BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017C07 645 bp,

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG20572.1|  Pheophorbidase                                          291   2e-95   Gossypium arboreum [tree cotton]
ref|XP_009784670.1|  PREDICTED: methylesterase 17-like                  291   2e-95   Nicotiana sylvestris
ref|XP_007011384.1|  Methyl esterase 17                                 288   3e-94   Theobroma cacao [chocolate]
ref|XP_006367441.1|  PREDICTED: methylesterase 17-like                  288   4e-94   Solanum tuberosum [potatoes]
ref|XP_011084804.1|  PREDICTED: methylesterase 17 isoform X2            288   6e-94   Sesamum indicum [beniseed]
gb|ACU18515.1|  unknown                                                 285   6e-94   Glycine max [soybeans]
ref|XP_009626844.1|  PREDICTED: methylesterase 17                       286   1e-93   Nicotiana tomentosiformis
ref|XP_007218793.1|  hypothetical protein PRUPE_ppa009785mg             286   2e-93   Prunus persica
ref|XP_008234160.1|  PREDICTED: methylesterase 17                       286   3e-93   Prunus mume [ume]
ref|XP_009363781.1|  PREDICTED: methylesterase 17-like                  285   4e-93   Pyrus x bretschneideri [bai li]
ref|XP_007141327.1|  hypothetical protein PHAVU_008G186600g             285   6e-93   Phaseolus vulgaris [French bean]
ref|XP_003526792.1|  PREDICTED: methylesterase 17                       285   8e-93   Glycine max [soybeans]
gb|KEH35519.1|  methylesterase                                          285   1e-92   Medicago truncatula
gb|AFK40220.1|  unknown                                                 284   2e-92   Medicago truncatula
ref|XP_009777586.1|  PREDICTED: methylesterase 17-like                  284   2e-92   Nicotiana sylvestris
ref|XP_008376326.1|  PREDICTED: methylesterase 17-like                  283   3e-92   Malus domestica [apple tree]
ref|XP_004240843.1|  PREDICTED: methylesterase 17                       282   6e-92   Solanum lycopersicum
ref|XP_004502811.1|  PREDICTED: methylesterase 17-like                  283   7e-92   Cicer arietinum [garbanzo]
ref|XP_009362773.1|  PREDICTED: methylesterase 17                       282   1e-91   Pyrus x bretschneideri [bai li]
ref|XP_008388372.1|  PREDICTED: methylesterase 17-like                  281   1e-91   Malus domestica [apple tree]
gb|KJB60171.1|  hypothetical protein B456_009G292500                    282   2e-91   Gossypium raimondii
ref|XP_010999645.1|  PREDICTED: methylesterase 17                       280   3e-91   Populus euphratica
ref|XP_002325617.2|  hydrolase family protein                           280   5e-91   Populus trichocarpa [western balsam poplar]
gb|KDP21626.1|  hypothetical protein JCGZ_03297                         278   1e-90   Jatropha curcas
ref|XP_006435956.1|  hypothetical protein CICLE_v10032372mg             278   2e-90   Citrus clementina
ref|XP_004307746.1|  PREDICTED: methylesterase 17                       278   2e-90   Fragaria vesca subsp. vesca
gb|ACU16989.1|  unknown                                                 275   3e-90   Glycine max [soybeans]
ref|XP_006357300.1|  PREDICTED: methylesterase 17-like                  277   7e-90   Solanum tuberosum [potatoes]
gb|AFK48205.1|  unknown                                                 276   1e-89   Medicago truncatula
ref|XP_003523289.1|  PREDICTED: methylesterase 17 isoformX1             276   1e-89   Glycine max [soybeans]
ref|XP_011084803.1|  PREDICTED: methylesterase 17 isoform X1            277   2e-89   Sesamum indicum [beniseed]
ref|NP_001237523.1|  uncharacterized protein LOC100527539               275   4e-89   Glycine max [soybeans]
gb|AFK43530.1|  unknown                                                 274   2e-88   Lotus japonicus
gb|EPS70008.1|  hypothetical protein M569_04755                         273   3e-88   Genlisea aurea
ref|XP_010244542.1|  PREDICTED: methylesterase 17-like                  273   4e-88   Nelumbo nucifera [Indian lotus]
gb|EYU35190.1|  hypothetical protein MIMGU_mgv1a010972mg                273   4e-88   Erythranthe guttata [common monkey flower]
ref|XP_004141511.1|  PREDICTED: methylesterase 17-like                  273   4e-88   Cucumis sativus [cucumbers]
ref|XP_004167241.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    273   4e-88   
ref|XP_008459483.1|  PREDICTED: methylesterase 17                       271   7e-88   Cucumis melo [Oriental melon]
ref|XP_007136407.1|  hypothetical protein PHAVU_009G042400g             272   8e-88   Phaseolus vulgaris [French bean]
ref|XP_006578847.1|  PREDICTED: methylesterase 17 isoform X3            271   9e-88   Glycine max [soybeans]
ref|XP_002281126.1|  PREDICTED: methylesterase 17                       262   2e-84   Vitis vinifera
ref|XP_010067632.1|  PREDICTED: methylesterase 17                       261   7e-84   Eucalyptus grandis [rose gum]
ref|XP_011041773.1|  PREDICTED: methylesterase 17-like                  261   1e-83   Populus euphratica
ref|XP_002326065.1|  Chain A family protein                             258   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_004235449.1|  PREDICTED: methylesterase 17-like                  258   2e-82   Solanum lycopersicum
ref|XP_009146797.1|  PREDICTED: methylesterase 17                       258   3e-82   Brassica rapa
ref|XP_006574372.1|  PREDICTED: uncharacterized protein LOC100527...    257   6e-82   Glycine max [soybeans]
emb|CDY65415.1|  BnaCnng46980D                                          256   7e-82   Brassica napus [oilseed rape]
gb|KHN19243.1|  Pheophorbidase                                          256   1e-81   Glycine soja [wild soybean]
emb|CDY08569.1|  BnaA05g28050D                                          255   3e-81   Brassica napus [oilseed rape]
ref|XP_010252029.1|  PREDICTED: methylesterase 17-like isoform X1       255   4e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010670053.1|  PREDICTED: methylesterase 17                       254   4e-81   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003523290.1|  PREDICTED: methylesterase 17 isoformX2             251   8e-81   
ref|XP_004294719.1|  PREDICTED: methylesterase 17-like                  251   1e-79   Fragaria vesca subsp. vesca
ref|XP_010102428.1|  hypothetical protein L484_002055                   249   1e-78   Morus notabilis
ref|XP_009354983.1|  PREDICTED: methylesterase 17-like                  248   1e-78   Pyrus x bretschneideri [bai li]
ref|XP_006407497.1|  hypothetical protein EUTSA_v10021291mg             247   5e-78   Eutrema salsugineum
ref|XP_009122575.1|  PREDICTED: methylesterase 17                       242   3e-76   Brassica rapa
ref|XP_006298200.1|  hypothetical protein CARUB_v10014251mg             243   4e-76   Capsella rubella
ref|XP_007205683.1|  hypothetical protein PRUPE_ppa009635mg             242   4e-76   Prunus persica
ref|XP_006376560.1|  hypothetical protein POPTR_0013s15410g             240   6e-76   Populus trichocarpa [western balsam poplar]
emb|CDY36279.1|  BnaA01g31390D                                          241   6e-76   Brassica napus [oilseed rape]
gb|ABK95513.1|  unknown                                                 239   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_009406049.1|  PREDICTED: methylesterase 17-like                  239   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHF99571.1|  Pheophorbidase                                          239   2e-75   Gossypium arboreum [tree cotton]
ref|XP_002884817.1|  hypothetical protein ARALYDRAFT_478421             239   3e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_010464778.1|  PREDICTED: methylesterase 17-like                  240   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010491291.1|  PREDICTED: methylesterase 17-like                  238   8e-75   Camelina sativa [gold-of-pleasure]
ref|NP_187698.1|  methyl esterase 17                                    238   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252030.1|  PREDICTED: methylesterase 17-like isoform X2       234   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010486708.1|  PREDICTED: methylesterase 17                       237   3e-74   Camelina sativa [gold-of-pleasure]
gb|KFK38476.1|  hypothetical protein AALP_AA3G117800                    236   8e-74   Arabis alpina [alpine rockcress]
ref|XP_008788157.1|  PREDICTED: methylesterase 17                       235   1e-73   Phoenix dactylifera
ref|XP_010252032.1|  PREDICTED: methylesterase 17-like isoform X3       233   1e-73   Nelumbo nucifera [Indian lotus]
gb|KHN25794.1|  Pheophorbidase                                          232   6e-73   Glycine soja [wild soybean]
emb|CDP13885.1|  unnamed protein product                                232   7e-73   Coffea canephora [robusta coffee]
ref|XP_010931511.1|  PREDICTED: methylesterase 17-like                  229   2e-71   Elaeis guineensis
ref|XP_006376559.1|  hypothetical protein POPTR_0013s15410g             228   2e-71   Populus trichocarpa [western balsam poplar]
gb|ABK95809.1|  unknown                                                 229   5e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010543669.1|  PREDICTED: methylesterase 17                       225   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_006376561.1|  hypothetical protein POPTR_0013s15410g             219   2e-68   Populus trichocarpa [western balsam poplar]
gb|EEE51534.1|  hypothetical protein OsJ_32736                          220   7e-68   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67552.1|  hypothetical protein OsI_34885                          219   3e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001065997.1|  Os12g0117100                                       218   9e-67   
gb|EEC68736.1|  hypothetical protein OsI_37243                          218   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_004977391.1|  PREDICTED: methylesterase 17-like                  215   1e-65   Setaria italica
emb|CAN78031.1|  hypothetical protein VITISV_017532                     212   8e-65   Vitis vinifera
ref|NP_001151405.1|  esterase PIR7B                                     212   1e-64   Zea mays [maize]
emb|CBI25336.3|  unnamed protein product                                209   4e-64   Vitis vinifera
ref|XP_003576326.2|  PREDICTED: methylesterase 17-like                  210   2e-63   Brachypodium distachyon [annual false brome]
ref|XP_009603473.1|  PREDICTED: methylesterase 17-like                  202   1e-62   Nicotiana tomentosiformis
ref|XP_006847411.1|  hypothetical protein AMTR_s00153p00056390          204   9e-62   
ref|XP_006843726.1|  hypothetical protein AMTR_s00007p00221390          203   4e-61   
ref|XP_006842543.1|  hypothetical protein AMTR_s00077p00129970          202   5e-61   Amborella trichopoda
gb|KEH35520.1|  methylesterase                                          202   6e-61   Medicago truncatula
gb|KGN52590.1|  hypothetical protein Csa_5G645150                       197   5e-60   Cucumis sativus [cucumbers]
gb|EEC68737.1|  hypothetical protein OsI_37244                          199   6e-60   Oryza sativa Indica Group [Indian rice]
gb|EEE52649.1|  hypothetical protein OsJ_35011                          199   7e-60   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065998.2|  Os12g0117200                                       199   7e-60   
gb|EEC67553.1|  hypothetical protein OsI_34886                          199   1e-59   Oryza sativa Indica Group [Indian rice]
gb|KDO67571.1|  hypothetical protein CISIN_1g032072mg                   195   1e-59   Citrus sinensis [Valencia orange]
ref|NP_001065594.1|  Os11g0118000                                       198   2e-59   
ref|XP_002448907.1|  hypothetical protein SORBIDRAFT_05g001250          197   5e-59   Sorghum bicolor [broomcorn]
ref|XP_006662681.1|  PREDICTED: methylesterase 17-like                  197   8e-59   Oryza brachyantha
ref|XP_002520884.1|  conserved hypothetical protein                     196   8e-59   
ref|XP_004977392.1|  PREDICTED: methylesterase 17-like                  196   9e-59   Setaria italica
ref|XP_008669934.1|  PREDICTED: methylesterase 17-like isoform X1       196   1e-58   Zea mays [maize]
gb|ABK21272.1|  unknown                                                 196   1e-58   Picea sitchensis
ref|XP_004978521.1|  PREDICTED: methylesterase 17-like                  195   2e-58   Setaria italica
ref|XP_003577845.1|  PREDICTED: methylesterase 17-like                  194   9e-58   Brachypodium distachyon [annual false brome]
gb|EMS56887.1|  hypothetical protein TRIUR3_06889                       193   2e-57   Triticum urartu
ref|NP_001152091.1|  esterase PIR7A                                     191   1e-56   Zea mays [maize]
ref|XP_006851246.1|  hypothetical protein AMTR_s00180p00034130          191   1e-56   Amborella trichopoda
gb|EMT23896.1|  hypothetical protein F775_02537                         189   1e-55   Aegilops tauschii
gb|KDO60408.1|  hypothetical protein CISIN_1g022603mg                   189   3e-55   Citrus sinensis [Valencia orange]
ref|XP_006443782.1|  hypothetical protein CICLE_v10021442mg             187   7e-55   Citrus clementina
ref|XP_006842541.1|  hypothetical protein AMTR_s00077p00129560          182   3e-53   
ref|XP_008669935.1|  PREDICTED: methylesterase 17-like isoform X2       179   4e-53   Zea mays [maize]
ref|XP_010527076.1|  PREDICTED: pheophorbidase isoform X1               179   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010094434.1|  hypothetical protein L484_018804                   183   1e-51   Morus notabilis
ref|XP_008245182.1|  PREDICTED: methylesterase 17                       177   2e-51   
ref|XP_010527079.1|  PREDICTED: pheophorbidase isoform X3               177   9e-51   Tarenaya hassleriana [spider flower]
emb|CAC82615.1|  hypothetical protein                                   175   3e-50   Capsella rubella
ref|XP_006401106.1|  hypothetical protein EUTSA_v10014415mg             174   7e-50   Eutrema salsugineum
ref|XP_010434786.1|  PREDICTED: probable pheophorbidase isoform X1      174   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010449732.1|  PREDICTED: probable pheophorbidase                 173   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002868108.1|  esterase/lipase/thioesterase family protein        173   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_002866256.1|  hydrolase, alpha/beta fold family protein          172   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010434787.1|  PREDICTED: probable pheophorbidase isoform X2      172   4e-49   Camelina sativa [gold-of-pleasure]
gb|KDO60409.1|  hypothetical protein CISIN_1g022603mg                   170   5e-49   Citrus sinensis [Valencia orange]
ref|XP_006284340.1|  hypothetical protein CARUB_v10005512mg             171   1e-48   Capsella rubella
ref|NP_200639.1|  methyl esterase 18                                    170   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145604.1|  PREDICTED: pheophorbidase                          169   3e-48   Brassica rapa
emb|CDY53646.1|  BnaA08g30360D                                          169   4e-48   Brassica napus [oilseed rape]
emb|CDY40511.1|  BnaC01g20010D                                          168   9e-48   Brassica napus [oilseed rape]
gb|KJB20515.1|  hypothetical protein B456_003G152800                    164   9e-48   Gossypium raimondii
ref|XP_002870859.1|  hypothetical protein ARALYDRAFT_356177             168   1e-47   Arabidopsis lyrata subsp. lyrata
emb|CDY71711.1|  BnaAnng38540D                                          168   1e-47   Brassica napus [oilseed rape]
ref|XP_006279686.1|  hypothetical protein CARUB_v10027010mg             167   1e-47   Capsella rubella
emb|CDY50844.1|  BnaC08g47900D                                          167   5e-47   Brassica napus [oilseed rape]
sp|Q2V0W1.1|PPD_RAPSA  RecName: Full=Pheophorbidase; Short=RsPPD        166   6e-47   Raphanus sativus
ref|XP_010483409.1|  PREDICTED: methylesterase 18-like                  166   9e-47   Camelina sativa [gold-of-pleasure]
emb|CDY32712.1|  BnaA02g07740D                                          166   1e-46   Brassica napus [oilseed rape]
ref|XP_010453481.1|  PREDICTED: methylesterase 18                       166   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009126767.1|  PREDICTED: methylesterase 18                       166   1e-46   Brassica rapa
ref|NP_001147011.1|  esterase PIR7B                                     165   1e-46   Zea mays [maize]
emb|CDY60708.1|  BnaC07g50080D                                          164   3e-46   Brassica napus [oilseed rape]
ref|XP_010443550.1|  PREDICTED: methylesterase 18-like                  165   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006842540.1|  hypothetical protein AMTR_s00077p00129020          163   9e-46   Amborella trichopoda
ref|NP_193402.1|  methyl esterase 16                                    162   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414315.1|  hypothetical protein EUTSA_v10026004mg             162   2e-45   Eutrema salsugineum
ref|XP_010440115.1|  PREDICTED: probable pheophorbidase isoform X2      159   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010440114.1|  PREDICTED: probable pheophorbidase isoform X1      159   6e-45   Camelina sativa [gold-of-pleasure]
emb|CDY02809.1|  BnaC02g10800D                                          160   1e-44   Brassica napus [oilseed rape]
gb|ABK26618.1|  unknown                                                 160   1e-44   Picea sitchensis
ref|XP_002967870.1|  hypothetical protein SELMODRAFT_88885              160   2e-44   Selaginella moellendorffii
ref|XP_010533979.1|  PREDICTED: methylesterase 18 isoform X1            160   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_002981647.1|  hypothetical protein SELMODRAFT_114920             160   2e-44   Selaginella moellendorffii
gb|KFK27361.1|  hypothetical protein AALP_AA8G372900                    160   3e-44   Arabis alpina [alpine rockcress]
ref|XP_002313085.2|  hypothetical protein POPTR_0009s11070g             157   5e-43   Populus trichocarpa [western balsam poplar]
ref|NP_001176321.1|  Os11g0117900                                       150   2e-42   
gb|KFK23092.1|  hypothetical protein AALP_AAs51321U000500               154   3e-42   Arabis alpina [alpine rockcress]
ref|XP_004300554.1|  PREDICTED: probable esterase PIR7A isoform X1      155   3e-42   Fragaria vesca subsp. vesca
ref|XP_006379213.1|  hypothetical protein POPTR_0009s11050g             154   6e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002313084.2|  hypothetical protein POPTR_0009s11040g             154   9e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010041620.1|  PREDICTED: methylesterase 17-like                  150   1e-41   Eucalyptus grandis [rose gum]
gb|ABK23030.1|  unknown                                                 153   1e-41   Picea sitchensis
ref|XP_002522352.1|  Polyneuridine-aldehyde esterase precursor, p...    152   1e-41   Ricinus communis
ref|XP_001763956.1|  predicted protein                                  151   3e-41   Physcomitrella patens
gb|ABA91258.1|  hydrolase, alpha/beta fold family protein, expressed    150   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001764587.1|  predicted protein                                  150   1e-40   Physcomitrella patens
ref|XP_006380732.1|  hypothetical protein POPTR_0007s11750g             149   2e-40   Populus trichocarpa [western balsam poplar]
gb|KDP38248.1|  hypothetical protein JCGZ_04891                         150   2e-40   Jatropha curcas
gb|KDP31871.1|  hypothetical protein JCGZ_12332                         149   4e-40   Jatropha curcas
ref|XP_011039242.1|  PREDICTED: polyneuridine-aldehyde esterase-like    148   5e-40   Populus euphratica
ref|XP_007047136.1|  Methyl esterase 10, putative                       148   5e-40   Theobroma cacao [chocolate]
ref|XP_004514191.1|  PREDICTED: methylesterase 10-like isoform X1       148   5e-40   Cicer arietinum [garbanzo]
ref|XP_007047134.1|  Methyl esterase 10, putative isoform 1             148   6e-40   Theobroma cacao [chocolate]
ref|XP_004514196.1|  PREDICTED: methylesterase 10-like isoform X1       148   6e-40   Cicer arietinum [garbanzo]
ref|XP_002310760.1|  hypothetical protein POPTR_0007s11750g             148   6e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007047135.1|  Methyl esterase 10, putative isoform 2             148   7e-40   Theobroma cacao [chocolate]
ref|XP_004234676.1|  PREDICTED: salicylic acid-binding protein 2-...    147   9e-40   Solanum lycopersicum
ref|XP_004301853.2|  PREDICTED: probable esterase PIR7A                 149   9e-40   Fragaria vesca subsp. vesca
ref|XP_008241857.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    147   1e-39   
ref|NP_001239778.1|  uncharacterized protein LOC100803613               147   2e-39   Glycine max [soybeans]
ref|XP_008230905.1|  PREDICTED: putative methylesterase 11, chlor...    149   2e-39   Prunus mume [ume]
ref|XP_007215535.1|  hypothetical protein PRUPE_ppa007173mg             149   2e-39   Prunus persica
ref|XP_006480147.1|  PREDICTED: methylesterase 10-like                  147   2e-39   Citrus sinensis [Valencia orange]
gb|KJB43607.1|  hypothetical protein B456_007G209600                    146   3e-39   Gossypium raimondii
ref|XP_011039240.1|  PREDICTED: salicylic acid-binding protein 2-...    148   3e-39   Populus euphratica
ref|XP_009123030.1|  PREDICTED: pheophorbidase-like                     145   4e-39   Brassica rapa
ref|XP_009782139.1|  PREDICTED: putative methylesterase 11, chlor...    149   4e-39   Nicotiana sylvestris
ref|XP_006423079.1|  hypothetical protein CICLE_v10028977mg             146   4e-39   Citrus clementina
ref|NP_001275411.1|  methyl jasmonate esterase                          145   5e-39   Solanum tuberosum [potatoes]
ref|XP_007042333.1|  Methyl esterase 10, putative isoform 1             145   1e-38   Theobroma cacao [chocolate]
ref|XP_007202197.1|  hypothetical protein PRUPE_ppa018866mg             144   1e-38   Prunus persica
ref|XP_010070490.1|  PREDICTED: probable esterase PIR7A                 145   1e-38   Eucalyptus grandis [rose gum]
ref|XP_010026413.1|  PREDICTED: salicylic acid-binding protein 2-...    144   2e-38   Eucalyptus grandis [rose gum]
emb|CDO97130.1|  unnamed protein product                                145   2e-38   Coffea canephora [robusta coffee]
ref|NP_001233813.1|  methylesterase                                     144   2e-38   Solanum lycopersicum
ref|XP_006436459.1|  hypothetical protein CICLE_v10032394mg             144   2e-38   Citrus clementina
ref|XP_008341788.1|  PREDICTED: putative methylesterase 11, chlor...    147   2e-38   Malus domestica [apple tree]
gb|KDP31864.1|  hypothetical protein JCGZ_12325                         144   2e-38   Jatropha curcas
ref|XP_009628221.1|  PREDICTED: putative methylesterase 11, chlor...    146   2e-38   Nicotiana tomentosiformis
ref|XP_010088992.1|  hypothetical protein L484_020275                   144   2e-38   Morus notabilis
gb|KEH17958.1|  alpha/beta fold hydrolase                               144   3e-38   Medicago truncatula
gb|KEH17957.1|  alpha/beta fold hydrolase                               144   3e-38   Medicago truncatula
ref|XP_004304220.1|  PREDICTED: putative methylesterase 11, chlor...    146   3e-38   Fragaria vesca subsp. vesca
ref|XP_009628220.1|  PREDICTED: putative methylesterase 11, chlor...    147   3e-38   Nicotiana tomentosiformis
ref|XP_006346482.1|  PREDICTED: polyneuridine-aldehyde esterase-like    144   3e-38   Solanum tuberosum [potatoes]
gb|KDP41318.1|  hypothetical protein JCGZ_15725                         146   3e-38   Jatropha curcas
ref|XP_002310759.2|  hypothetical protein POPTR_0007s11740g             145   4e-38   Populus trichocarpa [western balsam poplar]
gb|KJB47436.1|  hypothetical protein B456_008G026500                    144   4e-38   Gossypium raimondii
gb|KCW55258.1|  hypothetical protein EUGRSUZ_I01184                     144   4e-38   Eucalyptus grandis [rose gum]
ref|XP_003626748.1|  Methyl jasmonate esterase                          143   5e-38   Medicago truncatula
ref|XP_010028516.1|  PREDICTED: salicylic acid-binding protein 2-...    143   6e-38   Eucalyptus grandis [rose gum]
dbj|BAJ88088.1|  predicted protein                                      145   6e-38   Hordeum vulgare subsp. vulgare [barley]
ref|XP_007199380.1|  hypothetical protein PRUPE_ppa025654mg             143   8e-38   Prunus persica
ref|XP_010921786.1|  PREDICTED: probable esterase PIR7A                 144   8e-38   Elaeis guineensis
ref|XP_003626737.1|  Methyl jasmonate esterase                          143   9e-38   Medicago truncatula
ref|XP_004514835.1|  PREDICTED: putative methylesterase 11, chlor...    145   9e-38   Cicer arietinum [garbanzo]
ref|XP_006659045.1|  PREDICTED: putative methylesterase 14, chlor...    145   9e-38   Oryza brachyantha
gb|AFK46482.1|  unknown                                                 145   1e-37   Medicago truncatula
ref|XP_008241854.1|  PREDICTED: salicylic acid-binding protein 2-...    142   1e-37   Prunus mume [ume]
