHGVLLVGYG+AG APIRLKE
Sbjct  289  MQTYMKGISCPYICSKRNLDHGVLLVGYGAAGFAPIRLKE  328



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score = 83.2 bits (204),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            ++ KPYWIIKNSWGESWGE GYYKICRGRN+CGV+SMVS+V A +  T+
Sbjct  197  LKNKPYWIIKNSWGESWGESGYYKICRGRNVCGVESMVSSVTAAHFTTT  245


 Score = 69.3 bits (168),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLK  116
            MQTYIGGVSCPYIC K LDHGVL+VGYG+ G+AP+RLK
Sbjct  162  MQTYIGGVSCPYICGKSLDHGVLIVGYGT-GYAPVRLK  198



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score = 82.4 bits (202),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  259
            ++ KP+WIIKNSWG  WGE GYYK+CRG N+CG+++MVSTVAA N  T D
Sbjct  344  LKNKPFWIIKNSWGPDWGEDGYYKLCRGHNVCGINTMVSTVAAANIQTDD  393


 Score = 69.3 bits (168),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLK  116
            MQTY+GGVSCPY+C+K+ LDHGVLLVGYG+AG+AP RLK
Sbjct  307  MQTYVGGVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLK  345



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score = 77.4 bits (189),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            ++ K YWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A++T
Sbjct  322  LKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTVSAIHT  370


 Score = 74.3 bits (181),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G APIRLK+
Sbjct  286  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKD  324



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score = 82.8 bits (203),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  313  LKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  358


 Score = 68.2 bits (165),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCP IC KR DHGVLLVGYGS G APIRLK 
Sbjct  277  MQTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKN  315



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score = 88.6 bits (218),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
             + KPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  279  TKEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  326


 Score = 62.0 bits (149),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGH  98
            MQTY+GGVSCPY C++RLDHGVLLVGYGS  +
Sbjct  247  MQTYVGGVSCPYTCTRRLDHGVLLVGYGSGAY  278



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score = 82.8 bits (203),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  326  LKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  371


 Score = 67.8 bits (164),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCP IC KR DHGVLLVGYGS G APIRLK 
Sbjct  290  MQTYVRGVSCPLICLKRQDHGVLLVGYGSEGFAPIRLKN  328



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 79.0 bits (193),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A ++
Sbjct  326  KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHS  373


 Score = 71.6 bits (174),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G AP R KE
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKE  327



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score = 88.6 bits (218),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  253
             + KPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  278  TKEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  325


 Score = 62.0 bits (149),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGH  98
            MQTY+GGVSCPY C++RLDHGVLLVGYGS  +
Sbjct  246  MQTYVGGVSCPYTCTRRLDHGVLLVGYGSGAY  277



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score = 79.3 bits (194),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE WGE GYYKICRG+ NICGVD+MVSTV A +T
Sbjct  316  LKAKPYWIIKNSWGEHWGEHGYYKICRGQHNICGVDAMVSTVTAAHT  362


 Score = 70.9 bits (172),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLK  116
            MQTYIGGVSCP +C K  DHGVLLVGYGSAG APIRLK
Sbjct  280  MQTYIGGVSCPLVCFKHQDHGVLLVGYGSAGFAPIRLK  317



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score = 77.4 bits (189),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  94   LKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  142


 Score = 72.8 bits (177),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G AP+RLK+
Sbjct  58   MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPMRLKD  96



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score = 78.2 bits (191),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 3/52 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  259
            + KPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A +    +
Sbjct  318  KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHASKEE  369


 Score = 71.6 bits (174),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKEN  122
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G AP R KE 
Sbjct  281  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEK  320



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score = 77.0 bits (188),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTV  232
            ++ K YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV
Sbjct  315  LKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355


 Score = 72.4 bits (176),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCP IC KR DHGVLLVGYGS G APIRLKE
Sbjct  279  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKE  317



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score = 75.9 bits (185),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE WGE GYYK+C G N CG+D+MVS V + NT
Sbjct  319  KEKPYWIIKNSWGEDWGEDGYYKLCSGYNACGMDTMVSAVVSTNT  363


 Score = 73.6 bits (179),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIG VSCPYICSK ++DHGVLLVGYGSAG+AP+R KE
Sbjct  281  MQTYIGQVSCPYICSKTKMDHGVLLVGYGSAGYAPLRFKE  320



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score = 78.2 bits (191),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 3/52 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  259
            + KPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A +    +
Sbjct  326  KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHASKEE  377


 Score = 71.6 bits (174),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G AP R KE
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKE  327



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score = 77.0 bits (188),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  323  MKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366


 Score = 72.4 bits (176),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSKR LDHGVLLVGYG+A  APIR+K+
Sbjct  286  MQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKD  325



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score = 77.0 bits (188),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  323  MKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366


 Score = 72.4 bits (176),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSKR LDHGVLLVGYG+A  APIR+K+
Sbjct  286  MQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKD  325



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score = 77.4 bits (189),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  241
            ++ KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  323  MKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366