ref|XP_009341927.1|  PREDICTED: probable esterase PIR7A                 143   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_003552586.1|  PREDICTED: putative methylesterase 11, chlor...    144   1e-37   Glycine max [soybeans]
ref|XP_010089652.1|  hypothetical protein L484_021045                   145   1e-37   Morus notabilis
ref|XP_007203473.1|  hypothetical protein PRUPE_ppa024619mg             142   1e-37   Prunus persica
ref|XP_009376503.1|  PREDICTED: probable esterase PIR7A                 142   1e-37   Pyrus x bretschneideri [bai li]
gb|KHN13537.1|  Putative esterase                                       144   1e-37   Glycine soja [wild soybean]
ref|XP_004232153.1|  PREDICTED: putative methylesterase 11, chlor...    144   2e-37   Solanum lycopersicum
ref|XP_002533543.1|  Esterase PIR7B, putative                           144   2e-37   Ricinus communis
ref|XP_002985678.1|  hypothetical protein SELMODRAFT_424768             141   2e-37   Selaginella moellendorffii
ref|XP_001781125.1|  predicted protein                                  141   2e-37   Physcomitrella patens
ref|XP_009800171.1|  PREDICTED: putative methylesterase 11, chlor...    144   2e-37   Nicotiana sylvestris
ref|XP_010646596.1|  PREDICTED: salicylic acid-binding protein 2        141   2e-37   Vitis vinifera
ref|XP_009589631.1|  PREDICTED: putative methylesterase 11, chlor...    144   2e-37   Nicotiana tomentosiformis
ref|XP_010921787.1|  PREDICTED: probable esterase PIR7A                 142   3e-37   Elaeis guineensis
ref|NP_001060815.1|  Os08g0110000                                       144   3e-37   
ref|XP_004239042.1|  PREDICTED: putative methylesterase 11, chlor...    144   3e-37   Solanum lycopersicum
gb|KHN14024.1|  Putative esterase                                       144   3e-37   Glycine soja [wild soybean]
gb|EAZ05349.1|  hypothetical protein OsI_27553                          144   3e-37   Oryza sativa Indica Group [Indian rice]
gb|EAZ41273.1|  hypothetical protein OsJ_25780                          144   3e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CBI32481.3|  unnamed protein product                                141   3e-37   Vitis vinifera
ref|XP_004230826.1|  PREDICTED: polyneuridine-aldehyde esterase         141   3e-37   Solanum lycopersicum
ref|XP_002284944.1|  PREDICTED: methylesterase 10                       141   3e-37   Vitis vinifera
ref|XP_006584519.1|  PREDICTED: uncharacterized protein LOC100526...    143   4e-37   Glycine max [soybeans]
ref|XP_007156846.1|  hypothetical protein PHAVU_002G022300g             141   4e-37   Phaseolus vulgaris [French bean]
ref|XP_010440116.1|  PREDICTED: probable pheophorbidase isoform X3      138   4e-37   Camelina sativa [gold-of-pleasure]
emb|CDX93739.1|  BnaA09g23390D                                          142   4e-37   Brassica napus [oilseed rape]
ref|XP_010070491.1|  PREDICTED: probable esterase PIR7A                 140   4e-37   Eucalyptus grandis [rose gum]
gb|KDO48824.1|  hypothetical protein CISIN_1g024134mg                   141   4e-37   Citrus sinensis [Valencia orange]
ref|XP_006485625.1|  PREDICTED: methylesterase 1-like                   140   5e-37   Citrus sinensis [Valencia orange]
ref|XP_009114775.1|  PREDICTED: putative methylesterase 14, chlor...    142   5e-37   Brassica rapa
ref|XP_007204507.1|  hypothetical protein PRUPE_ppa019104mg             140   5e-37   Prunus persica
gb|AAG12536.1|AC015446_17  Unknown protein                              140   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099230.1|  PREDICTED: salicylic acid-binding protein 2-...    140   6e-37   Sesamum indicum [beniseed]
ref|XP_006366936.1|  PREDICTED: polyneuridine-aldehyde esterase-like    140   6e-37   Solanum tuberosum [potatoes]
ref|XP_010921788.1|  PREDICTED: probable esterase PIR7A isoform X1      140   7e-37   Elaeis guineensis
ref|XP_006415915.1|  hypothetical protein EUTSA_v10007629mg             144   7e-37   Eutrema salsugineum
ref|XP_002284928.2|  PREDICTED: salicylic acid-binding protein 2        141   7e-37   Vitis vinifera
ref|XP_009627967.1|  PREDICTED: methylesterase 10-like isoform X1       140   8e-37   Nicotiana tomentosiformis
ref|XP_011009240.1|  PREDICTED: putative methylesterase 11, chlor...    142   8e-37   Populus euphratica
ref|XP_008236705.1|  PREDICTED: esterase PIR7B-like                     140   8e-37   Prunus mume [ume]
ref|XP_010070492.1|  PREDICTED: salicylic acid-binding protein 2-...    140   8e-37   Eucalyptus grandis [rose gum]
ref|XP_010646594.1|  PREDICTED: salicylic acid-binding protein 2-...    140   8e-37   Vitis vinifera
ref|XP_008241566.1|  PREDICTED: methylesterase 3-like                   140   8e-37   Prunus mume [ume]
gb|ABY59789.1|  methyl jasmonate esterase                               140   9e-37   Nicotiana attenuata
ref|XP_006348679.1|  PREDICTED: putative methylesterase 11, chlor...    140   9e-37   
ref|XP_010939193.1|  PREDICTED: putative methylesterase 11, chlor...    142   1e-36   Elaeis guineensis
emb|CDP11927.1|  unnamed protein product                                139   1e-36   Coffea canephora [robusta coffee]
ref|XP_010530122.1|  PREDICTED: putative methylesterase 14, chlor...    141   1e-36   Tarenaya hassleriana [spider flower]
pdb|3STY|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...    139   1e-36   Lycopersicon hirsutum f. glabratum
gb|ABR17565.1|  unknown                                                 139   1e-36   Picea sitchensis
emb|CDM82835.1|  unnamed protein product                                139   1e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006366937.1|  PREDICTED: polyneuridine-aldehyde esterase-like    139   2e-36   Solanum tuberosum [potatoes]
ref|XP_007139458.1|  hypothetical protein PHAVU_008G031400g             141   2e-36   Phaseolus vulgaris [French bean]
emb|CBI18571.3|  unnamed protein product                                139   2e-36   Vitis vinifera
ref|XP_010026414.1|  PREDICTED: salicylic acid-binding protein 2-...    139   2e-36   
ref|XP_007047137.1|  Methyl esterase 1, putative                        139   2e-36   
gb|KHG04552.1|  hypothetical protein F383_29159                         142   2e-36   
ref|XP_007047146.1|  Methyl esterase 10, putative                       139   2e-36   
ref|XP_011031527.1|  PREDICTED: putative methylesterase 14, chlor...    141   2e-36   
ref|XP_010030657.1|  PREDICTED: probable esterase PIR7A                 139   2e-36   
ref|XP_006858583.1|  hypothetical protein AMTR_s00071p00187920          140   2e-36   
ref|XP_010527077.1|  PREDICTED: pheophorbidase isoform X2               138   2e-36   
ref|XP_010683356.1|  PREDICTED: putative methylesterase 14, chlor...    141   2e-36   
ref|NP_001060214.1|  Os07g0603600                                       139   2e-36   
gb|AAV87156.1|  MKS1                                                    139   2e-36   
emb|CDY15302.1|  BnaC06g07880D                                          140   2e-36   
ref|XP_003519919.1|  PREDICTED: salicylic acid-binding protein 2-...    139   2e-36   
ref|XP_002305386.1|  hypothetical protein POPTR_0004s11550g             141   2e-36   
ref|XP_009411687.1|  PREDICTED: probable esterase PIR7A                 139   2e-36   
gb|KJB40591.1|  hypothetical protein B456_007G070400                    141   2e-36   
gb|KDP31866.1|  hypothetical protein JCGZ_12327                         139   2e-36   
ref|XP_006361568.1|  PREDICTED: polyneuridine-aldehyde esterase-like    139   3e-36   
pdb|3STX|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...    139   3e-36   
gb|KDP27262.1|  hypothetical protein JCGZ_19961                         141   3e-36   
ref|XP_006425815.1|  hypothetical protein CICLE_v10026277mg             139   3e-36   
ref|XP_009588438.1|  PREDICTED: putative methylesterase 11, chlor...    142   3e-36   
gb|ADK38535.1|  methylketone synthase I                                 139   3e-36   
pdb|3STT|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...    139   3e-36   
emb|CDX91794.1|  BnaC08g07130D                                          140   3e-36   
gb|EYU22770.1|  hypothetical protein MIMGU_mgv1a008866mg                140   3e-36   
ref|XP_008241567.1|  PREDICTED: salicylic acid-binding protein 2-...    139   3e-36   
ref|XP_006306487.1|  hypothetical protein CARUB_v10012466mg             142   3e-36   
ref|XP_006365366.1|  PREDICTED: salicylic acid-binding protein 2-...    138   3e-36   
gb|KFK32713.1|  hypothetical protein AALP_AA6G278900                    138   3e-36   
gb|ACN36895.1|  unknown                                                 140   3e-36   
ref|NP_174661.1|  methyl esterase 14                                    140   4e-36   
gb|AAM66136.1|  polyneuridine aldehyde esterase, putative               140   4e-36   
ref|XP_006391040.1|  hypothetical protein EUTSA_v10018532mg             142   4e-36   
ref|XP_007047147.1|  Methyl esterase 10, putative                       138   4e-36   
ref|XP_002888709.1|  hydrolase, alpha/beta fold family protein          142   4e-36   
ref|XP_009391582.1|  PREDICTED: probable esterase PIR7A                 138   4e-36   
ref|XP_004294516.1|  PREDICTED: putative methylesterase 12, chlor...    140   4e-36   
ref|XP_003567442.1|  PREDICTED: probable esterase PIR7A                 138   4e-36   
emb|CDY46454.1|  BnaA08g06540D                                          140   4e-36   
ref|XP_011009369.1|  PREDICTED: putative methylesterase 11, chlor...    140   4e-36   
emb|CDP10786.1|  unnamed protein product                                138   4e-36   
ref|XP_009107939.1|  PREDICTED: putative methylesterase 14, chlor...    140   5e-36   
ref|XP_002444898.1|  hypothetical protein SORBIDRAFT_07g001070          140   5e-36   
ref|XP_002974308.1|  hypothetical protein SELMODRAFT_414679             137   5e-36   
ref|XP_011009242.1|  PREDICTED: putative methylesterase 11, chlor...    140   5e-36   
gb|EYU44209.1|  hypothetical protein MIMGU_mgv1a008225mg                140   6e-36   
emb|CDY36076.1|  BnaA08g19720D                                          141   6e-36   
ref|NP_001150431.1|  polyneuridine-aldehyde esterase                    140   6e-36   
ref|XP_002323905.2|  hypothetical protein POPTR_0017s13080g             140   6e-36   
ref|XP_009109917.1|  PREDICTED: putative methylesterase 13, chlor...    141   6e-36   
ref|XP_009365968.1|  PREDICTED: putative methylesterase 11, chlor...    140   6e-36   
ref|XP_004972459.1|  PREDICTED: putative methylesterase 14, chlor...    140   6e-36   
gb|AFW61429.1|  polyneuridine-aldehyde esterase                         140   7e-36   
dbj|BAJ99976.1|  predicted protein                                      137   7e-36   
gb|KEH34282.1|  alpha/beta fold hydrolase                               137   7e-36   
gb|KFK32022.1|  hypothetical protein AALP_AA6G189900                    139   7e-36   
ref|XP_006431317.1|  hypothetical protein CICLE_v10011905mg             140   7e-36   
emb|CDP19577.1|  unnamed protein product                                137   8e-36   
ref|XP_006338354.1|  PREDICTED: putative methylesterase 11, chlor...    139   9e-36   
ref|XP_006425816.1|  hypothetical protein CICLE_v10026277mg             137   9e-36   
ref|XP_008789941.1|  PREDICTED: probable esterase PIR7A                 137   9e-36   
ref|XP_009356419.1|  PREDICTED: putative methylesterase 11, chlor...    140   9e-36   
gb|KDO79351.1|  hypothetical protein CISIN_1g024065mg                   137   1e-35   
emb|CDP02329.1|  unnamed protein product                                139   1e-35   
ref|XP_004243297.2|  PREDICTED: methylesterase 10-like                  137   1e-35   
ref|XP_007047142.1|  Methyl esterase 6, putative                        137   1e-35   
gb|KCW55271.1|  hypothetical protein EUGRSUZ_I01198                     137   1e-35   
ref|XP_010437282.1|  PREDICTED: methylesterase 9-like                   137   1e-35   
ref|XP_006346473.1|  PREDICTED: polyneuridine-aldehyde esterase-like    139   1e-35   
ref|XP_002974304.1|  hypothetical protein SELMODRAFT_414672             136   1e-35   
ref|XP_006466659.1|  PREDICTED: salicylic acid-binding protein 2-...    137   1e-35   
ref|XP_009619949.1|  PREDICTED: probable esterase PIR7A                 137   1e-35   
ref|XP_010041541.1|  PREDICTED: salicylic acid-binding protein 2-...    137   1e-35   
gb|EAZ04631.1|  hypothetical protein OsI_26779                          139   1e-35   
gb|AAG52490.1|AC018364_8  putative alpha/beta hydrolase; 66690-68793    140   1e-35   
ref|XP_008241568.1|  PREDICTED: methylesterase 10-like                  137   1e-35   
ref|XP_009592821.1|  PREDICTED: salicylic acid-binding protein 2-...    137   1e-35   
gb|EAZ40574.1|  hypothetical protein OsJ_25031                          139   1e-35   
ref|XP_010936456.1|  PREDICTED: putative methylesterase 11, chlor...    139   1e-35   
ref|XP_006346533.1|  PREDICTED: methylesterase 10-like                  137   1e-35   
ref|XP_010477863.1|  PREDICTED: putative methylesterase 13, chlor...    140   1e-35   
ref|NP_177084.2|  methyl esterase 15                                    140   2e-35   
gb|KDP31865.1|  hypothetical protein JCGZ_12326                         136   2e-35   
emb|CBI32488.3|  unnamed protein product                                137   2e-35   
gb|KDP36703.1|  hypothetical protein JCGZ_07994                         139   2e-35   
ref|XP_010548386.1|  PREDICTED: methylesterase 1-like                   137   2e-35   
ref|XP_002284950.3|  PREDICTED: salicylic acid-binding protein 2-...    138   2e-35   
ref|XP_004137122.1|  PREDICTED: methylesterase 3-like                   137   2e-35   
ref|XP_004170642.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    137   2e-35   
ref|XP_007042334.1|  Methyl esterase 10, putative isoform 2             135   2e-35   
ref|XP_006285859.1|  hypothetical protein CARUB_v10007354mg             136   2e-35   
ref|XP_008389409.1|  PREDICTED: putative methylesterase 11, chlor...    139   2e-35   
ref|XP_002874595.1|  hydrolase, alpha/beta fold family protein          138   2e-35   
ref|XP_006436460.1|  hypothetical protein CICLE_v10032396mg             137   2e-35   
ref|XP_006658778.1|  PREDICTED: putative methylesterase 11, chlor...    139   2e-35   
ref|XP_002284907.3|  PREDICTED: salicylic acid-binding protein 2        137   2e-35   
ref|XP_002325532.1|  hydrolase family protein                           138   2e-35   
emb|CBI32472.3|  unnamed protein product                                137   2e-35   
gb|AAF27064.1|AC008262_13  F4N2.19                                      140   2e-35   
ref|XP_008785612.1|  PREDICTED: putative methylesterase 11, chlor...    139   2e-35   
ref|XP_002459047.1|  hypothetical protein SORBIDRAFT_03g045070          136   2e-35   
ref|XP_009791930.1|  PREDICTED: salicylic acid-binding protein 2-...    137   2e-35   
gb|KHG12512.1|  hypothetical protein F383_16648                         138   2e-35   
ref|XP_003573282.1|  PREDICTED: putative methylesterase 14, chlor...    139   2e-35   
ref|XP_009622541.1|  PREDICTED: putative methylesterase 12, chlor...    138   2e-35   
ref|XP_008454904.1|  PREDICTED: methylesterase 3-like                   137   2e-35   
ref|XP_002316717.1|  Chain A family protein                             135   2e-35   
ref|XP_010470899.1|  PREDICTED: putative methylesterase 15, chlor...    139   2e-35   
ref|XP_007151830.1|  hypothetical protein PHAVU_004G078800g             136   2e-35   
ref|XP_009798021.1|  PREDICTED: putative methylesterase 11, chlor...    140   2e-35   
ref|XP_010670152.1|  PREDICTED: putative methylesterase 11, chlor...    139   2e-35   
ref|XP_004231413.1|  PREDICTED: polyneuridine-aldehyde esterase         136   3e-35   
ref|XP_009365910.1|  PREDICTED: putative methylesterase 11, chlor...    140   3e-35   
ref|XP_006478193.1|  PREDICTED: putative methylesterase 14, chlor...    138   3e-35   
emb|CAB39614.1|  putative host response protein                         136   3e-35   
ref|XP_007203427.1|  hypothetical protein PRUPE_ppa021591mg             135   3e-35   
ref|XP_011099026.1|  PREDICTED: putative methylesterase 11, chlor...    138   3e-35   
ref|XP_009802772.1|  PREDICTED: putative methylesterase 12, chlor...    138   3e-35   
dbj|BAK00779.1|  predicted protein                                      136   3e-35   
ref|XP_002973861.1|  hypothetical protein SELMODRAFT_100200             137   3e-35   
ref|XP_009414632.1|  PREDICTED: putative methylesterase 14, chlor...    137   3e-35   
ref|XP_006376121.1|  hydrolase family protein                           137   3e-35   
ref|XP_004230823.1|  PREDICTED: polyneuridine-aldehyde esterase         138   3e-35   
ref|XP_002983529.1|  hypothetical protein SELMODRAFT_118270             137   3e-35   
ref|XP_009612686.1|  PREDICTED: putative methylesterase 11, chlor...    138   3e-35   
gb|KJB70421.1|  hypothetical protein B456_011G072700                    137   4e-35   
ref|XP_006425813.1|  hypothetical protein CICLE_v10026284mg             135   4e-35   
gb|KJB70423.1|  hypothetical protein B456_011G072700                    137   4e-35   
ref|XP_010070493.1|  PREDICTED: probable esterase PIR7A                 135   4e-35   
dbj|BAJ96426.1|  predicted protein                                      138   4e-35   
ref|XP_010323708.1|  PREDICTED: salicylic acid-binding protein 2        135   4e-35   
ref|XP_006404849.1|  hypothetical protein EUTSA_v10000533mg             135   4e-35   
ref|XP_002459051.1|  hypothetical protein SORBIDRAFT_03g045110          135   4e-35   
ref|XP_004971186.1|  PREDICTED: probable esterase PIR7A-like            135   4e-35   
ref|XP_008440235.1|  PREDICTED: methylesterase 10                       135   4e-35   
gb|KCW44286.1|  hypothetical protein EUGRSUZ_L02277                     136   5e-35   
gb|ACH63241.1|  ethylene esterase-like protein                          135   5e-35   
emb|CDY34566.1|  BnaC03g56660D                                          138   5e-35   
ref|XP_009769295.1|  PREDICTED: putative methylesterase 11, chlor...    138   5e-35   
ref|XP_002875544.1|  hydrolase, alpha/beta fold family protein          138   5e-35   
emb|CAN67986.1|  hypothetical protein VITISV_010770                     140   5e-35   
ref|XP_002880515.1|  hypothetical protein ARALYDRAFT_481226             135   6e-35   
gb|KFK41347.1|  hypothetical protein AALP_AA2G118700                    139   6e-35   
ref|XP_006415051.1|  hypothetical protein EUTSA_v10008092mg             137   6e-35   
ref|XP_010101270.1|  hypothetical protein L484_011634                   137   6e-35   
ref|XP_010030653.1|  PREDICTED: salicylic acid-binding protein 2-...    135   6e-35   
ref|XP_002522349.1|  Polyneuridine-aldehyde esterase precursor, p...    134   6e-35   
ref|XP_009399152.1|  PREDICTED: putative methylesterase 12, chlor...    136   7e-35   
ref|XP_010246766.1|  PREDICTED: putative methylesterase 14, chlor...    137   7e-35   
gb|KFK28992.1|  hypothetical protein AALP_AA7G074800                    138   7e-35   
ref|XP_009616768.1|  PREDICTED: salicylic acid-binding protein 2-...    135   7e-35   
ref|XP_006346475.1|  PREDICTED: salicylic acid-binding protein 2-...    135   7e-35   
emb|CDM82839.1|  unnamed protein product                                135   7e-35   
ref|XP_002890665.1|  predicted protein                                  138   8e-35   
ref|XP_009362000.1|  PREDICTED: methylesterase 7-like                   135   9e-35   
dbj|BAJ12170.1|  alpha/beta hydrolase fold superfamily                  134   9e-35   
dbj|BAF58165.1|  alpha/beta hydrolase fold superfamily                  134   9e-35   
dbj|BAJ17976.1|  alpha/beta hydrolase fold superfamily                  134   1e-34   
ref|XP_010460319.1|  PREDICTED: putative methylesterase 13, chlor...    138   1e-34   
gb|EMT21621.1|  hypothetical protein F775_21482                         134   1e-34   
ref|XP_006397131.1|  hypothetical protein EUTSA_v10028772mg             136   1e-34   
ref|NP_192728.2|  methyl esterase 12                                    136   1e-34   
ref|XP_006466663.1|  PREDICTED: salicylic acid-binding protein 2-...    134   1e-34   
ref|XP_007047144.1|  Salicylic acid-binding protein 2                   134   1e-34   
ref|XP_008379871.1|  PREDICTED: LOW QUALITY PROTEIN: putative met...    138   1e-34   
ref|XP_006339354.1|  PREDICTED: putative methylesterase 14, chlor...    136   1e-34   
ref|XP_009399151.1|  PREDICTED: putative methylesterase 14, chlor...    136   1e-34   
gb|KDO79352.1|  hypothetical protein CISIN_1g024065mg                   134   1e-34   
ref|XP_001772896.1|  predicted protein                                  134   1e-34   
gb|KDO79350.1|  hypothetical protein CISIN_1g024065mg                   134   1e-34   
ref|XP_001774530.1|  predicted protein                                  134   1e-34   
ref|XP_010066830.1|  PREDICTED: putative methylesterase 11, chlor...    137   2e-34   
ref|XP_009774878.1|  PREDICTED: putative methylesterase 14, chlor...    136   2e-34   
ref|XP_009366235.1|  PREDICTED: salicylic acid-binding protein 2-...    134   2e-34   
gb|KFK30342.1|  hypothetical protein AALP_AA7G249100                    134   2e-34   
ref|XP_009383535.1|  PREDICTED: probable esterase PIR7A                 135   2e-34   
gb|EPS70657.1|  hypothetical protein M569_04103                         136   2e-34   
ref|XP_010432108.1|  PREDICTED: methylesterase 9-like                   134   2e-34   
ref|XP_002869010.1|  hypothetical protein ARALYDRAFT_912657             134   2e-34   
ref|XP_008243834.1|  PREDICTED: putative methylesterase 11, chlor...    136   2e-34   
gb|KJB56793.1|  hypothetical protein B456_009G136100                    134   2e-34   
gb|KDP38249.1|  hypothetical protein JCGZ_04892                         134   2e-34   
ref|XP_011039232.1|  PREDICTED: salicylic acid-binding protein 2-...    134   2e-34   
ref|XP_007200274.1|  hypothetical protein PRUPE_ppa014939mg             134   2e-34   
ref|XP_008810785.1|  PREDICTED: salicylic acid-binding protein 2-...    134   2e-34   
ref|XP_006300410.1|  hypothetical protein CARUB_v10021332mg             137   2e-34   
ref|XP_002522344.1|  Polyneuridine-aldehyde esterase precursor, p...    133   2e-34   
dbj|BAJ12171.1|  alpha/beta hydrolase fold superfamily                  133   3e-34   
ref|XP_003566319.1|  PREDICTED: probable esterase PIR7A                 134   3e-34   
ref|XP_010511946.1|  PREDICTED: putative methylesterase 15, chlor...    137   3e-34   
dbj|BAF58164.1|  alpha/beta hydrolase fold superfamily                  133   3e-34   
ref|XP_010499048.1|  PREDICTED: putative methylesterase 13, chlor...    136   3e-34   
ref|NP_001275858.1|  ethylene-induced esterase                          133   3e-34   
ref|XP_004958235.1|  PREDICTED: putative methylesterase 11, chlor...    135   3e-34   
ref|XP_007223024.1|  hypothetical protein PRUPE_ppa006887mg             135   3e-34   
ref|XP_006346488.1|  PREDICTED: polyneuridine-aldehyde esterase-like    134   3e-34   
gb|AGT17094.1|  esterase PIR7A-like protein                             134   3e-34   
ref|XP_007017094.1|  Methyl esterase 17-like protein isoform 1          131   3e-34   
ref|XP_002522346.1|  Polyneuridine-aldehyde esterase precursor, p...    133   3e-34   
ref|XP_008241571.1|  PREDICTED: LOW QUALITY PROTEIN: salicylic ac...    133   3e-34   
gb|KHG11847.1|  Polyneuridine-aldehyde esterase                         133   3e-34   
ref|XP_010930559.1|  PREDICTED: putative methylesterase 14, chlor...    135   3e-34   
ref|XP_008786474.1|  PREDICTED: putative methylesterase 14, chlor...    134   3e-34   
ref|XP_010938436.1|  PREDICTED: salicylic acid-binding protein 2-...    133   3e-34   
emb|CDY50306.1|  BnaA02g14640D                                          136   3e-34   
ref|XP_010437905.1|  PREDICTED: putative methylesterase 12, chlor...    135   3e-34   
emb|CDY54147.1|  BnaCnng26270D                                          136   3e-34   
ref|XP_002977823.1|  hypothetical protein SELMODRAFT_107740             134   3e-34   
ref|XP_008444053.1|  PREDICTED: putative methylesterase 11, chlor...    135   3e-34   
ref|XP_008339612.1|  PREDICTED: methylesterase 10                       133   3e-34   
ref|NP_173960.2|  methyl esterase 13                                    136   4e-34   
ref|XP_007202449.1|  hypothetical protein PRUPE_ppa010011mg             133   4e-34   
ref|XP_011088755.1|  PREDICTED: probable esterase PIR7A                 133   4e-34   
ref|XP_009127711.1|  PREDICTED: putative methylesterase 15, chlor...    137   4e-34   
ref|XP_010026416.1|  PREDICTED: probable esterase PIR7A                 133   4e-34   
ref|XP_009117275.1|  PREDICTED: methylesterase 2-like                   133   4e-34   
ref|XP_004300557.1|  PREDICTED: salicylic acid-binding protein 2-...    133   4e-34   
gb|ABK26277.1|  unknown                                                 133   4e-34   
gb|EEC79085.1|  hypothetical protein OsI_19694                          134   4e-34   
ref|XP_011039235.1|  PREDICTED: salicylic acid-binding protein 2-...    133   4e-34   



>gb|KHG20572.1| Pheophorbidase [Gossypium arboreum]
Length=275

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = +2

Query  44   IREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDIL  223
            + E+  A    PHFVLVHG+GGGAWCWYK++CLMENSGYKVSCIDL  AG D SDAN I+
Sbjct  9    MTEKETAAMNNPHFVLVHGIGGGAWCWYKIKCLMENSGYKVSCIDLKGAGTDRSDANSIV  68

Query  224  TFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGF  403
            +FDDYNKPL+DF+++LP ++QVILVGHSAGGLSVT ATHKF  KI LA+Y+AATMLK+GF
Sbjct  69   SFDDYNKPLMDFMSALPHSEQVILVGHSAGGLSVTQATHKFANKIRLAVYVAATMLKSGF  128

Query  404  TSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTL  583
             ++QDIKDG+PDLS FG   +VY++GFG+G + PPT+ +V K  QRKI+YQMSP EDSTL
Sbjct  129  LTDQDIKDGVPDLSQFG---DVYELGFGLGAEQPPTTAIVKKEFQRKIIYQMSPQEDSTL  185

Query  584  AGMLLRPGPI  613
            A MLLRPGPI
Sbjct  186  AAMLLRPGPI  195



>ref|XP_009784670.1| PREDICTED: methylesterase 17-like [Nicotiana sylvestris]
Length=281

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 171/207 (83%), Gaps = 6/207 (3%)
 Frame = +2

Query  2    GGESFETKKTAEEKIREEVVAPPPPP--HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCI  175
            G ES + +   E   + +V  PP P   HFVLVHG+GGG WCWYK+R LMENSGYKV+C+
Sbjct  2    GEESVDIRLEIE---KAKVPLPPQPQRTHFVLVHGIGGGGWCWYKIRSLMENSGYKVTCL  58

Query  176  DLSSAGVDPSDANDILTFDDYNKPLLDFLAS-LPPNQQVILVGHSAGGLSVTDATHKFPQ  352
            DL  AG+D +D N I++FD+YNKPL+DFL+S LP ++QVILVGHSAGGLSVTDATHKF +
Sbjct  59   DLKGAGIDQADPNTIISFDEYNKPLIDFLSSTLPDSEQVILVGHSAGGLSVTDATHKFAK  118

Query  353  KISLAIYIAATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKT  532
            K+ +A+YIAATML+TGF + QD+KDG+PDLSDFGE  +VYDIGFG G + PPTSI++ K+
Sbjct  119  KVKVAVYIAATMLRTGFVTTQDVKDGVPDLSDFGEFADVYDIGFGSGPEQPPTSIVIKKS  178

Query  533  LQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LQRKI+YQ+SPLEDSTLA MLLRPGPI
Sbjct  179  LQRKIIYQISPLEDSTLATMLLRPGPI  205



>ref|XP_007011384.1| Methyl esterase 17 [Theobroma cacao]
 gb|EOY20194.1| Methyl esterase 17 [Theobroma cacao]
Length=271

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 155/179 (87%), Gaps = 3/179 (2%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVLVHG+ GGAWCWYK+RCLMENSGYKVSCIDL  AG+D SDAN IL+FDDYNKPLLD
Sbjct  17   PHFVLVHGISGGAWCWYKIRCLMENSGYKVSCIDLKGAGIDQSDANSILSFDDYNKPLLD  76

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            F+++LP  +QVILVGHSAGGLSVT ATHKF +KI LA+Y+AATMLK G+ ++QDIKDG+P
Sbjct  77   FMSALPDTEQVILVGHSAGGLSVTQATHKFSKKIRLAVYVAATMLKLGYLTDQDIKDGVP  136

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            DLS FG   +VY++GFG+G + PPTS +V K  QRKI+YQMSP EDSTLA MLLRPGPI
Sbjct  137  DLSGFG---DVYELGFGLGPEQPPTSAIVKKEFQRKIIYQMSPQEDSTLATMLLRPGPI  192



>ref|XP_006367441.1| PREDICTED: methylesterase 17-like [Solanum tuberosum]
Length=274

 Score =   288 bits (736),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG+GGG WCWYK+R L+EN GYKV+ +DL  AG+DPSD N IL+F DYNKPLLDF
Sbjct  24   HFVLIHGIGGGGWCWYKIRSLIENCGYKVTSLDLKGAGIDPSDPNTILSFHDYNKPLLDF  83

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+SLP N+QVILVGHSAGG+SVTDA HKFP+KI +A+YIAATML+TGF S+QD+KDG+PD
Sbjct  84   LSSLPHNEQVILVGHSAGGMSVTDAIHKFPKKIKVAVYIAATMLRTGFMSQQDVKDGVPD  143

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VYD+GFG+G + PPTS++V K+LQR+I+YQMSPLEDSTLA MLLRPGPI
Sbjct  144  LSEFG---DVYDMGFGLGPEKPPTSVVVKKSLQREIIYQMSPLEDSTLASMLLRPGPI  198



>ref|XP_011084804.1| PREDICTED: methylesterase 17 isoform X2 [Sesamum indicum]
Length=288

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGGAWCWYK+RCLME+SGY+VSC+DL  AG+DP+D N +L+F+DYNKPLLDF
Sbjct  33   HFVLVHGIGGGAWCWYKIRCLMESSGYRVSCLDLKGAGMDPTDPNTVLSFNDYNKPLLDF  92

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKF-PQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            L+SL  + QVILVGHSAGGLS++DA HKF  +KI LA++IAATML++GF ++QDIKDG+P
Sbjct  93   LSSLHDDHQVILVGHSAGGLSLSDAIHKFGKKKIKLAVFIAATMLRSGFVTDQDIKDGVP  152

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            DLS+FGE+ EVYD+GFG+G+D PPT++++ K LQRKI+YQ+SP EDSTLA MLLRPGP
Sbjct  153  DLSEFGELKEVYDVGFGLGEDHPPTTMMINKELQRKIIYQLSPQEDSTLAAMLLRPGP  210



>gb|ACU18515.1| unknown [Glycine max]
Length=219

 Score =   285 bits (730),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 161/195 (83%), Gaps = 5/195 (3%)
 Frame = +2

Query  29   TAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  208
            T  E++ E VVA     HFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL SAG+D SD
Sbjct  4    TMPERVEEGVVALNQ--HFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLKSAGIDQSD  61

Query  209  ANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM  388
            A+ +L+FDDYNKPL+DF++ LP N+QVILVGHSAGGLS+T A HKF  KI LA+Y+AATM
Sbjct  62   ADSVLSFDDYNKPLMDFMSDLPENEQVILVGHSAGGLSITQACHKFANKIRLAVYVAATM  121

Query  389  LKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPL  568
            LK GF ++QD KDG+PDLS++G   +VY++GFG+G D PPTS LV K  QRKI+Y +SP 
Sbjct  122  LKFGFLTDQDHKDGVPDLSEYG---DVYELGFGLGHDKPPTSALVKKEFQRKIIYPLSPH  178

Query  569  EDSTLAGMLLRPGPI  613
            EDSTLA MLLRPGP+
Sbjct  179  EDSTLAAMLLRPGPL  193



>ref|XP_009626844.1| PREDICTED: methylesterase 17 [Nicotiana tomentosiformis]
Length=280

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+ GG WCWYK++ LME SGYKV+C+DL  AG+ P+D   +L+FDDYN+PL+DF
Sbjct  24   HFVLVHGISGGGWCWYKIKSLMEISGYKVTCLDLKGAGIHPTDPTTLLSFDDYNEPLIDF  83

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+SLP N+QVILVGHSAGGLSVTDATHKFP+K+ LA+Y+AATML+TGF +EQD++DGIPD
Sbjct  84   LSSLPENEQVILVGHSAGGLSVTDATHKFPKKVRLAVYVAATMLRTGFVTEQDVEDGIPD  143

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FGE  +VYD+GFG+G + PP+S ++ ++LQRKI+YQMSPLEDSTLA MLLRPGPI
Sbjct  144  LSEFGEPIDVYDMGFGLGPEQPPSSAVIKRSLQRKIIYQMSPLEDSTLAAMLLRPGPI  201



>ref|XP_007218793.1| hypothetical protein PRUPE_ppa009785mg [Prunus persica]
 gb|EMJ19992.1| hypothetical protein PRUPE_ppa009785mg [Prunus persica]
Length=277

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 155/178 (87%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+ GGAWCWYK+RCLMENSGYKVSC+DL SAG+D SDAN + +FDDYNKPLLD 
Sbjct  25   HFVLVHGISGGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQSDANSVFSFDDYNKPLLDL  84

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L++LP N+QVILVGHSAGGLSVT AT  FP+KI LA+Y+AATMLK G++++QDIKDG+PD
Sbjct  85   LSALPENEQVILVGHSAGGLSVTHATLMFPKKIRLAVYVAATMLKLGYSTDQDIKDGVPD  144

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG+I   Y++GFG+G + PPTS ++ K  QRKI+YQMSP EDSTLA MLLRPGP+
Sbjct  145  LSEFGDI---YELGFGLGSNKPPTSAMIKKEFQRKIIYQMSPQEDSTLAAMLLRPGPL  199



>ref|XP_008234160.1| PREDICTED: methylesterase 17 [Prunus mume]
Length=286

 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 155/178 (87%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+ GGAWCWYK+RCLMENSGYKVSC+DL SAG+D SDAN + +FDDYNKPLLD 
Sbjct  32   HFVLVHGISGGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQSDANSVFSFDDYNKPLLDL  91

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L++LP N+QVILVGHSAGGLSVT AT  FP+KI LA+Y+AATMLK G++++QDIKDG+PD
Sbjct  92   LSALPENEQVILVGHSAGGLSVTHATLMFPKKIRLAVYVAATMLKLGYSTDQDIKDGVPD  151

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG+I   Y++GFG+G + PPTS ++ K  QRKI+YQMSP EDSTLA MLLRPGP+
Sbjct  152  LSEFGDI---YELGFGLGSNKPPTSAMIKKEFQRKIIYQMSPQEDSTLAAMLLRPGPL  206



>ref|XP_009363781.1| PREDICTED: methylesterase 17-like [Pyrus x bretschneideri]
Length=280

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = +2

Query  23   KKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDP  202
            ++T  EK  E    P    HFVLVHG+  GAWCWYK+RCLMENSGYKVSC+DL SAG+D 
Sbjct  8    EETMVEKKMELSEVPLKTTHFVLVHGISHGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQ  67

Query  203  SDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAA  382
            SDAN +L+FDDYNKPLLD L++LP N+QVILVGHSAGGL+VT AT KFP+KI LA+Y+AA
Sbjct  68   SDANSVLSFDDYNKPLLDLLSALPENEQVILVGHSAGGLNVTQATLKFPKKILLAVYVAA  127

Query  383  TMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMS  562
            TMLK GF+++QD KDG+PDLS+FG   +VY++GFG+G D PPTS +V K  QRKI YQ+S
Sbjct  128  TMLKHGFSTDQDFKDGVPDLSEFG---DVYELGFGLGADKPPTSAIVKKEFQRKISYQLS  184

Query  563  PLEDSTLAGMLLRPGPI  613
            P EDSTLA MLLRPGP+
Sbjct  185  PQEDSTLAAMLLRPGPL  201



>ref|XP_007141327.1| hypothetical protein PHAVU_008G186600g [Phaseolus vulgaris]
 gb|ESW13321.1| hypothetical protein PHAVU_008G186600g [Phaseolus vulgaris]
Length=284

 Score =   285 bits (729),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 162/199 (81%), Gaps = 6/199 (3%)
 Frame = +2

Query  26   KTAEEK---IREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  196
            +  EEK   + EE      P HFVLVHG+GGGAWCWYK+RCLMENSGYKVSCIDL SAG+
Sbjct  2    RVKEEKAMAVSEESGDSRGPIHFVLVHGIGGGAWCWYKIRCLMENSGYKVSCIDLKSAGI  61

Query  197  DPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYI  376
            D S A+ +L+FDDYN+PL+DFL++LP N+QVILVGHSAGGLSVT+A HKF +KI LA+Y+
Sbjct  62   DQSHADSVLSFDDYNQPLMDFLSALPENEQVILVGHSAGGLSVTEACHKFAKKIHLAVYV  121

Query  377  AATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQ  556
            AATMLK GF +++D+K G+PDLS+FG   +VY +GFG+GQD PPTS LV K  QRKI+Y 
Sbjct  122  AATMLKLGFLTDEDLKHGVPDLSEFG---DVYQLGFGLGQDKPPTSALVKKEFQRKIIYH  178

Query  557  MSPLEDSTLAGMLLRPGPI  613
            +SP EDSTLA MLLR GPI
Sbjct  179  LSPHEDSTLASMLLRAGPI  197



>ref|XP_003526792.1| PREDICTED: methylesterase 17 [Glycine max]
Length=276

 Score =   285 bits (728),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 161/195 (83%), Gaps = 5/195 (3%)
 Frame = +2

Query  29   TAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  208
            T  E++ E VVA     HFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL SAG+D SD
Sbjct  4    TMPERVEEGVVALNQ--HFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLKSAGIDQSD  61

Query  209  ANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM  388
            A+ +L+FDDYNKPL+DF++ LP N+QVILVGHSAGGLS+T A HKF  KI LA+Y+AATM
Sbjct  62   ADSVLSFDDYNKPLMDFMSDLPENEQVILVGHSAGGLSITQACHKFANKIRLAVYVAATM  121

Query  389  LKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPL  568
            LK GF ++QD KDG+PDLS++G   +VY++GFG+G D PPTS LV K  QRKI+Y +SP 
Sbjct  122  LKFGFLTDQDHKDGVPDLSEYG---DVYELGFGLGHDKPPTSALVKKEFQRKIIYPLSPH  178

Query  569  EDSTLAGMLLRPGPI  613
            EDSTLA MLLRPGP+
Sbjct  179  EDSTLAAMLLRPGPL  193



>gb|KEH35519.1| methylesterase [Medicago truncatula]
Length=289

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG WCWYK++CLMENSGYKVSCIDL S+G+D SDA+ ILTFDDYNKP++DF
Sbjct  36   HFVLVHGIGGGGWCWYKIKCLMENSGYKVSCIDLKSSGIDQSDADSILTFDDYNKPVIDF  95

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP N+QVILVGHSAGGLS+T A HKF  K+SLA+Y+AATMLK G+++++D+KDG+PD
Sbjct  96   MSALPDNEQVILVGHSAGGLSITQACHKFANKVSLAVYVAATMLKFGYSTDEDLKDGVPD  155

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VY++GFG+GQD PPTS L+ K LQRKI+Y +SP EDSTLA MLLRPGP+
Sbjct  156  LSEFG---DVYELGFGLGQDKPPTSALIKKELQRKIIYPLSPHEDSTLAAMLLRPGPL  210



>gb|AFK40220.1| unknown [Medicago truncatula]
Length=289

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG WCWYK++CLMENSGYKVSCIDL S+G+D SDA+ ILTFDDYNKP++DF
Sbjct  36   HFVLVHGIGGGGWCWYKIKCLMENSGYKVSCIDLKSSGIDQSDADSILTFDDYNKPVIDF  95

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP N+QVILVGHSAGGLS+T A HKF  K+SLA+Y+AATMLK G+++++D+KDG+PD
Sbjct  96   MSALPDNEQVILVGHSAGGLSITQACHKFANKVSLAVYVAATMLKFGYSTDEDLKDGVPD  155

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VY++GFG+GQD PPTS L+ K LQRKI+Y +SP EDSTLA MLLRPGP+
Sbjct  156  LSEFG---DVYELGFGLGQDKPPTSALIKKELQRKIIYPLSPHEDSTLAAMLLRPGPL  210



>ref|XP_009777586.1| PREDICTED: methylesterase 17-like [Nicotiana sylvestris]
Length=280

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+ GG WCWYK++ LME S YKV+C+DL  AG+ P+D   +L+FDDYN+PL++F
Sbjct  24   HFVLVHGISGGGWCWYKIKSLMEISCYKVTCLDLKGAGIHPADPTTVLSFDDYNEPLIEF  83

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+SLP N+QVILVGHSAGGLSVTDATHKFP+K+ LA+Y+AATML+TGF +EQD+KDGIPD
Sbjct  84   LSSLPENEQVILVGHSAGGLSVTDATHKFPKKVRLAVYVAATMLRTGFVTEQDVKDGIPD  143

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FGE  +VYD+GFG+G + PP+S ++ ++LQRKI+YQMSPLEDSTLA MLLRPGPI
Sbjct  144  LSEFGEPIDVYDMGFGLGPEQPPSSAVIKRSLQRKIIYQMSPLEDSTLAAMLLRPGPI  201



>ref|XP_008376326.1| PREDICTED: methylesterase 17-like [Malus domestica]
Length=280

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 154/178 (87%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+  GAWCWYK+RCLMENSGYKVSC+DL SAG+D SDAN +L+FDDYNKPLLD 
Sbjct  27   HFVLVHGISHGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQSDANSVLSFDDYNKPLLDL  86

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L++LP N+QVILVGHSAGGL+VT AT KFP+KI LA+Y+AATMLK GF+++QD KDG+PD
Sbjct  87   LSALPENEQVILVGHSAGGLNVTQATIKFPKKILLAVYVAATMLKHGFSTDQDFKDGVPD  146

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VY++GFG+G D PPTS +V K  QRKI YQ+SP EDSTLA MLLRPGP+
Sbjct  147  LSEFG---DVYELGFGLGADKPPTSAIVKKEFQRKISYQLSPQEDSTLAAMLLRPGPL  201



>ref|XP_004240843.1| PREDICTED: methylesterase 17 [Solanum lycopersicum]
Length=280

 Score =   282 bits (722),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = +2

Query  2    GGESFETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDL  181
            G E F  K+  EE + E+V       HFVL+HG+ GG WCWYK++ LME SGYKV+C+DL
Sbjct  2    GEEYFVEKEKMEENL-EQV----SKIHFVLIHGISGGGWCWYKIKSLMEISGYKVTCLDL  56

Query  182  SSAGVDPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKIS  361
              AG+ P D   I++FDDYN+PL++FL+SLP N+QVILVGHSAGGLSVTDATHKFP+K+ 
Sbjct  57   KGAGIHPHDPTTIISFDDYNQPLINFLSSLPLNEQVILVGHSAGGLSVTDATHKFPKKVR  116

Query  362  LAIYIAATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQR  541
            +A+YI ATML+ GF +EQD+KDGIPDLSDFGE  +VYD+ FG+G + PPTS ++  +LQR
Sbjct  117  MAVYIGATMLRNGFVTEQDVKDGIPDLSDFGEAIDVYDMSFGLGVEQPPTSAVIKTSLQR  176

Query  542  KILYQMSPLEDSTLAGMLLRPGPI  613
            KI+YQMSP+EDSTLA MLLRPGPI
Sbjct  177  KIIYQMSPIEDSTLAAMLLRPGPI  200



>ref|XP_004502811.1| PREDICTED: methylesterase 17-like [Cicer arietinum]
Length=293

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = +2

Query  26   KTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  205
            +  EE +       P   HFVLVHG+GGG+WCWYK++CLMENSGYKVSCIDL S G+D S
Sbjct  20   REIEEGVDSRENNIPLKQHFVLVHGIGGGSWCWYKIKCLMENSGYKVSCIDLKSGGIDQS  79

Query  206  DANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAAT  385
            DA+ ILTFDDYNKPL+DF+++LP N++VILVGHSAGGLS+T   HKF  K+ LA+Y+AAT
Sbjct  80   DADSILTFDDYNKPLIDFMSNLPHNEKVILVGHSAGGLSITHVCHKFANKVDLAVYVAAT  139