 Score = 72.4 bits (176),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPY+CSKR LDHGVLLVGYG+A  APIR+K+
Sbjct  286  MQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKD  325



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score = 78.2 bits (191),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 3/52 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  259
            + KPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A +    +
Sbjct  251  KEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHASKDE  302


 Score = 71.6 bits (174),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G AP R KE
Sbjct  214  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKE  252



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score = 75.1 bits (183),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            + KPYWIIKNSWG++WGE GYY IC+GRNICG +SMVS+VAA
Sbjct  46   KEKPYWIIKNSWGQNWGENGYYLICKGRNICGSESMVSSVAA  87


 Score = 74.3 bits (181),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCPYICSKR LDHGVLLVGYGSAG APIR KE
Sbjct  8    MQTYIKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKE  47



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score = 76.3 bits (186),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  39   LKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  87


 Score = 72.8 bits (177),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G APIRLK+
Sbjct  3    MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKD  41



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score = 80.5 bits (197),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG++WGE GYYKICRG +ICGVD+MVSTV A +T
Sbjct  311  LKNKPYWIIKNSWGKTWGEHGYYKICRGHHICGVDAMVSTVTATHT  356


 Score = 68.2 bits (165),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCP IC KR DHGVLLVGYGS G APIRLK 
Sbjct  275  MQTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKN  313



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score = 76.3 bits (186),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSM  220
            ++ KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSM
Sbjct  322  MKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSM  358


 Score = 72.4 bits (176),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G +PIR+KE
Sbjct  287  MQTYVGGVSCPYICSKKLDHGVLLVGYGT-GFSPIRMKE  324



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 79.0 bits (193),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 3/48 (6%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  247
            + KPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  330  KEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  377


 Score = 68.9 bits (167),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCPYIC + LDH V LVGYGSAG+AP+R KE
Sbjct  294  MQTYIGGVSCPYICGRHLDH-VFLVGYGSAGYAPLRFKE  331



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 75.5 bits (184),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  256
            + KPYWI+KNSW + WGE GYY+ICRG+N+CGVDSMVS+V A    TS
Sbjct  320  KEKPYWILKNSWSKYWGEHGYYRICRGQNMCGVDSMVSSVVAAIQTTS  367


 Score = 72.0 bits (175),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY  GVSCP++CS  LDHGVLLVGYGSAG++PIR KE
Sbjct  283  MQTYTAGVSCPFLCSGELDHGVLLVGYGSAGYSPIRFKE  321



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score = 82.4 bits (202),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWI+KNSWG++WGEKGYYKICRG NICGV+SMVSTV A+++
Sbjct  310  LKNKPYWIVKNSWGKNWGEKGYYKICRGSNICGVESMVSTVTAIHS  355


 Score = 65.1 bits (157),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYI GVSCP +C K  LDHGVL+VGYGS+G+APIRLK 
Sbjct  273  MQTYIRGVSCPLVCGKSNLDHGVLMVGYGSSGYAPIRLKN  312



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score = 77.4 bits (189),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 1/44 (2%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEK-GYYKICRGRNICGVDSMVSTVAAV  241
            + KPYWIIKNSWGESWGE  GY +ICRGRN+CGVD+MVSTVAA+
Sbjct  270  KNKPYWIIKNSWGESWGENDGYDEICRGRNVCGVDAMVSTVAAI  313


 Score = 69.7 bits (169),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYIC K LDHGVLLVGYG   +APIR K 
Sbjct  233  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGRYAPIRFKN  271



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score = 78.6 bits (192),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            ++ KPYWI+KNSWGE+WGE+GYYKIC+G N+CGV+S+VSTV A
Sbjct  293  LKEKPYWIVKNSWGENWGEQGYYKICKGHNVCGVESLVSTVTA  335


 Score = 67.0 bits (162),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+ GVSCP IC K RLDHG+L+VGYG++G+APIRLKE
Sbjct  256  MQTYVHGVSCPLICMKTRLDHGILIVGYGASGYAPIRLKE  295



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.7 bits (195),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+RLKE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRLKE  114


 Score = 64.7 bits (156),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  LKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.2 bits (191),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRVKE  114


 Score = 65.9 bits (159),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            V+ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  VKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 64.7 bits (156),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score = 72.4 bits (176),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIG VSCPY+CSK+ LDHGVLLVGYGSAG+AP RLKE
Sbjct  106  MQTYIGKVSCPYVCSKKPLDHGVLLVGYGSAGYAPSRLKE  145


 Score = 71.2 bits (173),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            ++ KPYWIIKNSWG  WGE GYYKIC G N+CG+D+MVS V + + 
Sbjct  143  LKEKPYWIIKNSWGPDWGEDGYYKICSGHNLCGMDTMVSAVVSTSA  188



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 64.7 bits (156),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 64.7 bits (156),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 64.7 bits (156),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 64.7 bits (156),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.6 bits (192),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 64.7 bits (156),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 64.3 bits (155),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDRWGEEGFYKICRGRNICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 79.0 bits (193),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 63.9 bits (154),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG  WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGNKWGEEGFYKICRGRNICG  144



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 77.8 bits (190),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+++KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVKMKE  114


 Score = 64.7 bits (156),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 77.8 bits (190),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYG++G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGTSGYSPVRMKE  114


 Score = 64.7 bits (156),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04295.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 76.6 bits (187),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+ +KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVSMKE  114


 Score = 64.7 bits (156),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KPYWIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPYWIIKNSWGDKWGEEGFYKICRGRNICG  144



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score = 78.6 bits (192),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+G++P+R+KE
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKE  114


 Score = 62.8 bits (151),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICG  208
            ++ KP+WIIKNSWG+ WGE+G+YKICRGRNICG
Sbjct  112  MKEKPHWIIKNSWGDKWGEEGFYKICRGRNICG  144



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score = 73.6 bits (179),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  116  RKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  235
             KPYWIIKNSWG +WGE+GYYKICRG  +CG+++MVSTVA
Sbjct  328  EKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  367


 Score = 67.4 bits (163),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP ICSK  +DHGVLLVGYG+ G+APIR  E
Sbjct  289  MQTYIGGVSCPIICSKHHIDHGVLLVGYGAKGYAPIRFTE  328



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 73.6 bits (179),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  116  RKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  235
             KPYWIIKNSWG +WGE+GYYKICRG  +CG+++MVSTVA
Sbjct  291  EKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  330


 Score = 67.0 bits (162),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP ICSK  +DHGVLLVGYG+ G+APIR  E
Sbjct  252  MQTYIGGVSCPIICSKHHIDHGVLLVGYGAKGYAPIRFTE  291



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score = 69.7 bits (169),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVS-CPYICSKRLDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVS CPYIC +RL+HGVLLVGYGSAG+AP R KE
Sbjct  11   MQTYIGGVSACPYICMRRLNHGVLLVGYGSAGYAPARFKE  50


 Score = 69.3 bits (168),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  113  ERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMV  223
            + KPYWIIKNSWGE+WGE G+YKICRGRN+CGVD  V
Sbjct  49   KEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDMSV  85



>ref|XP_010504326.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=363

 Score = 73.9 bits (180),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            +  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA 
Sbjct  317  LSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVAT  359


 Score = 61.2 bits (147),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRL  113
            MQTYIGGVSCP ICSKR ++HGVLLVGYGS G + +RL
Sbjct  280  MQTYIGGVSCPLICSKRKINHGVLLVGYGSKGFSILRL  317



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score = 73.9 bits (180),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            +  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA 
Sbjct  321  LSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVAT  363


 Score = 61.2 bits (147),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRL  113
            MQTYIGGVSCP ICSKR ++HGVLLVGYGS G + +RL
Sbjct  284  MQTYIGGVSCPLICSKRKINHGVLLVGYGSKGFSILRL  321



>gb|KEH43476.1| papain family cysteine protease [Medicago truncatula]
Length=381

 Score = 73.2 bits (178),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  247
            + +KPYWIIKNSWGE WGEKGYYK+CRG  +CG+++MVS      T
Sbjct  325  LRKKPYWIIKNSWGERWGEKGYYKLCRGHGMCGMNTMVSAAMVAQT  370


 Score = 61.6 bits (148),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRLKE  119
            MQTYIGGVSCP ICSKR L+HGVLLVGY S G + +RL++
Sbjct  288  MQTYIGGVSCPLICSKRMLNHGVLLVGYNSQGFSILRLRK  327



>emb|CAB41090.1| cysteine proteinase precursor-like protein [Arabidopsis thaliana]
Length=363

 Score = 73.9 bits (180),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            +  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA 
Sbjct  317  LSNKPYWIIKNSWGKKWGENGYYKLCRGHDICGINSMVSAVAT  359


 Score = 60.8 bits (146),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRL  113
            MQTYIGGVSCP ICSKR ++HGVLLVGYGS G + +RL
Sbjct  280  MQTYIGGVSCPLICSKRNVNHGVLLVGYGSKGFSILRL  317



>ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 73.6 bits (179),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            +  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA 
Sbjct  322  LSNKPYWIIKNSWGKKWGENGYYKLCRGHDICGINSMVSAVAT  364


 Score = 60.8 bits (146),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRL  113
            MQTYIGGVSCP ICSKR ++HGVLLVGYGS G + +RL
Sbjct  285  MQTYIGGVSCPLICSKRKVNHGVLLVGYGSKGFSILRL  322



>ref|NP_567010.5| Papain family cysteine protease [Arabidopsis thaliana]
 gb|AAL49820.1| putative cysteine proteinase [Arabidopsis thaliana]
 gb|AEE79316.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=367

 Score = 73.6 bits (179),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  110  VERKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  238
            +  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA 
Sbjct  321  LSNKPYWIIKNSWGKKWGENGYYKLCRGHDICGINSMVSAVAT  363


 Score = 60.8 bits (146),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGHAPIRL  113
            MQTYIGGVSCP ICSKR ++HGVLLVGYGS G + +RL
Sbjct  284  MQTYIGGVSCPLICSKRNVNHGVLLVGYGSKGFSILRL  321



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800