Query  386  MLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            MLK GF++++D+KDG+PDL++FG   +VY++GFG+GQD PPTS LV K  QRKI+Y +SP
Sbjct  140  MLKFGFSTDEDLKDGVPDLTEFG---DVYELGFGLGQDKPPTSALVKKEFQRKIIYPLSP  196

Query  566  LEDSTLAGMLLRPGPI  613
             EDSTLAGMLL+PGP+
Sbjct  197  HEDSTLAGMLLKPGPL  212



>ref|XP_009362773.1| PREDICTED: methylesterase 17 [Pyrus x bretschneideri]
Length=281

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 163/199 (82%), Gaps = 5/199 (3%)
 Frame = +2

Query  17   ETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  196
            ET    +++I EE +      HFVLVHG+  GAWCWYK+RCLME+SGYKVSC+DL SAGV
Sbjct  9    ETMVDEDKEISEEPLGATT--HFVLVHGISHGAWCWYKIRCLMESSGYKVSCVDLKSAGV  66

Query  197  DPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYI  376
            D SDAN +L+FDDYNKPLLD L++LP N++VILVGHSAGGL+VT AT KFP+KI LA+Y+
Sbjct  67   DQSDANSVLSFDDYNKPLLDLLSALPENEKVILVGHSAGGLNVTQATLKFPKKILLAVYV  126

Query  377  AATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQ  556
            AATMLK GF+S+QD KDG+PDLS+FG   +VY++GFG+G D PPTS +V K  QRKI YQ
Sbjct  127  AATMLKLGFSSDQDFKDGVPDLSEFG---DVYELGFGLGSDKPPTSAIVKKEFQRKISYQ  183

Query  557  MSPLEDSTLAGMLLRPGPI  613
            +SP EDSTLA MLLRPGP+
Sbjct  184  LSPQEDSTLAAMLLRPGPL  202



>ref|XP_008388372.1| PREDICTED: methylesterase 17-like [Malus domestica]
Length=281

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 162/203 (80%), Gaps = 7/203 (3%)
 Frame = +2

Query  17   ETKKTAEEKIREEVVAPPPP----PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLS  184
            E K T E  + EE      P     HFVLVHG+  GAWCWYK+RCLME+SG+KVSC+DL 
Sbjct  3    EDKATEETMVDEEKEISSEPLKATTHFVLVHGISHGAWCWYKIRCLMESSGFKVSCVDLK  62

Query  185  SAGVDPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISL  364
            SAG+D SDAN +L+FDDYNKPLLD L++LP N++VILVGHSAGGL+VT AT KFP+KI L
Sbjct  63   SAGLDQSDANSVLSFDDYNKPLLDLLSALPENEKVILVGHSAGGLNVTQATLKFPKKILL  122

Query  365  AIYIAATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRK  544
            A+Y+AATMLK GF+S+QD KDG+PDLS+FG   +VY++GFG+G D PPTS +V K  QRK
Sbjct  123  AVYVAATMLKLGFSSDQDFKDGVPDLSEFG---DVYELGFGLGSDKPPTSAIVKKEFQRK  179

Query  545  ILYQMSPLEDSTLAGMLLRPGPI  613
            I YQ+SP EDSTLA MLLRPGP+
Sbjct  180  ISYQLSPQEDSTLAAMLLRPGPL  202



>gb|KJB60171.1| hypothetical protein B456_009G292500 [Gossypium raimondii]
Length=301

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 161/202 (80%), Gaps = 7/202 (3%)
 Frame = +2

Query  17   ETKKTAEEKIR----EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLS  184
            + K   EE++     E+  A    PHFVLVHGLGGGAWCWY+++CLME SGYKVSCIDL 
Sbjct  22   KQKAAMEEEVTMSMTEKETAAMNNPHFVLVHGLGGGAWCWYRIKCLMEISGYKVSCIDLK  81

Query  185  SAGVDPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISL  364
             AG D SDAN I++FDDYNKPL+DF+++LP ++QVILVGHSAGGLSVT ATHKF  KI L
Sbjct  82   GAGTDRSDANSIVSFDDYNKPLMDFMSALPHSEQVILVGHSAGGLSVTQATHKFANKIRL  141

Query  365  AIYIAATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRK  544
            A+Y+AATMLK+GF ++QD KDG+PD S FG   +VY++GFG+G + PPT+ +V K  QRK
Sbjct  142  AVYVAATMLKSGFLTDQDTKDGVPDFSQFG---DVYELGFGLGAEQPPTTAMVKKEFQRK  198

Query  545  ILYQMSPLEDSTLAGMLLRPGP  610
            I+YQMSP EDSTLA +LLRPGP
Sbjct  199  IIYQMSPQEDSTLAALLLRPGP  220



>ref|XP_010999645.1| PREDICTED: methylesterase 17 [Populus euphratica]
Length=276

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 155/183 (85%), Gaps = 3/183 (2%)
 Frame = +2

Query  65   PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK  244
            P  P HFVLVHG+ GG+WCWYK+RCLMENSGY+VSCIDL  AG+DP+DA+ + +FDDYNK
Sbjct  18   PQQPTHFVLVHGISGGSWCWYKIRCLMENSGYRVSCIDLKGAGIDPADADSVHSFDDYNK  77

Query  245  PLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIK  424
            PLLDF++SLP N++VILVGHSAGGLSVT ATH F +KI LA+Y+AATMLK GF ++QDI+
Sbjct  78   PLLDFMSSLPDNEKVILVGHSAGGLSVTQATHMFAKKIRLAVYLAATMLKLGFWTDQDIQ  137

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            DG+PDLS FG   +VY++GFG+G D PPTS +V K  QRKI+YQ+SP EDSTLA ML RP
Sbjct  138  DGVPDLSSFG---DVYELGFGLGPDQPPTSAIVKKEFQRKIMYQLSPQEDSTLAAMLSRP  194

Query  605  GPI  613
            GPI
Sbjct  195  GPI  197



>ref|XP_002325617.2| hydrolase family protein [Populus trichocarpa]
 gb|EEE99998.2| hydrolase family protein [Populus trichocarpa]
Length=276

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            P HFVLVHG+ GG+WCWYK+RCLMENSGY+VSCIDL  AG+DP+DA+ + +FDDYNKP++
Sbjct  21   PTHFVLVHGISGGSWCWYKIRCLMENSGYRVSCIDLKGAGIDPADADSVHSFDDYNKPIM  80

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            DF++SLP N++VILVGHSAGGLSVT ATHKF +KI LA+Y+AATMLK GF +++DIKDG+
Sbjct  81   DFMSSLPDNEKVILVGHSAGGLSVTQATHKFAKKIRLAVYLAATMLKLGFWTDEDIKDGV  140

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            PDLS FG   +VY++GFG+G D PPTS +V K  QRKI+YQ+SP EDSTLA ML RPGPI
Sbjct  141  PDLSSFG---DVYELGFGLGPDQPPTSAIVKKEFQRKIIYQLSPQEDSTLAAMLSRPGPI  197



>gb|KDP21626.1| hypothetical protein JCGZ_03297 [Jatropha curcas]
Length=274

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL  AG+D +DAN IL+FDDYNKPLLDF
Sbjct  19   HFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLKGAGIDQADANSILSFDDYNKPLLDF  78

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++SLP N+QVI+VGHSAGGLSVT A+ KF +KI LA+Y+ ATMLK GF ++QDI+ G+PD
Sbjct  79   MSSLPDNEQVIMVGHSAGGLSVTQASLKFAKKIRLAVYLGATMLKLGFWTDQDIQHGVPD  138

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS FG   EVY++GFG+G D PPTS ++ K  QR+I+YQMSP EDSTLA MLLRPGP+
Sbjct  139  LSSFG---EVYELGFGLGCDKPPTSAIIKKQFQRQIIYQMSPQEDSTLASMLLRPGPV  193



>ref|XP_006435956.1| hypothetical protein CICLE_v10032372mg [Citrus clementina]
 ref|XP_006486136.1| PREDICTED: methylesterase 17-like [Citrus sinensis]
 gb|ESR49196.1| hypothetical protein CICLE_v10032372mg [Citrus clementina]
Length=275

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVLVHG+ GGAWCWYK+RCLMENSGYKVSCI+L  AG DPSDAN I +FDDYNKPL+D
Sbjct  19   PHFVLVHGISGGAWCWYKVRCLMENSGYKVSCINLKGAGTDPSDANSIHSFDDYNKPLMD  78

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            F++SL  N++VILVGHSAGGLS+T A+HKF  KI LA+Y+AATMLK GF +++D+K G+P
Sbjct  79   FMSSLTDNEKVILVGHSAGGLSITQASHKFGNKIRLAVYLAATMLKLGFCTDEDVKIGVP  138

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            DLS FG+  +VY +GFG+G D PPTS +V + LQRKI+YQMSP EDSTLA ML+RPGPI
Sbjct  139  DLSGFGD--DVYQLGFGLGADQPPTSAIVKQELQRKIIYQMSPQEDSTLAAMLVRPGPI  195



>ref|XP_004307746.1| PREDICTED: methylesterase 17 [Fragaria vesca subsp. vesca]
Length=282

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 154/178 (87%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG WCWYK+RCLME SGYKVS +DL SAG+DPS+ + +L+FDDYNKPLLDF
Sbjct  20   HFVLVHGIGGGGWCWYKIRCLMEKSGYKVSTVDLKSAGIDPSNVDSVLSFDDYNKPLLDF  79

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+SLP  +QV+LVGHSAGGLSVT AT KFP+KI LA+Y+AATMLK G+ SE+D+KDG+PD
Sbjct  80   LSSLPEYEQVVLVGHSAGGLSVTQATLKFPKKIRLAVYVAATMLKHGYLSEEDVKDGVPD  139

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VY++GFG+G + PPTS +V K  QRKI+YQMSP EDSTLA MLLRPGP+
Sbjct  140  LSEFG---DVYELGFGLGANQPPTSGVVKKDFQRKIIYQMSPQEDSTLAAMLLRPGPL  194



>gb|ACU16989.1| unknown [Glycine max]
Length=204

 Score =   275 bits (704),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 152/178 (85%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+FDDYNKPL+DF
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++ LP N+QVILVGHSAGGLS+T A HKF  KI LA+Y+AATMLK GF ++QD+KDG+PD
Sbjct  74   MSDLPENEQVILVGHSAGGLSITQACHKFANKIRLAVYVAATMLKFGFLTDQDLKDGVPD  133

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS++G   +VY++GFG+G D PPTS LV K  Q KI+Y +SP EDSTLA MLLRPGP+
Sbjct  134  LSEYG---DVYELGFGLGHDKPPTSALVKKEFQHKIIYPLSPHEDSTLAAMLLRPGPL  188



>ref|XP_006357300.1| PREDICTED: methylesterase 17-like [Solanum tuberosum]
Length=275

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG+ GG WCWYK++ LME SGYKV+C+DL  +G+ P D   I++FDDYN+PL++F
Sbjct  23   HFVLIHGISGGGWCWYKIKSLMEISGYKVTCLDLKGSGIHPHDPTTIISFDDYNQPLINF  82

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
             +SLP N+QVILVGHSAGGLSVTDATHKFP+K+ +A+YI ATML+ GF +EQD+KDGIPD
Sbjct  83   FSSLPQNEQVILVGHSAGGLSVTDATHKFPKKVRMAVYIGATMLRNGFVTEQDVKDGIPD  142

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FGE  +VYD+ FG+G + PPTS +V  +LQRKI+YQMSPLEDSTLA MLLRPGPI
Sbjct  143  LSEFGEAIDVYDMCFGLGPEQPPTSAVVKTSLQRKIIYQMSPLEDSTLAAMLLRPGPI  200



>gb|AFK48205.1| unknown [Medicago truncatula]
 gb|KEH28138.1| methylesterase-like protein [Medicago truncatula]
Length=282

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG WCWYK+RCLMENSGYKVSCIDL SAG++ SDA+ +L+FDDYN+PLLDF
Sbjct  30   HFVLVHGIGGGGWCWYKIRCLMENSGYKVSCIDLKSAGINQSDADSVLSFDDYNQPLLDF  89

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++SLP N+QVILVGHSAGGLS+T A HKF +KI LA+Y+AATMLK GF +++D++DG+PD
Sbjct  90   MSSLPENEQVILVGHSAGGLSITHACHKFAKKICLAVYVAATMLKLGFCTDEDLRDGVPD  149

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VY +GFG+G D PPTS L+ K  QR++++ +SP ED TLA M+LRPGPI
Sbjct  150  LSEFG---DVYQLGFGLGIDKPPTSALIKKEFQREVIFNLSPHEDCTLAAMMLRPGPI  204



>ref|XP_003523289.1| PREDICTED: methylesterase 17 isoformX1 [Glycine max]
Length=271

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 152/178 (85%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+FDDYNKPL+DF
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++ LP N+QVILVGHSAGGLS+T A HKF  KI LA+Y+AATMLK GF ++QD+KDG+PD
Sbjct  74   MSDLPENEQVILVGHSAGGLSITQACHKFANKIRLAVYVAATMLKFGFLTDQDLKDGVPD  133

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS++G   +VY++GFG+G D PPTS LV K  Q KI+Y +SP EDSTLA MLLRPGP+
Sbjct  134  LSEYG---DVYELGFGLGHDKPPTSALVKKEFQHKIIYPLSPHEDSTLAAMLLRPGPL  188



>ref|XP_011084803.1| PREDICTED: methylesterase 17 isoform X1 [Sesamum indicum]
Length=304

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 160/194 (82%), Gaps = 17/194 (9%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGGAWCWYK+RCLME+SGY+VSC+DL  AG+DP+D N +L+F+DYNKPLLDF
Sbjct  33   HFVLVHGIGGGAWCWYKIRCLMESSGYRVSCLDLKGAGMDPTDPNTVLSFNDYNKPLLDF  92

Query  260  LASLPPNQQ----------------VILVGHSAGGLSVTDATHKF-PQKISLAIYIAATM  388
            L+SL  + Q                VILVGHSAGGLS++DA HKF  +KI LA++IAATM
Sbjct  93   LSSLHDDHQLVLAAGFPFCTQTHLWVILVGHSAGGLSLSDAIHKFGKKKIKLAVFIAATM  152

Query  389  LKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPL  568
            L++GF ++QDIKDG+PDLS+FGE+ EVYD+GFG+G+D PPT++++ K LQRKI+YQ+SP 
Sbjct  153  LRSGFVTDQDIKDGVPDLSEFGELKEVYDVGFGLGEDHPPTTMMINKELQRKIIYQLSPQ  212

Query  569  EDSTLAGMLLRPGP  610
            EDSTLA MLLRPGP
Sbjct  213  EDSTLAAMLLRPGP  226



>ref|NP_001237523.1| uncharacterized protein LOC100527539 [Glycine max]
 gb|ACU16635.1| unknown [Glycine max]
Length=283

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 152/182 (84%), Gaps = 3/182 (2%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   HFVLVHG+GG  WCWYK+RCLMENSG+KVSCIDL SAG+D SD + +L+FDDYN+P
Sbjct  24   PLKQHFVLVHGVGGRGWCWYKIRCLMENSGFKVSCIDLKSAGIDQSDVDSVLSFDDYNQP  83

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L+D L++LP N+QVILVGHSAGGLSVT A HKF +KI LA+Y+AATMLK GF +++D+K 
Sbjct  84   LMDLLSALPENEQVILVGHSAGGLSVTQACHKFAKKIRLAVYVAATMLKLGFLTDEDLKH  143

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
            G+PDLS+FG   +VY +GFG+GQD PPTS LV K  QRKI+Y +SP EDSTLA MLLRPG
Sbjct  144  GVPDLSEFG---DVYRLGFGLGQDKPPTSALVKKEFQRKIIYPLSPHEDSTLAAMLLRPG  200

Query  608  PI  613
            PI
Sbjct  201  PI  202



>gb|AFK43530.1| unknown [Lotus japonicus]
Length=285

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 156/186 (84%), Gaps = 3/186 (2%)
 Frame = +2

Query  56   VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDD  235
            +  P    HFVLVHG+ GG+WCWYK+RCLMEN GYKVSCIDL SAG+D S A+ +L+FDD
Sbjct  21   ITIPLKQQHFVLVHGISGGSWCWYKIRCLMENPGYKVSCIDLKSAGIDQSVADSVLSFDD  80

Query  236  YNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQ  415
            YN+PL+DF+++LP N++VILVGHSAGGLS+T A HKF +KI+LA+Y+AATMLK GF +++
Sbjct  81   YNQPLMDFMSALPDNEKVILVGHSAGGLSITQACHKFAEKINLAVYVAATMLKLGFCTDE  140

Query  416  DIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGML  595
            D+KDG+PDLS+FG   +VY +G G+G+D PPTS LV K LQRKI+Y +SP EDSTLA ML
Sbjct  141  DLKDGVPDLSEFG---DVYQLGLGLGRDKPPTSALVKKELQRKIIYPLSPHEDSTLASML  197

Query  596  LRPGPI  613
            LRPGPI
Sbjct  198  LRPGPI  203



>gb|EPS70008.1| hypothetical protein M569_04755 [Genlisea aurea]
Length=268

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = +2

Query  65   PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK  244
            PP P HFVL+HG+GGGAWCWYK+RCLMENSGY+V+C+DL  +GVDP+DAN I +FD YN 
Sbjct  7    PPAPAHFVLIHGIGGGAWCWYKIRCLMENSGYRVTCLDLRGSGVDPTDANTIRSFDHYNS  66

Query  245  PLLDFLASLPPNQQVILVGHSAGGLSVTDATHKF-PQKISLAIYIAATMLKTGFTSEQDI  421
            PL+ FL+ LP  ++VILVGHSAGGLS+TDA H+F  +KI LA+Y+ ATML++GF SE DI
Sbjct  67   PLVGFLSQLPDGERVILVGHSAGGLSLTDAIHRFGKKKIKLAVYVGATMLRSGFASEDDI  126

Query  422  KDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
            K G PDLS+FGE NE++D  +G+GQ+ PPTS+++    QRKI+YQ+SPLED TLA MLLR
Sbjct  127  KIGQPDLSEFGEFNELHDTVYGLGQNQPPTSVMLNNKYQRKIIYQLSPLEDYTLAAMLLR  186

Query  602  PGPI  613
            PGP+
Sbjct  187  PGPM  190



>ref|XP_010244542.1| PREDICTED: methylesterase 17-like [Nelumbo nucifera]
Length=276

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 161/198 (81%), Gaps = 7/198 (4%)
 Frame = +2

Query  32   AEEKIREEVVAPPP----PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVD  199
            A E  +  V+  PP      HFVL+HG+GGGAWCWYKLRCLME+SGYKV+CIDL SAG+D
Sbjct  4    ASEDGKGLVMGIPPFSSRAAHFVLLHGIGGGAWCWYKLRCLMESSGYKVTCIDLKSAGID  63

Query  200  PSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIA  379
            PSD + IL+FD YN+PL+DFL+ LP +Q+VILVGHSAGGLSVTDA +KFP+KI +AIYI 
Sbjct  64   PSDPDSILSFDQYNQPLVDFLSHLPQDQKVILVGHSAGGLSVTDAIYKFPKKIGMAIYIG  123

Query  380  ATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQM  559
            ATML+ GF ++QDIKDG PDLS+FG   +VY+ G+G+G+D PPTS ++ K  QRKI+Y M
Sbjct  124  ATMLRWGFQTDQDIKDGAPDLSEFG---DVYEFGYGLGRDHPPTSAIIKKEYQRKIIYHM  180

Query  560  SPLEDSTLAGMLLRPGPI  613
            SP EDSTLA MLL+PGP+
Sbjct  181  SPQEDSTLALMLLKPGPL  198



>gb|EYU35190.1| hypothetical protein MIMGU_mgv1a010972mg [Erythranthe guttata]
Length=295

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
            FVL+HG+ GGAWCWYK+R LMENSGYKV+C+DL  AGVD +D N +L+F DYN PL+ FL
Sbjct  41   FVLIHGISGGAWCWYKMRSLMENSGYKVTCLDLKGAGVDQTDPNSVLSFHDYNTPLIHFL  100

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKF-PQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +SL  + QVILVGHSAGGLSV+DA +KF  +KI LA++IAATMLK+GF + QDIK G+PD
Sbjct  101  SSLNHDHQVILVGHSAGGLSVSDAMNKFGKKKIKLAVFIAATMLKSGFITHQDIKHGVPD  160

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS++GE+NEVYDIGFG+G+D PPTS+++ K LQRKI+YQ+SP EDSTLA MLLRPGPI
Sbjct  161  LSEYGELNEVYDIGFGLGEDNPPTSMMIKKELQRKIIYQLSPQEDSTLAAMLLRPGPI  218



>ref|XP_004141511.1| PREDICTED: methylesterase 17-like [Cucumis sativus]
Length=285

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 3/180 (2%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            PPHFVLVHG+ GG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N +  FDDYN+PLL
Sbjct  20   PPHFVLVHGISGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDRSDPNSVFNFDDYNQPLL  79

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            DF+++LP N+Q+ILVGHSAGGLSVT AT KF +KI LA+Y+AATML+ GF ++QDIKDG+
Sbjct  80   DFISTLPENEQIILVGHSAGGLSVTQATLKFAKKIRLAVYVAATMLRFGFQNDQDIKDGV  139

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            PD S++G   +VY +GFG+G + PPT+ ++ +  QRKI Y MSP EDSTLA MLLRPGPI
Sbjct  140  PDFSEYG---DVYSLGFGLGSEQPPTTAVIKREFQRKIAYHMSPQEDSTLAAMLLRPGPI  196



>ref|XP_004167241.1| PREDICTED: LOW QUALITY PROTEIN: methylesterase 17-like [Cucumis 
sativus]
Length=285

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 3/180 (2%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            PPHFVLVHG+ GG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N +  FDDYN+PLL
Sbjct  20   PPHFVLVHGISGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDRSDPNSVFNFDDYNQPLL  79

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            DF+++LP N+Q+ILVGHSAGGLSVT AT KF +KI LA+Y+AATML+ GF ++QDIKDG+
Sbjct  80   DFISTLPENEQIILVGHSAGGLSVTQATLKFAKKIRLAVYVAATMLRFGFQNDQDIKDGV  139

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            PD S++G   +VY +GFG+G + PPT+ ++ +  QRKI Y MSP EDSTLA MLLRPGPI
Sbjct  140  PDFSEYG---DVYSLGFGLGSEQPPTTAVIKREFQRKIAYHMSPQEDSTLAAMLLRPGPI  196



>ref|XP_008459483.1| PREDICTED: methylesterase 17 [Cucumis melo]
Length=274

 Score =   271 bits (694),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            PPHFVLVHG+GGG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N ++ FDDYN+PLL
Sbjct  20   PPHFVLVHGIGGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDLSDPNSVINFDDYNQPLL  79

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            DF++SLP N+Q+ILVGHSAGGLS+T AT KF +KI LA+Y+AATML+ GF ++QDIKDG+
Sbjct  80   DFISSLPENEQIILVGHSAGGLSITQATLKFAKKIRLAVYVAATMLRFGFQTDQDIKDGV  139

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            PDLS++G+I   Y++ FG+G   PPT+ ++ +  QRK+ Y MSP EDSTLA MLLRPGPI
Sbjct  140  PDLSEYGDI---YNLEFGLGPQQPPTTAVIKREFQRKVAYHMSPHEDSTLAAMLLRPGPI  196



>ref|XP_007136407.1| hypothetical protein PHAVU_009G042400g [Phaseolus vulgaris]
 gb|ESW08401.1| hypothetical protein PHAVU_009G042400g [Phaseolus vulgaris]
Length=282

 Score =   272 bits (695),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = +2

Query  17   ETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  196
            + +K+  E +REE V      HFVLVHGLGGG WCWYK+RCLMENSGYKVSCIDL S G+
Sbjct  4    KAEKSMPEGVREEGVGLKQQ-HFVLVHGLGGGGWCWYKIRCLMENSGYKVSCIDLKSGGI  62

Query  197  DPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYI  376
            D SDA+ +L+FDDYNKPL+DF+++LP N+QVILVGHSAGGL++T A HKF  KI LA+Y+
Sbjct  63   DQSDADSLLSFDDYNKPLMDFMSALPENEQVILVGHSAGGLNITQACHKFSNKIRLAVYV  122

Query  377  AATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQ  556
            AATMLK GF ++QD+KDG+PDLS++G   +VY++GFG+G D PPTS LV K  QR+I+Y 
Sbjct  123  AATMLKLGFLTDQDLKDGVPDLSEYG---DVYELGFGLGHDKPPTSALVKKEFQRRIIYP  179

Query  557  MSPLEDSTLAGMLLRPGPI  613
            +SP EDSTLA MLLRPGP+
Sbjct  180  LSPQEDSTLASMLLRPGPV  198



>ref|XP_006578847.1| PREDICTED: methylesterase 17 isoform X3 [Glycine max]
Length=272

 Score =   271 bits (694),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+FDDYNKPL+DF
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD-GIP  436
            ++ LP N+QVILVGHSAGGLS+T A HKF  KI LA+Y+AATMLK GF ++QD+KD G+P
Sbjct  74   MSDLPENEQVILVGHSAGGLSITQACHKFANKIRLAVYVAATMLKFGFLTDQDLKDQGVP  133

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            DLS++G   +VY++GFG+G D PPTS LV K  Q KI+Y +SP EDSTLA MLLRPGP+
Sbjct  134  DLSEYG---DVYELGFGLGHDKPPTSALVKKEFQHKIIYPLSPHEDSTLAAMLLRPGPL  189



>ref|XP_002281126.1| PREDICTED: methylesterase 17 [Vitis vinifera]
Length=263

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVL+HG+GGGAWCWYKLRCLMENSGYKVSCI+L+S G+D SDA+ + +FD+Y+KPL D
Sbjct  12   PHFVLIHGIGGGAWCWYKLRCLMENSGYKVSCIELTSGGIDRSDASSVQSFDEYSKPLTD  71

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            F + LP NQ+VILVGHSAGGLSVT A+H+F +KI LA+Y+AATML+ GF +++D  DG+P
Sbjct  72   FFSELPENQKVILVGHSAGGLSVTQASHRFAKKIELAVYVAATMLRLGFMTDEDRMDGVP  131

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            DLSDFG   +VY++ FG  Q   P S ++ K  QRKI+Y MSPLEDSTLA MLLRPGP+
Sbjct  132  DLSDFG---DVYEVEFGADQS--PISAVIKKEFQRKIIYNMSPLEDSTLAAMLLRPGPL  185



>ref|XP_010067632.1| PREDICTED: methylesterase 17 [Eucalyptus grandis]
 gb|KCW65799.1| hypothetical protein EUGRSUZ_G03151 [Eucalyptus grandis]
Length=276

 Score =   261 bits (668),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVLVHG+GGGAWCWYK+R LME+SGY VSC+DL+ AG++P+D N +LT DDYNKPLLD
Sbjct  24   PHFVLVHGIGGGAWCWYKIRTLMESSGYTVSCLDLTGAGINPTDPNTVLTMDDYNKPLLD  83

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            FL++LP ++QVILVGHSAGGL VT A+ KFP KI +A+Y+AATMLK G  ++QD+KDG P
Sbjct  84   FLSTLPDDKQVILVGHSAGGLCVTQASGKFPGKIGVAVYVAATMLKHGLQTDQDLKDGAP  143

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            DLS FG++N   D+ FG+G D PPTS ++ K  QR I+Y MSPLEDSTLA ML++PGP 
Sbjct  144  DLSGFGDVN---DLTFGLGPDKPPTSAIIKKEFQRNIIYHMSPLEDSTLAAMLVKPGPF  199



>ref|XP_011041773.1| PREDICTED: methylesterase 17-like [Populus euphratica]
Length=263

 Score =   261 bits (666),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            P+FVLVHG+  GAWCWYK+RCLME SGYKV+C+DL SAG+D S+ N ILTFD+YN PL+D
Sbjct  10   PYFVLVHGVCHGAWCWYKIRCLMETSGYKVTCLDLKSAGIDQSNPNTILTFDEYNAPLID  69

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            FL++LP +++VILVGHSAGGLS+TDA H+FP+KI LAIY+AA MLK GF+S+QD KDG P
Sbjct  70   FLSNLPHDEKVILVGHSAGGLSLTDAIHRFPKKIHLAIYVAANMLKHGFSSDQDFKDGDP  129

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            D+S++GEI    D+ +GMG D PPTS+++ +  Q++ILYQMSP EDS LA MLLR GP+
Sbjct  130  DVSEYGEIA---DLEYGMGLDEPPTSVIIKEEFQKRILYQMSPKEDSILASMLLRAGPV  185



>ref|XP_002326065.1| Chain A family protein [Populus trichocarpa]
 gb|EEF00447.1| Chain A family protein [Populus trichocarpa]
Length=263

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVLVHG   GAWCWYK+RCLME SGYKV+C+DL SAG+D S+ N ILT D+YN PL+D
Sbjct  10   PHFVLVHGACHGAWCWYKIRCLMETSGYKVTCLDLKSAGIDQSNPNTILTLDEYNAPLID  69

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            FL++LP +++VILVGHSAGGLS+TDA H+FP++I LAIY+AA MLK GF+S+QD KDG P
Sbjct  70   FLSNLPHDEKVILVGHSAGGLSLTDAIHRFPKRIHLAIYVAANMLKHGFSSDQDFKDGDP  129

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            D+S++GEI    D+ +GMG D PPTS+++ +  +++ILYQMSP EDS LA MLLR GP+
Sbjct  130  DVSEYGEIA---DLEYGMGLDEPPTSVIIKEEFRKRILYQMSPKEDSILASMLLRAGPV  185



>ref|XP_004235449.1| PREDICTED: methylesterase 17-like [Solanum lycopersicum]
Length=273

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H VL+HG+GGG WCWYK+R L+EN GYKV+ +DL  AG+DPSD N IL+F +YNKPLLD 
Sbjct  23   HLVLIHGIGGGGWCWYKIRSLIENCGYKVTSLDLKGAGIDPSDPNTILSFHEYNKPLLDL  82

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+SLP N+QVILVGHSAGG+SVTDA HKFP+KI  A+YIAATML+TGF S+QD+KDG+PD
Sbjct  83   LSSLPHNEQVILVGHSAGGMSVTDAIHKFPKKIKFAVYIAATMLRTGFMSQQDVKDGVPD  142

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VYD+ FG+G + PPTS++V K LQR+I+YQMSPLEDSTLA MLLRPGPI
Sbjct  143  LSEFG---DVYDMEFGLGPEKPPTSVVVKKNLQREIIYQMSPLEDSTLASMLLRPGPI  197



>ref|XP_009146797.1| PREDICTED: methylesterase 17 [Brassica rapa]
Length=275

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 155/196 (79%), Gaps = 5/196 (3%)
 Frame = +2

Query  32   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  205
            AEE   E +V  P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+DPS
Sbjct  2    AEENQEETLVLKPRSKPPHFVLIHGISLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDPS  61

Query  206  DANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAAT  385
             A+ + +FD YN+PL DFL+SLP  +QVILVGHSAGGLSVT + HKFP+KISLA+YIAAT
Sbjct  62   SADSLTSFDQYNQPLTDFLSSLPEQEQVILVGHSAGGLSVTSSIHKFPKKISLAVYIAAT  121

Query  386  MLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            MLK GF +++D+KDG+P+LS+ G   +VY++GFG+G + PPTS L+    +RK+LY MSP
Sbjct  122  MLKFGFQTDEDLKDGVPELSEHG---DVYELGFGLGHEHPPTSALIKPEYRRKLLYHMSP  178

Query  566  LEDSTLAGMLLRPGPI  613
             ++  LA +L+RPGP+
Sbjct  179  QQECALAALLMRPGPV  194



>ref|XP_006574372.1| PREDICTED: uncharacterized protein LOC100527539 isoform X1 [Glycine 
max]
Length=288

 Score =   257 bits (656),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   HFVLVHG+GGG WCWYK+RCLMENSG+KVSCIDL SAG+D SD + +L+FDDYN+P
Sbjct  24   PLKQHFVLVHGVGGGGWCWYKIRCLMENSGFKVSCIDLKSAGIDQSDVDSVLSFDDYNQP  83

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L+D L++LP N+QVILVGHSAGGLSVT A HKF +KI LA+Y+AATMLK GF +++D+K 
Sbjct  84   LMDLLSALPENEQVILVGHSAGGLSVTQACHKFAKKIRLAVYVAATMLKLGFLTDEDLKH  143

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
            G+PDLS+FG   +VY +GFG+GQD PPTS LV K  QRKI+Y +SP EDSTLA MLLRPG
Sbjct  144  GVPDLSEFG---DVYRLGFGLGQDKPPTSALVKKEFQRKIIYPLSPHEDSTLAAMLLRPG  200

Query  608  PI  613
            PI
Sbjct  201  PI  202



>emb|CDY65415.1| BnaCnng46980D [Brassica napus]
Length=275

 Score =   256 bits (655),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 155/196 (79%), Gaps = 5/196 (3%)
 Frame = +2

Query  32   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  205
            AEE   E +V  P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+DPS
Sbjct  2    AEENQEETLVLKPRSKPPHFVLIHGISLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDPS  61

Query  206  DANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAAT  385
             A+ + +FD YN+PL DFL+SLP  +QVILVGHSAGGLSVT + HKFP+KISLA+YIAAT
Sbjct  62   SADSLTSFDQYNQPLTDFLSSLPEQEQVILVGHSAGGLSVTSSIHKFPKKISLAVYIAAT  121

Query  386  MLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            MLK GF +++D+KDG+P+LS+ G   +VY++GFG+G + PPTS L+    +RK+LY MSP
Sbjct  122  MLKFGFQTDEDLKDGVPELSEHG---DVYELGFGLGPEHPPTSALIKPEYRRKLLYHMSP  178

Query  566  LEDSTLAGMLLRPGPI  613
             ++  LA +L+RPGP+
Sbjct  179  QQECALAALLMRPGPV  194



>gb|KHN19243.1| Pheophorbidase [Glycine soja]
Length=288

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 152/178 (85%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG WCWYK+RCLMENSG+KVSCIDL SAG+D SD + +L+FDDYN+PL+D 
Sbjct  28   HFVLVHGVGGGGWCWYKIRCLMENSGFKVSCIDLKSAGIDQSDVDSVLSFDDYNQPLMDL  87

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L++LP N+QVILVGHSAGGLSVT A HKF +KI LA+Y+AATMLK GF +++D+K G+PD
Sbjct  88   LSALPENEQVILVGHSAGGLSVTQACHKFAKKIRLAVYVAATMLKLGFLTDEDLKHGVPD  147

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   +VY +GFG+GQD PPTS LV K  QRKI+Y +SP EDSTLA MLLRPGPI
Sbjct  148  LSEFG---DVYRLGFGLGQDKPPTSALVKKEFQRKIIYPLSPHEDSTLAAMLLRPGPI  202



>emb|CDY08569.1| BnaA05g28050D [Brassica napus]
Length=275

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 154/196 (79%), Gaps = 5/196 (3%)
 Frame = +2

Query  32   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  205
            AEE   E +V  P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+DPS
Sbjct  2    AEENQEETLVLKPRSKPPHFVLIHGISLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDPS  61

Query  206  DANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAAT  385
             A+ + +FD YN+PL DFL+SLP  +QVILVGHSAGGLSVT + HKFP+KISLA+YIAAT
Sbjct  62   SADSLTSFDQYNQPLTDFLSSLPEQEQVILVGHSAGGLSVTSSIHKFPKKISLAVYIAAT  121

Query  386  MLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            MLK GF +++D+KDG+P+LS+ G   +VY++GFG+G   PPTS L+    +RK+LY MSP
Sbjct  122  MLKFGFQTDEDLKDGVPELSEHG---DVYELGFGLGPKHPPTSALIKPEYRRKLLYHMSP  178

Query  566  LEDSTLAGMLLRPGPI  613
             ++  LA +L+RPGP+
Sbjct  179  QQECALAALLMRPGPV  194



>ref|XP_010252029.1| PREDICTED: methylesterase 17-like isoform X1 [Nelumbo nucifera]
Length=283

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +2

Query  41   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  220
            K+   V     P HFVLVHG+GGGAWCWYK+RCL+E+SGYKV+C+DL SAG+D S+ + I
Sbjct  16   KVTSSVFISSSPAHFVLVHGIGGGAWCWYKVRCLLESSGYKVTCLDLKSAGIDQSNPDSI  75

Query  221  LTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG  400
            L+F++YNKPL+DFL+ LP +Q+VILVGHSAGG+SVTDA H+F +KI++AIY+ ATML++G
Sbjct  76   LSFEEYNKPLIDFLSDLPQDQKVILVGHSAGGMSVTDAIHRFAKKIAVAIYVGATMLRSG  135

Query  401  FTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDST  580
            F ++QD+KDG+P+L   G++ E   + +G+G D PPTSI++ K  Q ++ Y MSP EDST
Sbjct  136  FRTDQDVKDGVPELFKTGDMCE---LRYGLGPDQPPTSIVIKKEFQHRMAYHMSPQEDST  192

Query  581  LAGMLLRPGPI  613
            LA ML++PGP+
Sbjct  193  LASMLVKPGPL  203



>ref|XP_010670053.1| PREDICTED: methylesterase 17 [Beta vulgaris subsp. vulgaris]
Length=274

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 143/178 (80%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HF+LVHG   G WCWYK+R L+E+SGY V+C+DL S+G++PSDAN I TF DYN+PL+D 
Sbjct  20   HFILVHGASHGGWCWYKVRTLLESSGYLVTCLDLKSSGIEPSDANSIATFQDYNQPLIDL  79

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            LASLP + +VILVGHSAGG+SVT+A HKFP+KI  A+Y+ ATMLK GF S+QD KDG+PD
Sbjct  80   LASLPIHTKVILVGHSAGGISVTEAIHKFPEKIEAAVYVGATMLKLGFHSDQDTKDGVPD  139

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+FG   + YD+GFG G D PPTS +V K LQRKILYQMS LED  LA +LLRP P+
Sbjct  140  LSEFG---QAYDLGFGSGIDQPPTSAIVKKDLQRKILYQMSALEDCALASLLLRPCPL  194



>ref|XP_003523290.1| PREDICTED: methylesterase 17 isoformX2 [Glycine max]
Length=205

 Score =   251 bits (642),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+FDDYNKPL+DF
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++ LP N+QVILVGHSAGGLS+T A HKF  KI LA+Y+AATMLK GF ++QD+KDG+PD
Sbjct  74   MSDLPENEQVILVGHSAGGLSITQACHKFANKIRLAVYVAATMLKFGFLTDQDLKDGVPD  133

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLE  571
            LS++G   +VY++GFG+G D PPTS LV K  Q KI+Y +SP E
Sbjct  134  LSEYG---DVYELGFGLGHDKPPTSALVKKEFQHKIIYPLSPHE  174



>ref|XP_004294719.1| PREDICTED: methylesterase 17-like [Fragaria vesca subsp. vesca]
Length=269

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 149/188 (79%), Gaps = 3/188 (2%)
 Frame = +2

Query  50   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  229
            E  VA P   H VL+HG+G GAWCWYKLRCL+E SG+KV+C+DL  AG+D SD N ILTF
Sbjct  4    ETEVANPHHHHLVLIHGVGHGAWCWYKLRCLLEASGHKVTCMDLKGAGIDQSDPNTILTF  63

Query  230  DDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTS  409
            +DYNKPL++FL++LP +++VILVGHSAGG+S+TDA H+F  KI +AIY+AATMLK GF++
Sbjct  64   EDYNKPLINFLSTLPHDEKVILVGHSAGGMSLTDAIHRFGNKIHMAIYVAATMLKYGFST  123

Query  410  EQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAG  589
            +QD  DG PDLS FG +NE     FG G D PPTS+++ +  + +ILY MSP++DS+LA 
Sbjct  124  DQDFIDGEPDLSAFGNVNEFI---FGFGPDQPPTSVIMKEDFRHQILYHMSPIQDSSLAS  180

Query  590  MLLRPGPI  613
            MLLRPGP+
Sbjct  181  MLLRPGPV  188



>ref|XP_010102428.1| hypothetical protein L484_002055 [Morus notabilis]
 gb|EXB93425.1| hypothetical protein L484_002055 [Morus notabilis]
Length=314

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +2

Query  56   VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDD  235
            +V  P  PHFVLVHG+ GG+WCWYK+RCLMENSGY+ SC+DL SAG+D SDA+ +LTFDD
Sbjct  8    LVELPLKPHFVLVHGISGGSWCWYKIRCLMENSGYRASCVDLKSAGIDRSDADSVLTFDD  67

Query  236  YNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQ  415
            YN+PL+ F+++LP N+QVILVGHSAGG+SVT AT KF +KI LA+YIAATMLK G+ ++Q
Sbjct  68   YNEPLMKFMSALPENEQVILVGHSAGGMSVTWATQKFAKKIRLAVYIAATMLKRGYWTDQ  127

Query  416  DIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            D+KDG+PDLS++G   +VY++GFG+G D PPTS ++ K  QRKI Y MSP
Sbjct  128  DVKDGVPDLSEYG---DVYELGFGLGNDKPPTSAVIKKEFQRKIGYHMSP  174



>ref|XP_009354983.1| PREDICTED: methylesterase 17-like [Pyrus x bretschneideri]
Length=281

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VL+HG+G GAWCWYK+RCLME SGYKV+C+DL  AGVD SD N +LTF DYN+PL DFL
Sbjct  29   LVLIHGIGHGAWCWYKIRCLMEASGYKVTCLDLKGAGVDQSDPNTVLTFQDYNQPLTDFL  88

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
            +SLP N++VILVGHSAGG+S+TDA H+F  KI +AIY+AATML+ GF++ +DI DG PDL
Sbjct  89   SSLPGNEKVILVGHSAGGMSLTDAMHRFASKIHMAIYVAATMLEHGFSTHRDIIDGEPDL  148

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            S FG +N+     +G+G D PPTS+++ +    +ILYQMSP+ED TLA MLLRPGP+
Sbjct  149  SAFGNVNKFI---YGLGVDQPPTSVIIKENFHHQILYQMSPIEDVTLASMLLRPGPV  202



>ref|XP_006407497.1| hypothetical protein EUTSA_v10021291mg [Eutrema salsugineum]
 gb|ESQ48950.1| hypothetical protein EUTSA_v10021291mg [Eutrema salsugineum]
Length=279

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 151/195 (77%), Gaps = 6/195 (3%)
 Frame = +2

Query  38   EKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  208
            E+ +EE +   P    PHFVL+HG+  G+WCWYK++CLME SG+ V+CI+L S+G+D S 
Sbjct  3    EENQEEALGLKPRRKQPHFVLIHGMSLGSWCWYKIKCLMEVSGFAVTCINLKSSGIDSSS  62

Query  209  ANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM  388
            A+ I +FD YN+PL+DFL+SLP  +QVILVGHSAGGLSVT A H+FP+KI LA+YIAA+M
Sbjct  63   ADSITSFDQYNQPLIDFLSSLPEQEQVILVGHSAGGLSVTSAIHRFPKKICLAVYIAASM  122

Query  389  LKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPL  568
            LK GF ++QD+KDG+PDLS+ G   +VY++GFG+G +  PTS L+    QRK+LY MSP 
Sbjct  123  LKFGFQTDQDLKDGVPDLSEHG---DVYELGFGLGSENAPTSALIKPEFQRKLLYHMSPQ  179

Query  569  EDSTLAGMLLRPGPI  613
            ++  LA +++RP P+
Sbjct  180  QECALAALMMRPAPL  194



>ref|XP_009122575.1| PREDICTED: methylesterase 17 [Brassica rapa]
Length=276

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 145/179 (81%), Gaps = 3/179 (2%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVL+HG+  G+WCWYK++CL+E SGY V+CIDL S+G+DPS A+ + +FD YN+PL+D
Sbjct  19   PHFVLIHGMSLGSWCWYKIKCLLEVSGYTVTCIDLKSSGIDPSSADTLTSFDQYNQPLVD  78

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            FL+SLP  +QVILVGHSAGGLSVT +  +FP+KI LA+YIAATMLK GF +++D+KDG+P
Sbjct  79   FLSSLPEQEQVILVGHSAGGLSVTSSIQRFPKKICLAVYIAATMLKFGFQTDEDLKDGVP  138

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            +LS+ G   +VY++GFG+G + PPTS L+    +RK+LY M+P ++  LA +++RP P+
Sbjct  139  ELSEHG---DVYELGFGLGPENPPTSALIKPEFRRKLLYHMTPQQECVLAALMMRPAPL  194



>ref|XP_006298200.1| hypothetical protein CARUB_v10014251mg [Capsella rubella]
 gb|EOA31098.1| hypothetical protein CARUB_v10014251mg [Capsella rubella]
Length=305

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 154/199 (77%), Gaps = 6/199 (3%)
 Frame = +2

Query  26   KTAEEKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  196
            + A+E  +EE +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+
Sbjct  28   QMADENHQEETLELKPRSKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGI  87

Query  197  DPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYI  376
            D S A+ + +FD YN+PL+DFL+S   ++QVILVGHSAGGLSVT A  +FP+KISLA+YI
Sbjct  88   DSSSADSLTSFDQYNQPLIDFLSSSSEHEQVILVGHSAGGLSVTSAIQRFPKKISLAVYI  147

Query  377  AATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQ  556
             A+MLK GF +++D+KDG+PDLS+ G   +VY++GFG+G + PPTS ++    +RK+LY 
Sbjct  148  GASMLKYGFRTDEDMKDGVPDLSEHG---DVYELGFGLGPENPPTSAIIKPEFRRKLLYH  204

Query  557  MSPLEDSTLAGMLLRPGPI  613
            MSP ++ +LA +++RP PI
Sbjct  205  MSPQQECSLAALMMRPAPI  223



>ref|XP_007205683.1| hypothetical protein PRUPE_ppa009635mg [Prunus persica]
 gb|EMJ06882.1| hypothetical protein PRUPE_ppa009635mg [Prunus persica]
Length=284

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 141/177 (80%), Gaps = 3/177 (2%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VL+HG+G GAWCWYK+RCL+E SGYKV+C+DL  AG+D SD N ILTF DYNKPL++FL
Sbjct  32   LVLIHGIGHGAWCWYKIRCLLEASGYKVTCLDLKGAGIDQSDPNTILTFQDYNKPLINFL  91

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
            ++LP +++V+LVGHS GG+S+TDA H+F  KI +AIY+AATML+ GF++ QD KDG PDL
Sbjct  92   SNLPLDEKVVLVGHSVGGMSLTDAIHRFANKIHMAIYVAATMLEHGFSTHQDFKDGKPDL  151

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            S FG + +     +G+G D PPTS ++ +  Q +ILYQMS LEDSTLA MLLRPGP+
Sbjct  152  SAFGNVVKFI---YGLGPDQPPTSAIMKENFQHQILYQMSTLEDSTLASMLLRPGPV  205



>ref|XP_006376560.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
 gb|ERP54357.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
Length=229

 Score =   240 bits (612),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK-P  247
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTFD+YN  P
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYNAPP  67

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L  FL++LP N++VILVGH AGGLS+TDA H+F +KI +AIY+AA MLK G  S+QDIKD
Sbjct  68   LTRFLSNLPDNEKVILVGHGAGGLSLTDAIHRFARKIRMAIYVAANMLKHG--SDQDIKD  125

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
            G PD+S++G   EV D+ +GMG D PPTSI++ +  Q+++LY MSP ED+ LA MLLRPG
Sbjct  126  GDPDVSEYG---EVADLEYGMGLDQPPTSIIIKEEFQKRLLYHMSPKEDTILASMLLRPG  182

Query  608  PI  613
            P+
Sbjct  183  PV  184



>emb|CDY36279.1| BnaA01g31390D [Brassica napus]
Length=276

 Score =   241 bits (616),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVL+HG+  G+WCWYK++CL+E SGY V+CIDL S+G+DPS A+ + +FD YN+PL D
Sbjct  19   PHFVLIHGMSLGSWCWYKIKCLLEVSGYTVTCIDLKSSGIDPSSADTLTSFDQYNQPLTD  78

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            FL+SLP  +QVILVGHSAGGLSVT +  +FP+KI LA+YIAATMLK GF +++D+KDG+P
Sbjct  79   FLSSLPEQEQVILVGHSAGGLSVTSSIQRFPKKICLAVYIAATMLKFGFQTDEDLKDGVP  138

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            +LS+ G   +VY++GFG+G + PPTS L+    +RK+LY M+P ++  LA +++RP P+
Sbjct  139  ELSEHG---DVYELGFGLGPENPPTSALIKPEFRRKLLYHMTPQQECVLAALMMRPAPL  194



>gb|ABK95513.1| unknown [Populus trichocarpa]
Length=260

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK-P  247
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTFD+YN  P
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYNAPP  67

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L  FL++LP N++VILVGH AGGLS+TDA H+F +KI +AIY+AA MLK G  S+QDIKD
Sbjct  68   LTRFLSNLPDNEKVILVGHGAGGLSLTDAIHRFARKIRMAIYVAANMLKHG--SDQDIKD  125

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
            G PD+S++G   EV D+ +GMG D PPTSI++ +  Q+++LY MSP ED+ LA MLLRPG
Sbjct  126  GDPDVSEYG---EVADLEYGMGLDQPPTSIIIKEEFQKRLLYHMSPKEDTILASMLLRPG  182

Query  608  PI  613
            P+
Sbjct  183  PV  184



>ref|XP_009406049.1| PREDICTED: methylesterase 17-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 141/177 (80%), Gaps = 3/177 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLRCL+E SG++VSC DL+SAG+ P+D N IL+ D+Y+ PL   
Sbjct  9    HFVLVHGAGHGAWCWFKLRCLLEASGHRVSCPDLASAGIHPADPNSILSIDEYDAPLFSI  68

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP +++VILVGHSAGGLSVT A H F  KI +AI++AATML  G+ +E+DIKDG+PD
Sbjct  69   MSALPEHEKVILVGHSAGGLSVTHALHVFNNKIKVAIFVAATMLPWGYQTEEDIKDGVPD  128

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            LS FG   +VY++ + MG + PPTS+ + K  QRKILYQ++P+EDSTLA MLLRP P
Sbjct  129  LSRFG---DVYELKYNMGPNNPPTSVALRKEFQRKILYQLNPIEDSTLASMLLRPWP  182



>gb|KHF99571.1| Pheophorbidase [Gossypium arboreum]
Length=262

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV+VHG G GAWCWYK+R L+E S YKVSCIDL  +G+DPSD N I +F DYNKPL+D 
Sbjct  9    HFVMVHGFGHGAWCWYKIRSLLEASDYKVSCIDLKGSGMDPSDPNTIFSFQDYNKPLIDL  68

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L++LP N++VILVGHSAGG+S+T A H+F QKI +AIY+AATMLK GF + QD + G PD
Sbjct  69   LSNLPHNEKVILVGHSAGGMSLTYAIHRFSQKIRMAIYVAATMLKHGFVTPQDYEHGDPD  128

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS +G++ +   + +G+G D PPTS+++ +  QRKILY +SP+EDSTLA ML+R GP+
Sbjct  129  LSIYGDVCK---MTYGLGADQPPTSMIIKEEFQRKILYHLSPIEDSTLAAMLVRAGPL  183



>ref|XP_002884817.1| hypothetical protein ARALYDRAFT_478421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61076.1| hypothetical protein ARALYDRAFT_478421 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 149/196 (76%), Gaps = 5/196 (3%)
 Frame = +2

Query  32   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  205
            AEE   E V   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S
Sbjct  2    AEENQEETVDLKPGRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDFS  61

Query  206  DANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAAT  385
             A+ + TFD YN+PL+DFL+S P  +QVILVGHSAGGLSVT A  +FP+KI LA++I A+
Sbjct  62   SADSLTTFDQYNQPLIDFLSSFPEQEQVILVGHSAGGLSVTSAIQRFPKKICLAVFIGAS  121

Query  386  MLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            MLK G  +++D+K+G+PDLS+ G   +VY++GFG+G + PPTS ++    +RK+LY MSP
Sbjct  122  MLKYGLQTDEDMKNGVPDLSEHG---DVYELGFGLGPENPPTSAIIKHEFRRKLLYHMSP  178

Query  566  LEDSTLAGMLLRPGPI  613
             ++ +LA +++RP PI
Sbjct  179  QQECSLAALMMRPAPI  194



>ref|XP_010464778.1| PREDICTED: methylesterase 17-like [Camelina sativa]
Length=279

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 150/195 (77%), Gaps = 6/195 (3%)
 Frame = +2

Query  38   EKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  208
            E  +EE +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S 
Sbjct  3    EDNQEETLELKPGRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGIDSSS  62

Query  209  ANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM  388
            A+ + +FD YN+PL+DFL+S+P  +QVILVGHSAGGLSVT A  +FP+KIS+A+YI A+M
Sbjct  63   ADSLTSFDQYNQPLIDFLSSIPEQEQVILVGHSAGGLSVTSAIQRFPKKISVAVYIGASM  122

Query  389  LKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPL  568
            LK G  +++D+KDG+PDLS+ G   +VY++ FG+G + PPTS ++    +RK+LY MSP 
Sbjct  123  LKYGLQTDEDMKDGVPDLSEHG---DVYELNFGLGTENPPTSAIIKHEFRRKLLYHMSPQ  179

Query  569  EDSTLAGMLLRPGPI  613
            ++ +LA +++RP PI
Sbjct  180  QECSLAALMMRPAPI  194



>ref|XP_010491291.1| PREDICTED: methylesterase 17-like [Camelina sativa]
Length=279

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 150/197 (76%), Gaps = 6/197 (3%)
 Frame = +2

Query  32   AEEKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDP  202
            AEE  +EE +   P   PP FVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D 
Sbjct  2    AEENHQEETLELKPIRKPPQFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGIDS  61

Query  203  SDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAA  382
            S A+ + +FD YN+PL+DFL+S P  +QVILVGHSAGGLSVT A  +FP+KISLA+YI A
Sbjct  62   SSADTLTSFDQYNQPLIDFLSSSPEEEQVILVGHSAGGLSVTSAIQRFPKKISLAVYIGA  121

Query  383  TMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMS  562
            +MLK G  +++D+KDG+P+LS+ G   +VY++ FG+G + PPTS ++    +RK+LY MS
Sbjct  122  SMLKYGLQTDEDMKDGVPELSEHG---DVYELSFGLGTENPPTSAIIKHEFRRKLLYHMS  178

Query  563  PLEDSTLAGMLLRPGPI  613
            P ++ +LA +++RP PI
Sbjct  179  PQQECSLAALMMRPAPI  195



>ref|NP_187698.1| methyl esterase 17 [Arabidopsis thaliana]
 sp|Q9SG92.1|MES17_ARATH RecName: Full=Methylesterase 17; Short=AtMES17; AltName: Full=Methyl 
indole-3-acetic acid esterase [Arabidopsis thaliana]
 gb|AAF19562.1|AC011708_5 putative alpha-hydroxynitrile lyase [Arabidopsis thaliana]
 gb|AAL36348.1| putative alpha-hydroxynitrile lyase [Arabidopsis thaliana]
 gb|AAM20326.1| putative alpha-hydroxynitrile lyase [Arabidopsis thaliana]
 gb|AEE74965.1| methyl esterase 17 [Arabidopsis thaliana]
Length=276

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 148/196 (76%), Gaps = 5/196 (3%)
 Frame = +2

Query  32   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  205
            AEE   E +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S
Sbjct  2    AEENQEETLELKPSRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDSS  61

Query  206  DANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAAT  385
              + + TFD YN+PL+DFL+S P  +QVILVGHSAGGLS+T A  +FP+KI LA++I A+
Sbjct  62   SVDSLTTFDQYNQPLIDFLSSFPEQEQVILVGHSAGGLSLTSAIQRFPKKICLAVFIGAS  121

Query  386  MLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            MLK G  +++D+KDG+PDLS+ G   +VY++GFG+G + PPTS ++    +RK+LY MSP
Sbjct  122  MLKNGLQTDEDMKDGVPDLSEHG---DVYELGFGLGPENPPTSAIIKPEYRRKLLYHMSP  178

Query  566  LEDSTLAGMLLRPGPI  613
             ++ +LA +++RP PI
Sbjct  179  QQECSLAALMMRPAPI  194



>ref|XP_010252030.1| PREDICTED: methylesterase 17-like isoform X2 [Nelumbo nucifera]
Length=207

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 141/177 (80%), Gaps = 3/177 (2%)
 Frame = +2

Query  41   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  220
            K+   V     P HFVLVHG+GGGAWCWYK+RCL+E+SGYKV+C+DL SAG+D S+ + I
Sbjct  16   KVTSSVFISSSPAHFVLVHGIGGGAWCWYKVRCLLESSGYKVTCLDLKSAGIDQSNPDSI  75

Query  221  LTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG  400
            L+F++YNKPL+DFL+ LP +Q+VILVGHSAGG+SVTDA H+F +KI++AIY+ ATML++G
Sbjct  76   LSFEEYNKPLIDFLSDLPQDQKVILVGHSAGGMSVTDAIHRFAKKIAVAIYVGATMLRSG  135

Query  401  FTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLE  571
            F ++QD+KDG+P+L   G++ E   + +G+G D PPTSI++ K  Q ++ Y MSP E
Sbjct  136  FRTDQDVKDGVPELFKTGDMCE---LRYGLGPDQPPTSIVIKKEFQHRMAYHMSPQE  189



>ref|XP_010486708.1| PREDICTED: methylesterase 17 [Camelina sativa]
Length=278

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 148/196 (76%), Gaps = 5/196 (3%)
 Frame = +2

Query  32   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  205
            AEE   E +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S
Sbjct  2    AEENQEETLELKPIRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGIDSS  61

Query  206  DANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAAT  385
             A+ + +FD YN+PL+DFL+S P  +QVILVGHSAGGLSVT A  +FP+KI LA+YI A+
Sbjct  62   SADSLTSFDQYNQPLIDFLSSSPEEEQVILVGHSAGGLSVTSAIQRFPKKICLAVYIGAS  121

Query  386  MLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSP  565
            MLK G  +++D+KDG+P+LS+ G   +VY++ FG+G + PPTS ++    +RK+LY MSP
Sbjct  122  MLKYGLQTDEDMKDGVPELSEHG---DVYELSFGLGTENPPTSAIIKHEFRRKLLYHMSP  178

Query  566  LEDSTLAGMLLRPGPI  613
             ++ +LA +++RP PI
Sbjct  179  QQECSLAALMMRPAPI  194



>gb|KFK38476.1| hypothetical protein AALP_AA3G117800 [Arabis alpina]
Length=276

 Score =   236 bits (601),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            PPHFVL+HG+  G+W WYK++CLME SG+ V+CIDL S G+D S A+ + +FD YN+PL+
Sbjct  4    PPHFVLIHGMSLGSWSWYKIKCLMEASGFTVTCIDLKSCGIDSSSADSLTSFDQYNQPLI  63

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            DFL+SLP  +QVILVGHSAGGLSVT A  +FP+KISLA+Y+ A+ML+ GF ++QD+KDG+
Sbjct  64   DFLSSLPEQEQVILVGHSAGGLSVTSAIRRFPKKISLAVYVGASMLEFGFQTDQDLKDGV  123

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            PDLS+ G+I   Y++GFG+G + PPTS L+    +RK+L+ MSP ++  L+ +++RP P+
Sbjct  124  PDLSEHGDI---YELGFGLGPENPPTSALIKPEFRRKLLFNMSPQQECALSALMMRPAPV  180



>ref|XP_008788157.1| PREDICTED: methylesterase 17 [Phoenix dactylifera]
Length=265

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 147/188 (78%), Gaps = 4/188 (2%)
 Frame = +2

Query  50   EEVVAPP-PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILT  226
            EEV+A    P HFV VHG+G GAWCW+KLR L+E SG++VSC+DL+SAG+D + A+ + +
Sbjct  3    EEVIAEAFQPQHFVFVHGVGHGAWCWFKLRHLLEASGHRVSCLDLTSAGIDRTGADSVRS  62

Query  227  FDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFT  406
            F++Y+KPL DF+++LP  ++VILVGHSAGGL VT A H+F  KI L+I+IAATML +GF 
Sbjct  63   FEEYDKPLFDFMSALPDGEKVILVGHSAGGLCVTHAMHEFSDKIKLSIFIAATMLPSGFC  122

Query  407  SEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLA  586
            SE+D+ DGIPDL+ +G   +VY++ FG+G+   PTS+ + K  QR ILYQ+SP EDSTLA
Sbjct  123  SEEDVIDGIPDLTKYG---DVYELTFGLGRGHSPTSMALRKEFQRPILYQLSPEEDSTLA  179

Query  587  GMLLRPGP  610
             MLLRP P
Sbjct  180  SMLLRPWP  187



>ref|XP_010252032.1| PREDICTED: methylesterase 17-like isoform X3 [Nelumbo nucifera]
Length=200

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 141/177 (80%), Gaps = 3/177 (2%)
 Frame = +2

Query  41   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  220
            K+   V     P HFVLVHG+GGGAWCWYK+RCL+E+SGYKV+C+DL SAG+D S+ + I
Sbjct  16   KVTSSVFISSSPAHFVLVHGIGGGAWCWYKVRCLLESSGYKVTCLDLKSAGIDQSNPDSI  75

Query  221  LTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG  400
            L+F++YNKPL+DFL+ LP +Q+VILVGHSAGG+SVTDA H+F +KI++AIY+ ATML++G
Sbjct  76   LSFEEYNKPLIDFLSDLPQDQKVILVGHSAGGMSVTDAIHRFAKKIAVAIYVGATMLRSG  135

Query  401  FTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLE  571
            F ++QD+KDG+P+L   G++ E   + +G+G D PPTSI++ K  Q ++ Y MSP E
Sbjct  136  FRTDQDVKDGVPELFKTGDMCE---LRYGLGPDQPPTSIVIKKEFQHRMAYHMSPQE  189



>gb|KHN25794.1| Pheophorbidase [Glycine soja]
Length=237

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 132/157 (84%), Gaps = 3/157 (2%)
 Frame = +2

Query  143  MENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLS  322
            MENSGYKVSCIDL SAG+D SDA+ +L+FDDYNKPL+DF++ LP N+QVILVGHSAGGLS
Sbjct  1    MENSGYKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDFMSDLPENEQVILVGHSAGGLS  60

Query  323  VTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDG  502
            +T A HKF  KI LA+Y+AATMLK GF ++QD KDG+PDLS++G   +VY++GFG+G D 
Sbjct  61   ITQACHKFANKIRLAVYVAATMLKFGFLTDQDHKDGVPDLSEYG---DVYELGFGLGHDK  117

Query  503  PPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            PPTS LV K  QRKI+Y +SP EDSTLA MLLRPGP+
Sbjct  118  PPTSALVKKEFQRKIIYPLSPHEDSTLAAMLLRPGPL  154



>emb|CDP13885.1| unnamed protein product [Coffea canephora]
Length=240

 Score =   232 bits (592),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  143  MENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLS  322
            MENSGYKVSCIDL  AG+D +D N I +F DYN+PLLDFLA+LP ++QVILVGHSAGGL+
Sbjct  1    MENSGYKVSCIDLKGAGLDQTDPNTIFSFQDYNQPLLDFLAALPGDEQVILVGHSAGGLN  60

Query  323  VTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDG  502
            VTDAT+KFP+K+SLA+Y+AATMLK G  +EQD+KDG+PD SD GE  +VYD+GF  G D 
Sbjct  61   VTDATYKFPKKVSLAVYVAATMLKKGMLNEQDVKDGVPDFSDIGEFGDVYDVGFASGLDQ  120

Query  503  PPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            PPTS+++ K L R++ YQM P EDSTLA ML+RPGPI
Sbjct  121  PPTSVVIKKHLLRRLNYQMCPEEDSTLAAMLVRPGPI  157



>ref|XP_010931511.1| PREDICTED: methylesterase 17-like [Elaeis guineensis]
Length=266

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = +2

Query  50   EEVVAPP-PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILT  226
            EEVV     P HFV VHG+G GAWCW+K+R L+E SG++V+C+DL+SAG+D +D N +L+
Sbjct  3    EEVVTDAFQPQHFVFVHGVGHGAWCWFKVRHLLEGSGHRVTCLDLTSAGIDRTDPNSVLS  62

Query  227  FDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFT  406
            F++Y++PL DF+++LP   +VILVGHSAGGL VT A H F  KI LAI++AATML +GF 
Sbjct  63   FEEYDRPLFDFMSALPDGDKVILVGHSAGGLCVTHAMHAFSDKIKLAIFLAATMLPSGFL  122

Query  407  SEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLA  586
            SE+DI DGIPDL  +G   +VY++ +G+G+   PTS+ + K  QR+ILYQ+SP +DS LA
Sbjct  123  SEEDILDGIPDLEKYG---DVYELTYGLGRGHSPTSMALRKEFQRRILYQLSPKQDSILA  179

Query  587  GMLLRPGP  610
             ML+RP P
Sbjct  180  SMLVRPWP  187



>ref|XP_006376559.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
 gb|ERP54356.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
Length=246

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 145/199 (73%), Gaps = 23/199 (12%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK-P  247
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTFD+YN  P
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYNAPP  67

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L  FL++LP N++VILVGH AGGLS+TDA H+F +KI +AIY+AA MLK G  S+QDIKD
Sbjct  68   LTRFLSNLPDNEKVILVGHGAGGLSLTDAIHRFARKIRMAIYVAANMLKHG--SDQDIKD  125

Query  428  -----------------GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQ  556
                             G PD+S++G   EV D+ +GMG D PPTSI++ +  Q+++LY 
Sbjct  126  HLKGLISASIPVPYMEQGDPDVSEYG---EVADLEYGMGLDQPPTSIIIKEEFQKRLLYH  182

Query  557  MSPLEDSTLAGMLLRPGPI  613
            MSP ED+ LA MLLRPGP+
Sbjct  183  MSPKEDTILASMLLRPGPV  201



>gb|ABK95809.1| unknown [Populus trichocarpa]
Length=277

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 145/199 (73%), Gaps = 23/199 (12%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK-P  247
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTFD+YN  P
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYNAPP  67

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L  FL++LP N++VILVGH AGGLS+TDA H+F +KI +AIY+AA MLK G  S+QDIKD
Sbjct  68   LTRFLSNLPDNEKVILVGHGAGGLSLTDAIHRFARKIRMAIYVAANMLKHG--SDQDIKD  125

Query  428  -----------------GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQ  556
                             G PD+S++G   EV D+ +GMG D PPTSI++ +  Q+++LY 
Sbjct  126  HLKGLISASIPVPYMEQGDPDVSEYG---EVADLEYGMGLDQPPTSIIIKEEFQKRLLYH  182

Query  557  MSPLEDSTLAGMLLRPGPI  613
            MSP ED+ LA MLLRPGP+
Sbjct  183  MSPKEDTILASMLLRPGPV  201



>ref|XP_010543669.1| PREDICTED: methylesterase 17 [Tarenaya hassleriana]
Length=279

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 143/178 (80%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG+  G WCWYK++CLME SG+ V+CIDL S+GVD S A+ + +FDDYN+PL+ F
Sbjct  18   HFVLIHGMSLGGWCWYKIKCLMEVSGFSVTCIDLKSSGVDLSSADSLSSFDDYNQPLVRF  77

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+SL  ++QVILVGHSAGGLSVT AT +FP+KISLA+Y+AA+MLK GF ++QD+KDG PD
Sbjct  78   LSSLSEDEQVILVGHSAGGLSVTKATRRFPEKISLAVYVAASMLKFGFQTDQDLKDGSPD  137

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS+ G   EVY++GFG+G + PPTS L+    QRK+LYQ SP +D  LA +L+RP PI
Sbjct  138  LSEHG---EVYELGFGLGPENPPTSALIKPDFQRKLLYQTSPQQDCALAALLMRPAPI  192



>ref|XP_006376561.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
 gb|ERP54358.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
Length=193

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 133/168 (79%), Gaps = 6/168 (4%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK-P  247
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTFD+YN  P
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYNAPP  67

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L  FL++LP N++VILVGH AGGLS+TDA H+F +KI +AIY+AA MLK G  S+QDIKD
Sbjct  68   LTRFLSNLPDNEKVILVGHGAGGLSLTDAIHRFARKIRMAIYVAANMLKHG--SDQDIKD  125

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLE  571
            G PD+S++G   EV D+ +GMG D PPTSI++ +  Q+++LY MSP E
Sbjct  126  GDPDVSEYG---EVADLEYGMGLDQPPTSIIIKEEFQKRLLYHMSPKE  170



>gb|EEE51534.1| hypothetical protein OsJ_32736 [Oryza sativa Japonica Group]
Length=266

 Score =   220 bits (561),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + TFDDYN PLLD 
Sbjct  16   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRTFDDYNAPLLDL  75

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLP   +VIL+GHSAGGLSV  A H F  +I  AI+IAATML+ G+ +EQDIKDG+PD
Sbjct  76   MASLPAGDKVILIGHSAGGLSVVHAMHLFGDRIKQAIFIAATMLQFGYQTEQDIKDGVPD  135

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            LS++G   +VYD+ FG+G D PPT++ + K  QR ILYQ SP EDS LA +LLRP P
Sbjct  136  LSEYG---DVYDLTFGLGADRPPTAVALRKEFQRIILYQQSPQEDSALASILLRPWP  189



>gb|EEC67552.1| hypothetical protein OsI_34885 [Oryza sativa Indica Group]
Length=266

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + +FDDYN PLLD 
Sbjct  16   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRSFDDYNAPLLDL  75

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLP   +VIL+GHSAGGLSV  A H F  +I  AI+IAATML+ G+ +EQDIKDG+PD
Sbjct  76   MASLPAGDKVILIGHSAGGLSVVHAMHLFGDRIKQAIFIAATMLQFGYQTEQDIKDGVPD  135

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            LS++G   +VYD+ FG+G D PPT++ + K  QR ILYQ SP EDS LA +LLRP P
Sbjct  136  LSEYG---DVYDLTFGLGADRPPTAVALRKEFQRIILYQQSPQEDSALASILLRPWP  189



>ref|NP_001065997.1| Os12g0117100 [Oryza sativa Japonica Group]
 gb|ABA95646.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29016.1| Os12g0117100 [Oryza sativa Japonica Group]
 dbj|BAG87221.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52648.1| hypothetical protein OsJ_35010 [Oryza sativa Japonica Group]
Length=268

 Score =   218 bits (554),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + +FDDYN PLLD 
Sbjct  18   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRSFDDYNAPLLDL  77

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLP   +VIL+GHSAGGLSV  A H F  +I  AI+IAATML+ G+ +EQDIKDG+PD
Sbjct  78   MASLPAGDKVILIGHSAGGLSVVHAMHLFGDRIKQAIFIAATMLQFGYQTEQDIKDGVPD  137

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            LS+ G   +VYD+ FG+G D PPT++ + K  QR ILYQ SP EDS LA +LLRP P
Sbjct  138  LSEHG---DVYDLTFGLGADHPPTAVALRKEFQRIILYQQSPQEDSALASILLRPWP  191



>gb|EEC68736.1| hypothetical protein OsI_37243 [Oryza sativa Indica Group]
Length=268

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + +FDDYN PLLD 
Sbjct  18   HFVLVHGAGHGAWCWFRLVRLLQDSGHRVSAVDLAGAAGSLVDPNHVRSFDDYNAPLLDL  77

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLP   +VIL+GHSAGGLSV  A H F  +I  AI+IAATML+ G+ +EQDIKDG+PD
Sbjct  78   MASLPAGDKVILIGHSAGGLSVVHAMHLFGDRIKQAIFIAATMLQFGYQTEQDIKDGVPD  137

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            LS+ G   +VYD+ FG+G D PPT++ + K  QR ILYQ SP EDS LA +LLRP P
Sbjct  138  LSEHG---DVYDLTFGLGADHPPTAVALRKEFQRIILYQQSPQEDSALASILLRPWP  191



>ref|XP_004977391.1| PREDICTED: methylesterase 17-like [Setaria italica]
Length=264

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 128/177 (72%), Gaps = 3/177 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCW+KL  L++ SG++VSCIDL+ A     + ND+ +FD+Y+ PLL F
Sbjct  13   HFVLVHGACHGAWCWFKLASLLQGSGHRVSCIDLAGAAGSLVNPNDVRSFDEYDAPLLQF  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +A+LP   +VILVGHSAGGLSVT A H F  KI   I+IAA ML  GF +EQD KDG+PD
Sbjct  73   MAALPDAHKVILVGHSAGGLSVTHAMHLFTDKIKQGIFIAADMLPFGFQTEQDTKDGVPD  132

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
             S+FG   +VYD+ FG+G+D PPTS+ + K  QR ILY  S  EDSTLA +LLRP P
Sbjct  133  FSEFG---DVYDLNFGLGEDHPPTSMALRKEYQRTILYHQSSREDSTLASILLRPFP  186



>emb|CAN78031.1| hypothetical protein VITISV_017532 [Vitis vinifera]
Length=244

 Score =   212 bits (539),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 126/179 (70%), Gaps = 24/179 (13%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVL+HG+GGGAWCWYKLRCLMENSGYKVSCI+L+S G+D SDA+ + +FD+Y+KPL D
Sbjct  12   PHFVLIHGIGGGAWCWYKLRCLMENSGYKVSCIELTSGGIDRSDASSVQSFDEYSKPLTD  71

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            F + LP NQ+VILVGHSAGGLSVT                     ++    E   + G+P
Sbjct  72   FFSELPENQKVILVGHSAGGLSVTSG-------------------ESPVREEDRTRRGVP  112

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            DLSDFG   +VY++ FG  Q   P S ++ K  QRKI+Y MSPLEDSTLA MLLRPGP+
Sbjct  113  DLSDFG---DVYEVEFGADQS--PISAVIKKEFQRKIIYNMSPLEDSTLAAMLLRPGPL  166



>ref|NP_001151405.1| esterase PIR7B [Zea mays]
 gb|ACG42731.1| esterase PIR7B [Zea mays]
 gb|AFW64634.1| esterase PIR7B [Zea mays]
Length=272

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 133/179 (74%), Gaps = 4/179 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSG-YKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            HFVLVHG G GAWCW+KL CL+  SG ++VSC+DL+ A     D +D+ +FD+Y+ PLLD
Sbjct  20   HFVLVHGAGHGAWCWFKLACLLRGSGRHRVSCVDLAGAAGSLVDPDDVRSFDEYDAPLLD  79

Query  257  FLASLPPN-QQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
             +A+LP + ++V+LVGHSAGGLSVT A H F  KI  AI++AATML  G+ SEQDIKDG 
Sbjct  80   LMAALPDDGRKVVLVGHSAGGLSVTHAMHLFRDKIKQAIFVAATMLPFGYQSEQDIKDGA  139

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            PDLS+FG  ++VYD+ F +G D PPTS+ + +  QR ILYQ    EDSTLA +LLRP P
Sbjct  140  PDLSEFG--DDVYDLKFSLGDDRPPTSVALREEHQRAILYQQCTHEDSTLASILLRPWP  196



>emb|CBI25336.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 5/157 (3%)
 Frame = +2

Query  143  MENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLS  322
            MENSGYKVSCI+L+S G+D SDA+ + +FD+Y+KPL DF + LP NQ+VILVGHSAGGLS
Sbjct  1    MENSGYKVSCIELTSGGIDRSDASSVQSFDEYSKPLTDFFSELPENQKVILVGHSAGGLS  60

Query  323  VTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDG  502
            VT A+H+F +KI LA+Y+AATML+ GF +++D  DG+PDLSDFG   +VY++ FG  Q  
Sbjct  61   VTQASHRFAKKIELAVYVAATMLRLGFMTDEDRMDGVPDLSDFG---DVYEVEFGADQS-  116

Query  503  PPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             P S ++ K  QRKI+Y MSPLEDSTLA MLLRPGP+
Sbjct  117  -PISAVIKKEFQRKIIYNMSPLEDSTLAAMLLRPGPL  152



>ref|XP_003576326.2| PREDICTED: methylesterase 17-like [Brachypodium distachyon]
Length=299

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 135/197 (69%), Gaps = 14/197 (7%)
 Frame = +2

Query  20   TKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVD  199
            ++   E+K+ +E        HFVLVHG G GAWCWY+L  L+  SGY+VSC+DL++    
Sbjct  37   SRNNNEKKLEQE--------HFVLVHGAGHGAWCWYRLLALLRRSGYRVSCVDLAAT---  85

Query  200  PSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIA  379
               +  + +F++Y  PL+D + +LP  ++VILVGHSAGGLS+T A H F  +I  AI+IA
Sbjct  86   TRSSGVVASFEEYTAPLVDLMEALPDGEKVILVGHSAGGLSLTHAMHLFSDRIKQAIFIA  145

Query  380  ATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQM  559
            ATML  GF +EQDIKDG+PDLS  G   +VY++ FG+G D PPT + + +  QR+ILYQ 
Sbjct  146  ATMLPFGFQTEQDIKDGVPDLSKLG---DVYELTFGLGDDHPPTGVALREEFQRRILYQQ  202

Query  560  SPLEDSTLAGMLLRPGP  610
            SPLED  LA +LLRP P
Sbjct  203  SPLEDCALASILLRPWP  219



>ref|XP_009603473.1| PREDICTED: methylesterase 17-like, partial [Nicotiana tomentosiformis]
Length=140

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 115/143 (80%), Gaps = 6/143 (4%)
 Frame = +2

Query  5    GESFETKKTAEEKIREEVVAPPPP--PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCID  178
            GE F   K   EK +     PP P   HFVL+HG+GGG WCWYK+R LMENSGYKV+C+D
Sbjct  2    GEEFVDMKLEIEKTK----VPPQPQRAHFVLIHGIGGGGWCWYKIRSLMENSGYKVTCLD  57

Query  179  LSSAGVDPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKI  358
            L  AG+D +D N I++FD+YNKPL+DFL+SLP ++QVILVGHSAGGLSVTDATHKFP+K+
Sbjct  58   LKGAGIDQADPNTIVSFDEYNKPLIDFLSSLPDSEQVILVGHSAGGLSVTDATHKFPKKV  117

Query  359  SLAIYIAATMLKTGFTSEQDIKD  427
             +A+YIAATML+TGF + QD+KD
Sbjct  118  KVAVYIAATMLRTGFVTTQDVKD  140



>ref|XP_006847411.1| hypothetical protein AMTR_s00153p00056390 [Amborella trichopoda]
 gb|ERN08992.1| hypothetical protein AMTR_s00153p00056390 [Amborella trichopoda]
Length=260

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 8/183 (4%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   HFVLVHG   GAWCWYK   L+++SG+KV+ +DL  +G+ P +A+ IL+F++YNKP
Sbjct  5    PATQHFVLVHGTCHGAWCWYKTASLLKDSGFKVTAVDLCGSGLHPGNADSILSFEEYNKP  64

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKF-PQKISLAIYIAATMLKTGFTSEQDIK  424
            L+D L+++P +++VILVGHSAGGLS+T ATH F  +KISL IY+ A ML+ G  S+QD +
Sbjct  65   LMDLLSTIPEDEKVILVGHSAGGLSITHATHVFGMKKISLCIYVTAIMLRNGIVSDQD-R  123

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
               PDL D        D  FG+G D PPTS ++   LQRK LYQ SP EDSTLA MLLRP
Sbjct  124  QAFPDLGD------AVDFNFGLGPDRPPTSAIINPYLQRKFLYQCSPHEDSTLASMLLRP  177

Query  605  GPI  613
             P+
Sbjct  178  APL  180



>ref|XP_006843726.1| hypothetical protein AMTR_s00007p00221390 [Amborella trichopoda]
 gb|ERN05401.1| hypothetical protein AMTR_s00007p00221390 [Amborella trichopoda]
Length=259

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 133/183 (73%), Gaps = 8/183 (4%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   H VLVHG+  GAWCWYK+  L++NSG+KV+ +DL  AG++P +A+ I++F++YNKP
Sbjct  5    PGTRHVVLVHGVCHGAWCWYKIASLLKNSGFKVTAVDLGGAGINPKNADSIVSFEEYNKP  64

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKF-PQKISLAIYIAATMLKTGFTSEQDIK  424
            L+D + ++P ++++ILVGHSAGGLS+T ATH F   KISL IYI A ML+ GF +++D++
Sbjct  65   LIDLILTIPEDEKIILVGHSAGGLSLTHATHVFGKSKISLCIYITAAMLRNGFKTDEDLQ  124

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
               P ++D      V D  FG+GQD PPTS++    L RK LYQ SP ED TLA MLL+P
Sbjct  125  SA-PSMAD------VADFKFGLGQDQPPTSVIFKPELLRKSLYQCSPEEDCTLASMLLKP  177

Query  605  GPI  613
            GP+
Sbjct  178  GPL  180



>ref|XP_006842543.1| hypothetical protein AMTR_s00077p00129970 [Amborella trichopoda]
 gb|ERN04218.1| hypothetical protein AMTR_s00077p00129970 [Amborella trichopoda]
Length=258

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   HFVLVHG   GAWCWYK   L++NSG+KV+ +DL  AG+DP ++N IL FD+YNKP
Sbjct  5    PATRHFVLVHGFCHGAWCWYKTASLLKNSGFKVTAVDLGGAGIDPGNSNSILQFDEYNKP  64

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKF-PQKISLAIYIAATMLKTGFTSEQDIK  424
            L+D L+++P +++VILVGHSAGGLS+  AT  F  +KISL I+IAA ML+ GF +++D++
Sbjct  65   LIDLLSAIPEDEKVILVGHSAGGLSLIHATRVFGKRKISLCIHIAAIMLRNGFMTDEDLQ  124

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
              IP+L+D      ++D  +G+G D PPTS +    LQRK+L Q SP ED TLA MLLRP
Sbjct  125  -SIPNLAD------LFDYNYGLGLDQPPTSGIFKPELQRKLLSQCSPDEDFTLASMLLRP  177

Query  605  GP  610
            GP
Sbjct  178  GP  179



>gb|KEH35520.1| methylesterase [Medicago truncatula]
Length=244

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 119/178 (67%), Gaps = 48/178 (27%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+GGG WCWYK++CLMENSGYKVSCIDL S+G+D SDA+ ILTFDDYNKP++DF
Sbjct  36   HFVLVHGIGGGGWCWYKIKCLMENSGYKVSCIDLKSSGIDQSDADSILTFDDYNKPVIDF  95

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP N+QVILVGHSAGGLS+T A HKF  K+SLA+Y+AATMLK G+++++D+KD    
Sbjct  96   MSALPDNEQVILVGHSAGGLSITQACHKFANKVSLAVYVAATMLKFGYSTDEDLKD----  151

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                                                        DSTLA MLLRPGP+
Sbjct  152  --------------------------------------------DSTLAAMLLRPGPL  165



>gb|KGN52590.1| hypothetical protein Csa_5G645150 [Cucumis sativus]
Length=176

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  59   VAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDY  238
            V+   PPHFVLVHG+ GG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N +  FDDY
Sbjct  15   VSVQIPPHFVLVHGISGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDRSDPNSVFNFDDY  74

Query  239  NKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQD  418
            N+PLLDF+++LP N+Q+ILVGHSAGGLSVT AT KF +KI LA+Y+AATML+ GF ++QD
Sbjct  75   NQPLLDFISTLPENEQIILVGHSAGGLSVTQATLKFAKKIRLAVYVAATMLRFGFQNDQD  134

Query  419  IKDGIPDL  442
            IKD I ++
Sbjct  135  IKDVIIEV  142



>gb|EEC68737.1| hypothetical protein OsI_37244 [Oryza sativa Indica Group]
Length=250

 Score =   199 bits (507),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 130/178 (73%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F+ Y+KPLLD 
Sbjct  5    HFVLVHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVRSFEQYDKPLLDL  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++++P +++VILVGH +GGLS+  A H+F  +I  AI++AATML  G  +++D KDG+P 
Sbjct  65   ISAIPEDEKVILVGHGSGGLSLIHAMHQFVDRIRQAIFVAATMLPFGLQTDEDKKDGLPT  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L +  EIN +    FG G D PPT+  +    QR+ L Q SP E+S LA ML+RP P+
Sbjct  125  LPE-NEINLI----FGTGADDPPTTAALRPEFQRERLSQQSPEEESVLASMLMRPWPV  177



>gb|EEE52649.1| hypothetical protein OsJ_35011 [Oryza sativa Japonica Group]
Length=250

 Score =   199 bits (507),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 130/178 (73%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F+ Y+KPLLD 
Sbjct  5    HFVLVHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVRSFEQYDKPLLDL  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++++P +++VILVGH +GGLS+  A H+F  +I  AI++AATML  G  +++D KDG+P 
Sbjct  65   ISAIPEDEKVILVGHGSGGLSLIHAMHQFVDRIRQAIFVAATMLPFGLQTDEDKKDGLPT  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L +  EIN +    FG G D PPT+  +    QR+ L Q SP E+S LA ML+RP P+
Sbjct  125  LPE-NEINLI----FGTGADDPPTTAALRPEFQRERLSQQSPEEESVLASMLMRPWPV  177



>ref|NP_001065998.2| Os12g0117200 [Oryza sativa Japonica Group]
 dbj|BAF29017.2| Os12g0117200 [Oryza sativa Japonica Group]
Length=252

 Score =   199 bits (507),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 130/178 (73%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F+ Y+KPLLD 
Sbjct  7    HFVLVHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVRSFEQYDKPLLDL  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++++P +++VILVGH +GGLS+  A H+F  +I  AI++AATML  G  +++D KDG+P 
Sbjct  67   ISAIPEDEKVILVGHGSGGLSLIHAMHQFVDRIRQAIFVAATMLPFGLQTDEDKKDGLPT  126

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L +  EIN +    FG G D PPT+  +    QR+ L Q SP E+S LA ML+RP P+
Sbjct  127  LPE-NEINLI----FGTGADDPPTTAALRPEFQRERLSQQSPEEESVLASMLMRPWPV  179



>gb|EEC67553.1| hypothetical protein OsI_34886 [Oryza sativa Indica Group]
 gb|EEE51535.1| hypothetical protein OsJ_32737 [Oryza sativa Japonica Group]
Length=250

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 130/178 (73%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F+ Y+KPLLD 
Sbjct  5    HFVLIHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVQSFEQYDKPLLDL  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++++P +++VILVGH +GGLS+  A H+F  +I  AI++AATML  G  +++D KDG+P 
Sbjct  65   ISAIPEDEKVILVGHGSGGLSLIHAMHQFVDRIRQAIFVAATMLPFGLQTDEDKKDGLPT  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L +  EIN +    FG G D PPT+  +    QR+ L Q SP E+S LA ML+RP P+
Sbjct  125  LPE-NEINLI----FGTGADDPPTTAALRPEFQRERLSQQSPEEESVLASMLMRPWPV  177



>gb|KDO67571.1| hypothetical protein CISIN_1g032072mg [Citrus sinensis]
Length=148

 Score =   195 bits (495),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +2

Query  35   EEKIREEVVAPPP--PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  208
            EE    E+  P     PHFVLVHG+ GGAWCWYK+RCLMENSGYKVSCI+L  +G DPSD
Sbjct  3    EEINMREIKKPAEVQKPHFVLVHGISGGAWCWYKVRCLMENSGYKVSCINLKGSGTDPSD  62

Query  209  ANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM  388
            AN I +FDDYNKPL+DF++SL  N++VILVGHSAGGLS+T A+HKF  KI LA+Y+AATM
Sbjct  63   ANSIHSFDDYNKPLMDFMSSLTDNEKVILVGHSAGGLSITQASHKFGNKIRLAVYLAATM  122

Query  389  LKTGFTSEQDIK  424
            LK GF +++D+K
Sbjct  123  LKLGFCTDEDVK  134



>ref|NP_001065594.1| Os11g0118000 [Oryza sativa Japonica Group]
 gb|ABA91260.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27439.1| Os11g0118000 [Oryza sativa Japonica Group]
Length=252

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 130/178 (73%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F+ Y+KPLLD 
Sbjct  7    HFVLIHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVQSFEQYDKPLLDL  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++++P +++VILVGH +GGLS+  A H+F  +I  AI++AATML  G  +++D KDG+P 
Sbjct  67   ISAIPEDEKVILVGHGSGGLSLIHAMHQFVDRIRQAIFVAATMLPFGLQTDEDKKDGLPT  126

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L +  EIN +    FG G D PPT+  +    QR+ L Q SP E+S LA ML+RP P+
Sbjct  127  LPE-NEINLI----FGTGADDPPTTAALRPEFQRERLSQQSPEEESVLASMLMRPWPV  179



>ref|XP_002448907.1| hypothetical protein SORBIDRAFT_05g001250 [Sorghum bicolor]
 gb|EES07895.1| hypothetical protein SORBIDRAFT_05g001250 [Sorghum bicolor]
Length=251

 Score =   197 bits (501),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 126/177 (71%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLR L+E +GY+V+CIDL+  GVDP+D N I +F  Y+KPL+D 
Sbjct  6    HFVLVHGEGHGAWCWFKLRWLLEGAGYRVTCIDLAGGGVDPTDPNTIRSFKQYDKPLIDL  65

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VILVGH AGGLSV  A H+F  +IS + ++AATML  GF +++D KDG+P 
Sbjct  66   ISTLPEGEKVILVGHGAGGLSVIHAMHEFVDRISQSFFVAATMLPFGFQADEDKKDGLPT  125

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L +    NE+ ++  G G D PPT+I +    QR  L Q SP E+S LA ML+RP P
Sbjct  126  LPE----NEI-ELTLGAGADDPPTTIALRLEFQRDRLSQQSPEEESVLASMLMRPWP  177



>ref|XP_006662681.1| PREDICTED: methylesterase 17-like [Oryza brachyantha]
Length=252

 Score =   197 bits (500),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 127/178 (71%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLR L+E+SGY+V+CIDL+  GVDP+D N + +F+ Y+KPLLD 
Sbjct  7    HFVLVHGEGHGAWCWFKLRWLLESSGYRVTCIDLAGGGVDPTDPNSVRSFEHYDKPLLDL  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++++P  ++VILVGH AGGLS+  A H+F  +I  AI++AATML  G  +++D KDG+P 
Sbjct  67   ISTMPEGEKVILVGHGAGGLSLIHAMHQFVDRIRQAIFVAATMLPFGLQTDEDKKDGLPT  126

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L +    NE+ ++ F  G D PPT+  +    QR  L Q SP E+S LA ML+RP P+
Sbjct  127  LPE----NEI-ELTFSAGVDDPPTTAALRPEFQRDRLSQQSPEEESVLASMLMRPWPV  179



>ref|XP_002520884.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41593.1| conserved hypothetical protein [Ricinus communis]
Length=228

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 114/179 (64%), Gaps = 50/179 (28%)
 Frame = +2

Query  77   PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLD  256
            PHFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL  AG+DP+DAN IL+FDDYNKPL+D
Sbjct  22   PHFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLRGAGIDPADANSILSFDDYNKPLMD  81

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            F++SLP N Q                                               G+P
Sbjct  82   FMSSLPDNHQ-----------------------------------------------GVP  94

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            DLS FG   +VY++G+G+G + PPTS +V K  QR I+YQMSP EDSTLA MLLRPGPI
Sbjct  95   DLSSFG---DVYEVGYGLGSEQPPTSAIVKKQFQRLIIYQMSPREDSTLASMLLRPGPI  150



>ref|XP_004977392.1| PREDICTED: methylesterase 17-like [Setaria italica]
Length=252

 Score =   196 bits (499),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 124/177 (70%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F  Y+KPL+D 
Sbjct  7    HFVLVHGEGHGAWCWFKLRWLLEGSGYRVTCIDLAGGGVDPTDPNTVWSFKQYDKPLIDL  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VILVGH AGGLSV  A H+F  +IS A ++AATML  GF +++D KDG+P 
Sbjct  67   ISTLPEGEKVILVGHGAGGLSVIHAMHEFVDRISQAFFVAATMLPFGFQTDEDKKDGLPS  126

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L +    NE+ ++      D PPTS+ +    QR  L Q SP E+S LA ML+RP P
Sbjct  127  LPE----NEI-ELTLSAAADDPPTSVALRPEFQRDRLSQQSPEEESVLASMLMRPWP  178



>ref|XP_008669934.1| PREDICTED: methylesterase 17-like isoform X1 [Zea mays]
Length=253

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 125/177 (71%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLR L+E +GY V+CIDL+  GVDP+D N I +F  Y+KPL+D 
Sbjct  8    HFVLVHGEGHGAWCWFKLRWLLEGAGYHVTCIDLAGGGVDPTDPNTIRSFQQYDKPLIDL  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VIL+GH AGGLSV  A H+F  +IS A ++AATML  GF +++D KDG+P 
Sbjct  68   ISTLPEGEKVILIGHGAGGLSVIHAMHEFVDRISQAFFVAATMLPFGFQADEDKKDGLPT  127

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L +    NE+ ++  G G D PPT+I +    QR  L Q SP E+S LA ML+RP P
Sbjct  128  LPE----NEI-ELTLGAGADDPPTTISLRPEFQRDRLSQQSPEEESVLASMLMRPWP  179



>gb|ABK21272.1| unknown [Picea sitchensis]
 gb|ABK21298.1| unknown [Picea sitchensis]
Length=263

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 133/178 (75%), Gaps = 6/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG G GAWCWYKL  L+ NSG+KV+ +DL+ +G++  D + + +F+DY+ PL+  
Sbjct  14   HFVLIHGAGHGAWCWYKLIHLLRNSGHKVTAMDLTGSGLNSVDPDSVTSFEDYDMPLMSI  73

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ +P +Q+V+LVGHSAGGLS++ A H F  KI++A+YIAATML  G  ++QDI+ G+PD
Sbjct  74   LSEIPYSQKVVLVGHSAGGLSLSHAIHVFGHKIAVAVYIAATMLSHGLCTDQDIQQGVPD  133

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L    +++E Y    G+G + PPTS ++ + LQ++ILYQ+SP ED+ LA +L+RP P+
Sbjct  134  LL---KVSEFYH---GLGSEQPPTSAMIHRELQQEILYQLSPPEDAALASLLIRPTPL  185



>ref|XP_004978521.1| PREDICTED: methylesterase 17-like [Setaria italica]
Length=252

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 124/177 (70%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F  Y+KPL+D 
Sbjct  7    HFVLVHGEGHGAWCWFKLRWLLEGSGYRVTCIDLAGGGVDPTDPNTVRSFKQYDKPLIDL  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            ++ LP  ++VILVGH AGGLSV  A H+F  +IS A ++AATML  GF +++D KDG+P 
Sbjct  67   ISILPEGEKVILVGHGAGGLSVIHALHEFVDRISQAFFVAATMLPFGFQTDEDKKDGLPT  126

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L +    NE+ ++ FG   D PP ++ +    QR  L Q SP E+S LA ML+RP P
Sbjct  127  LPE----NEI-ELTFGAAADDPPITVALRPEFQRDRLSQQSPEEESVLASMLMRPWP  178



>ref|XP_003577845.1| PREDICTED: methylesterase 17-like [Brachypodium distachyon]
Length=250

 Score =   194 bits (492),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 123/178 (69%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H VLVHG G G WCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F+ Y+KPLLD 
Sbjct  5    HLVLVHGEGHGGWCWFKLRWLLEGSGYRVTCIDLAGGGVDPTDPNTVRSFEQYDKPLLDL  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VIL+GH  GGLSV  A H+F  +I  AI++AA ML  G  +++D KDG+P 
Sbjct  65   ISALPEGEKVILIGHGIGGLSVIHAMHEFVDRIKEAIFVAAAMLPFGLQTDEDKKDGLPS  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            L +    NEV  + FG G D PPT++ +    QR  L Q SP EDS LA ML+RP P+
Sbjct  125  LPE----NEV-QLTFGAGADDPPTTVALRLEFQRDRLSQQSPEEDSILASMLMRPWPV  177



>gb|EMS56887.1| hypothetical protein TRIUR3_06889 [Triticum urartu]
Length=250

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 124/177 (70%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G G WCW+KLR L+E SGY+V+CIDL+ +GVDP+D N + +FD Y+KPLL  
Sbjct  5    HFVLVHGEGHGGWCWFKLRWLLEGSGYQVTCIDLAGSGVDPTDPNTVRSFDQYDKPLLRL  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VIL+GH +GGLSV  A H+F  +I  AI++AA ML  G  +++D KDG+P 
Sbjct  65   ISALPEGEKVILIGHGSGGLSVIHAMHEFVDRIKQAIFVAAAMLPFGLQTDEDKKDGLPS  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L +    NE  ++ FG G D PPT++ +    QR  L Q SP E+S LA ML+RP P
Sbjct  125  LPE----NET-ELTFGAGADDPPTTVALRLEFQRDRLSQQSPEEESILASMLMRPWP  176



>ref|NP_001152091.1| esterase PIR7A [Zea mays]
 gb|ACG45749.1| esterase PIR7A [Zea mays]
 gb|AFW64635.1| esterase PIR7A [Zea mays]
Length=253

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 124/177 (70%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLR L+E +G++V+C+DL+  GVDP+D N I +F  Y+KPL+D 
Sbjct  8    HFVLVHGEGHGAWCWFKLRWLLEGAGHRVTCVDLAGGGVDPTDPNTIRSFKQYDKPLIDL  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VIL+GH AGGLSV  A H+F  +I  A ++AATML  GF +++D  DG+P 
Sbjct  68   ISNLPDGEKVILIGHGAGGLSVIHAMHEFVDRIGQAFFVAATMLPFGFQADEDKNDGLPT  127

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L +    NE+ ++  G G D PPT+I +    QR  L Q SP E+S LA ML+RP P
Sbjct  128  LPE----NEI-ELTLGAGADDPPTTIALRPEFQRDRLSQQSPEEESVLASMLMRPWP  179



>ref|XP_006851246.1| hypothetical protein AMTR_s00180p00034130 [Amborella trichopoda]
 gb|ERN12827.1| hypothetical protein AMTR_s00180p00034130 [Amborella trichopoda]
Length=257

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 12/182 (7%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   HFVLVHG   GAWCWYK+  L+ N G+KVS +DL+ AG+DP DA+ I +F++YNKP
Sbjct  5    PGIQHFVLVHGACHGAWCWYKIVSLLRNKGHKVSAVDLAGAGIDPRDADSIFSFEEYNKP  64

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L+D ++++P +++VILVGHSAGGLS+  A H F +KISLAIY+ A M+  G  S  D K+
Sbjct  65   LIDLISTIPDDEKVILVGHSAGGLSLGYALHFFGKKISLAIYLTA-MVHKGLPS--DTKE  121

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
               DL +F         G+G+G D PPTSI+  +  QR+ LYQ+SP EDSTLA MLLRP 
Sbjct  122  RFGDLWEF---------GYGLGPDKPPTSIMFLREKQREALYQLSPDEDSTLASMLLRPW  172

Query  608  PI  613
            P+
Sbjct  173  PL  174



>gb|EMT23896.1| hypothetical protein F775_02537 [Aegilops tauschii]
Length=250

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 122/177 (69%), Gaps = 5/177 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H VLVHG G G WCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F+ Y+KPLL  
Sbjct  5    HLVLVHGEGHGGWCWFKLRWLLEGSGYQVTCIDLAGGGVDPTDPNTVRSFEQYDKPLLRL  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VIL+GH +GGLSV  A H+F  +I  AI++AA ML  G  +++D KDG+P 
Sbjct  65   ISALPEGEKVILIGHGSGGLSVIHAMHEFVDRIKQAIFVAAAMLPFGLQTDEDKKDGLPS  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L +    NE  ++ FG G D PPT++ +    QR  L Q SP E+S LA ML+RP P
Sbjct  125  LPE----NET-ELTFGAGADDPPTTVALRLEFQRDRLSQQSPEEESILASMLMRPWP  176



>gb|KDO60408.1| hypothetical protein CISIN_1g022603mg [Citrus sinensis]
Length=294

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 133/196 (68%), Gaps = 9/196 (5%)
 Frame = +2

Query  41   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  220
            KI+E+ +      HFV+VHG   GAWCW+K+R L+E SGYKV+C+DL+SAG+D +D N +
Sbjct  24   KIKEDKIHSSMMSHFVMVHGASHGAWCWFKVRALLETSGYKVTCLDLTSAGIDRTDPNTV  83

Query  221  LTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQ-KISLAIYIAATMLKT  397
             T ++YNKPL++ L +LP N++VILVGHS GGL+VTDA ++F   KI  A+Y+AA M   
Sbjct  84   FTLEEYNKPLINLLHNLPHNEKVILVGHSIGGLNVTDAINRFGYGKIHTAVYVAADMSD-  142

Query  398  GFTSEQDIKDGIPDLSDFGEIN-----EVYDIGFGMGQDGPPTSILVTKTLQRKILYQMS  562
                 +D+K   P   + G        +++++ + +G D  PTSI+V K  QR++ Y MS
Sbjct  143  --RRTEDVKVLFPASINQGAAQNGISPDMFELEYALGPDKFPTSIMVKKEYQRELYYHMS  200

Query  563  PLEDSTLAGMLLRPGP  610
            P+EDSTLA M+L+P P
Sbjct  201  PVEDSTLASMVLKPAP  216



>ref|XP_006443782.1| hypothetical protein CICLE_v10021442mg [Citrus clementina]
 ref|XP_006479484.1| PREDICTED: methylesterase 17-like [Citrus sinensis]
 gb|ESR57022.1| hypothetical protein CICLE_v10021442mg [Citrus clementina]
Length=294

 Score =   187 bits (476),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 132/196 (67%), Gaps = 9/196 (5%)
 Frame = +2

Query  41   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  220
            KI+E+ +      HFV+VHG   GAWCW+K+R L+E SGYKV+C+DL SAG+D +D N +
Sbjct  24   KIKEDKIHSSMMSHFVMVHGASHGAWCWFKVRALLETSGYKVTCLDLKSAGIDRTDPNTV  83

Query  221  LTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQ-KISLAIYIAATMLKT  397
             T ++YNKPL++ L +LP N++VILVGHS GGL+VTDA ++F   KI  A+Y+AA M   
Sbjct  84   FTLEEYNKPLINLLHNLPHNEKVILVGHSIGGLNVTDAINRFGYGKIHTAVYVAADM---  140

Query  398  GFTSEQDIKDGIPDLSDFGEIN-----EVYDIGFGMGQDGPPTSILVTKTLQRKILYQMS  562
                 +D+K   P   + G        +++++ + +G D  PTSI+V K  QR++ Y MS
Sbjct  141  SDRRTEDVKVLFPASINQGAAQNGISPDMFELEYALGPDKFPTSIMVKKEYQRELYYHMS  200

Query  563  PLEDSTLAGMLLRPGP  610
            P+EDSTLA M+L+P P
Sbjct  201  PVEDSTLASMVLKPAP  216



>ref|XP_006842541.1| hypothetical protein AMTR_s00077p00129560 [Amborella trichopoda]
 gb|ERN04216.1| hypothetical protein AMTR_s00077p00129560 [Amborella trichopoda]
Length=257

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 127/182 (70%), Gaps = 12/182 (7%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   HFVLVHG+  GAWCWYK+  L++NSG KV+ +DL  AG++P +A+ IL+F++YNKP
Sbjct  5    PATRHFVLVHGICHGAWCWYKIASLLKNSGVKVTAVDLGGAGINPGNADSILSFEEYNKP  64

Query  248  LLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD  427
            L+D + ++P +++V+LV HSAGGLS+  A H F +KISLA+Y+ A + K G  S+     
Sbjct  65   LIDLIPTIPEDEKVVLVAHSAGGLSLGYALHLFGKKISLAVYLTAVVHK-GLDSD-----  118

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
               D   FG   + ++ GFG+G D PPTS L  +  QR++LYQ+SP EDSTLA MLLR  
Sbjct  119  ---DKEQFG---DHWEFGFGLGPDKPPTSALFRRETQRELLYQLSPDEDSTLASMLLRSW  172

Query  608  PI  613
            P+
Sbjct  173  PL  174



>ref|XP_008669935.1| PREDICTED: methylesterase 17-like isoform X2 [Zea mays]
 tpg|DAA39314.1| TPA: hypothetical protein ZEAMMB73_815569 [Zea mays]
Length=179

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 116/167 (69%), Gaps = 5/167 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+KLR L+E +GY V+CIDL+  GVDP+D N I +F  Y+KPL+D 
Sbjct  8    HFVLVHGEGHGAWCWFKLRWLLEGAGYHVTCIDLAGGGVDPTDPNTIRSFQQYDKPLIDL  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +++LP  ++VIL+GH AGGLSV  A H+F  +IS A ++AATML  GF +++D KDG+P 
Sbjct  68   ISTLPEGEKVILIGHGAGGLSVIHAMHEFVDRISQAFFVAATMLPFGFQADEDKKDGLPT  127

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDST  580
            L +    NE+ ++  G G D PPT+I +    QR  L Q SP E S 
Sbjct  128  LPE----NEI-ELTLGAGADDPPTTISLRPEFQRDRLSQQSPEELSV  169



>ref|XP_010527076.1| PREDICTED: pheophorbidase isoform X1 [Tarenaya hassleriana]
Length=292

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 116/188 (62%), Gaps = 20/188 (11%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   G WCWYKL  L+E SG KV+ +DLS AG+  +D+N +   DDYN+PL  F
Sbjct  31   HFVLVHGASHGGWCWYKLITLLEKSGRKVTAVDLSGAGISLTDSNTVFESDDYNRPLFSF  90

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG----------FTS  409
            L++LPP  +VILVGHS GG SVT+A  KFP KIS+A+Y+AA M + G          F  
Sbjct  91   LSALPPLSKVILVGHSVGGGSVTEALCKFPDKISMAVYLAADMTRPGGTASTAAPYPFLE  150

Query  410  EQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAG  589
            +Q  KDG           E+++  +G G D PPT+I++ K   R+  Y  SPLED  LA 
Sbjct  151  DQRNKDG----------GEIWEYIYGEGADKPPTAIIMKKRYIRRFYYNQSPLEDVVLAS  200

Query  590  MLLRPGPI  613
             LLRP P 
Sbjct  201  KLLRPAPF  208



>ref|XP_010094434.1| hypothetical protein L484_018804 [Morus notabilis]
 gb|EXB56015.1| hypothetical protein L484_018804 [Morus notabilis]
Length=451

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 134/228 (59%), Gaps = 52/228 (23%)
 Frame = +2

Query  35   EEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDAN  214
            EEK ++++       HFVLVHG G G WCWYK+R L+E SG+KV+C+DL  +G+DP+D N
Sbjct  161  EEKAKQQL-------HFVLVHGAGHGGWCWYKIRTLLEASGHKVTCLDLKCSGIDPTDFN  213

Query  215  DILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLK  394
             + TF  YN+PL +F++S+PP Q+VILVGHSAGGL++TD  HKF +KI LA+Y+AA MLK
Sbjct  214  SVFTFAQYNEPLTNFMSSIPPGQKVILVGHSAGGLTITDVVHKFAEKIHLAVYVAAVMLK  273

Query  395  TGF--TSEQDIKDGIPDLSD-------------------------------FGEIN---E  466
             G+  + ++D KD   +++                                 GE+    +
Sbjct  274  HGYSISKDEDAKDTCLNIAHDVLRALAVMLVLDVMPMPLDQKNKAEHDQQIHGELRSGAD  333

Query  467  VYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
             Y+  +G+G D PPT +LV   L+RK         D  LA MLLRP P
Sbjct  334  DYEYIYGLGPDQPPTGVLVKPELRRK---------DYVLASMLLRPAP  372


 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 103/174 (59%), Gaps = 31/174 (18%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWY+LR L+E SG+KVS IDL S+G+DP++ + + TF +YN+PL+ F
Sbjct  11   HFVLVHGAGHGAWCWYRLRTLLEASGHKVSAIDLKSSGIDPTNFDAVFTFQEYNEPLITF  70

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGF----TSEQDIKD  427
            ++SLP ++                   KFP+K+ +A+YIAA M+K G+    T+ ++ K 
Sbjct  71   MSSLPSDE-------------------KFPEKVRVAVYIAANMMKNGYGFTKTTAKNFKS  111

Query  428  GIPDLSDF-----GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLED  574
                L+DF     G I ++      +G D  P  I+V    QR   Y MSP+E+
Sbjct  112  --LHLADFLKSLIGTIGDILKWEIVIGSDLLP-GIIVKPESQRLTYYHMSPVEE  162



>ref|XP_008245182.1| PREDICTED: methylesterase 17 [Prunus mume]
Length=240

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 110/177 (62%), Gaps = 48/177 (27%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VL+HG+G GAWCWYK+RCL+E SGYKV+C+DL  AG+D SD N ILTF DYNKPL++FL
Sbjct  33   LVLIHGIGHGAWCWYKIRCLLEASGYKVTCLDLKGAGIDQSDPNTILTFQDYNKPLINFL  92

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
            ++LP +++V+LVGHS GG+S+TDA H+F  KI +AIY+AATML+ GF++ QD KD     
Sbjct  93   SNLPLDEKVVLVGHSVGGMSLTDAIHRFANKIHMAIYVAATMLEHGFSTHQDFKD-----  147

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                                                       DSTLA MLLRPGP+
Sbjct  148  -------------------------------------------DSTLASMLLRPGPM  161



>ref|XP_010527079.1| PREDICTED: pheophorbidase isoform X3 [Tarenaya hassleriana]
Length=283

 Score =   177 bits (448),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   G WCWYKL  L+E SG KV+ +DLS AG+  +D+N +   DDYN+PL  F
Sbjct  31   HFVLVHGASHGGWCWYKLITLLEKSGRKVTAVDLSGAGISLTDSNTVFESDDYNRPLFSF  90

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTS-EQDIKDGIP  436
            L++LPP  +VILVGHS GG SVT+A  KFP KIS+A+Y+AA M   G     Q  KDG  
Sbjct  91   LSALPPLSKVILVGHSVGGGSVTEALCKFPDKISMAVYLAADMTPPGGCQPHQRNKDG--  148

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                     E+++  +G G D PPT+I++ K   R+  Y  SPLED  LA  LLRP P 
Sbjct  149  --------GEIWEYIYGEGADKPPTAIIMKKRYIRRFYYNQSPLEDVVLASKLLRPAPF  199



>emb|CAC82615.1| hypothetical protein [Capsella rubella]
Length=265

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 116/184 (63%), Gaps = 4/184 (2%)
 Frame = +2

Query  62   APPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYN  241
            A  P  HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +L  D YN
Sbjct  7    AEQPVIHFVFVHGASHGAWCWYKLTSLLETAGFKTTSVDLTGAGISVTDSNTVLESDQYN  66

Query  242  KPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDI  421
            +PL   L+ LPP+ +VILVGHS GG SVTDA  +F  KIS+AIY+AA+M+K G      +
Sbjct  67   RPLFSLLSDLPPSHKVILVGHSIGGGSVTDALCRFTDKISMAIYLAASMVKPGSVPSPHV  126

Query  422  KDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
             D   D  +      +++  +G G D PPT +++ +   R+  Y  SPLED +LA  LLR
Sbjct  127  SDMHADARE----ENIWEYTYGEGTDKPPTGVIMKQEFLRQYYYSQSPLEDVSLATKLLR  182

Query  602  PGPI  613
            P P+
Sbjct  183  PAPM  186



>ref|XP_006401106.1| hypothetical protein EUTSA_v10014415mg [Eutrema salsugineum]
 gb|ESQ42559.1| hypothetical protein EUTSA_v10014415mg [Eutrema salsugineum]
Length=263

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG+D +D N + + DDY++PL DF
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGIDQTDPNTVSSLDDYDQPLYDF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG SVT A  +FP K+S+A+Y+AA M+K G      +++ +  
Sbjct  65   LSQLPFDQKVILVSHSIGGGSVTAAMCRFPSKVSMAVYVAAAMVKPGALVPPSLREVMKI  124

Query  440  LSDFGE--INEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S   E    +++D  FG G   PPTS+++     R   Y  SP+ED TLA MLLRP P+
Sbjct  125  CSVVIEDVAEKIWDFTFGNGPQNPPTSMMMKPEYVRDKFYNESPMEDYTLATMLLRPAPV  184



>ref|XP_010434786.1| PREDICTED: probable pheophorbidase isoform X1 [Camelina sativa]
Length=265

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +   D YN+PL   
Sbjct  12   HFVFVHGASHGAWCWYKLITLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYNRPLYSL  71

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LPP+ +VILVGHS GG SVTDA  KF  KIS+AIY+AA+M++ G T        +  
Sbjct  72   LSGLPPSHKVILVGHSIGGGSVTDALCKFTNKISMAIYLAASMVRPGSTPSPQPSSNMH-  130

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D GE N +++  +G G+D  PT +++ +   R+  Y  SPLED TLA  LLRP P+
Sbjct  131  -ADVGEEN-IWEFTYGEGKDKSPTGVIMKQQFIRQYYYNQSPLEDVTLASKLLRPAPV  186



>ref|XP_010449732.1| PREDICTED: probable pheophorbidase [Camelina sativa]
Length=265

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 118/183 (64%), Gaps = 7/183 (4%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +   D YN+PL
Sbjct  9    PVIHFVFVHGASHGAWCWYKLTTLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L++LPP+ +VILVGHS GG SVTDA  KF  KIS+AIY+AA+M++ G T        
Sbjct  69   YSLLSALPPSHKVILVGHSIGGGSVTDALCKFTNKISMAIYLAASMVRPGSTPSPQ----  124

Query  431  IPDLSDFGEINE--VYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
             P  +  G++ E  +++  +G G+D  PT +++ +   R+  Y  SPLED TLA  LLRP
Sbjct  125  -PSSNLHGDVGEETIWEFTYGEGKDKSPTGVIMKQQFIRQYYYNQSPLEDVTLASKLLRP  183

Query  605  GPI  613
             P+
Sbjct  184  APV  186



>ref|XP_002868108.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44367.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=262

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 118/183 (64%), Gaps = 10/183 (5%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   GAWCWYKL  L++ +G+K S +DL+ AG+  +D+N ++  D YN+PL
Sbjct  9    PVIHFVFVHGASHGAWCWYKLTTLLDAAGFKSSSVDLTGAGISLTDSNTVMDSDQYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L+ LPP+ +VILVGHS GG SVT+A  KF  KIS+AIY+AA M++ G          
Sbjct  69   FTLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAAAMVQPGSIPS------  122

Query  431  IPDLSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
             P+LS+   GE  E++D  +G G D PPT IL+ +  +R   Y  SPLED TL+  LLRP
Sbjct  123  -PNLSNLHVGE-EEIWDYIYGEGADKPPTGILMKQEFRRHYYYSQSPLEDVTLSSKLLRP  180

Query  605  GPI  613
             P+
Sbjct  181  APV  183



>ref|XP_002866256.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42515.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=263

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 114/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   +  +G+K +CIDL +AG++P+D N + + DDY++PL  F
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKAAGINPTDPNTVSSLDDYDEPLYAF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A   FP K+SLA+Y+AA M+K G    + +K+ +  
Sbjct  65   LSQLPIDQKVILVSHSVGGGSMTAAMCLFPSKVSLAVYVAAAMVKPGTLIPERLKNVMKI  124

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G   PPT I++     R   Y  SP+ED TLA  LLRP P+
Sbjct  125  CSGLIEEETEKIWDFSFGNGPQNPPTGIMMKPEYVRDKFYNESPMEDYTLATTLLRPAPV  184



>ref|XP_010434787.1| PREDICTED: probable pheophorbidase isoform X2 [Camelina sativa]
Length=265

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 114/178 (64%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +   D YN+PL   
Sbjct  12   HFVFVHGASHGAWCWYKLITLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYNRPLYSL  71

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LPP+ +VILVGHS GG SVTDA  KF  KIS+AIY+AA+M++ G T        +  
Sbjct  72   LSGLPPSHKVILVGHSIGGGSVTDALCKFTNKISMAIYLAASMVRPGSTPSPQPSSNVSQ  131

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                GE N +++  +G G+D  PT +++ +   R+  Y  SPLED TLA  LLRP P+
Sbjct  132  Y--VGEEN-IWEFTYGEGKDKSPTGVIMKQQFIRQYYYNQSPLEDVTLASKLLRPAPV  186



>gb|KDO60409.1| hypothetical protein CISIN_1g022603mg [Citrus sinensis]
Length=206

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 122/183 (67%), Gaps = 9/183 (5%)
 Frame = +2

Query  41   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  220
            KI+E+ +      HFV+VHG   GAWCW+K+R L+E SGYKV+C+DL+SAG+D +D N +
Sbjct  24   KIKEDKIHSSMMSHFVMVHGASHGAWCWFKVRALLETSGYKVTCLDLTSAGIDRTDPNTV  83

Query  221  LTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQ-KISLAIYIAATMLKT  397
             T ++YNKPL++ L +LP N++VILVGHS GGL+VTDA ++F   KI  A+Y+AA M   
Sbjct  84   FTLEEYNKPLINLLHNLPHNEKVILVGHSIGGLNVTDAINRFGYGKIHTAVYVAADMSD-  142

Query  398  GFTSEQDIKDGIPDLSDFGEIN-----EVYDIGFGMGQDGPPTSILVTKTLQRKILYQMS  562
                 +D+K   P   + G        +++++ + +G D  PTSI+V K  QR++ Y MS
Sbjct  143  --RRTEDVKVLFPASINQGAAQNGISPDMFELEYALGPDKFPTSIMVKKEYQRELYYHMS  200

Query  563  PLE  571
            P+E
Sbjct  201  PVE  203



>ref|XP_006284340.1| hypothetical protein CARUB_v10005512mg [Capsella rubella]
 gb|EOA17238.1| hypothetical protein CARUB_v10005512mg [Capsella rubella]
Length=265

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 114/184 (62%), Gaps = 4/184 (2%)
 Frame = +2

Query  62   APPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYN  241
            A  P  HFV V G   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +   D YN
Sbjct  7    AEQPVIHFVFVRGASHGAWCWYKLTSLLETAGFKTTSVDLTGAGISVTDSNTVFDSDQYN  66

Query  242  KPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDI  421
            +PL   L+ LPP+ +VILVGHS GG SVTDA  KF  KIS+AIY+AA+M++ G      +
Sbjct  67   RPLFSLLSDLPPSHKVILVGHSMGGGSVTDALCKFTDKISMAIYLAASMVRPGSVPSPHV  126

Query  422  KDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
             D   D  +      +++  +G G D PPT +++ +   R+  Y  SPLED +LA  LLR
Sbjct  127  SDMHADARE----ENIWEYTYGEGTDKPPTGVIMKQEFLRQYYYSQSPLEDVSLATKLLR  182

Query  602  PGPI  613
            P P+
Sbjct  183  PAPM  186



>ref|NP_200639.1| methyl esterase 18 [Arabidopsis thaliana]
 sp|Q9LVL9.1|MES18_ARATH RecName: Full=Methylesterase 18; Short=AtMES18 [Arabidopsis thaliana]
 dbj|BAA96922.1| polyneuridine aldehyde esterase-like protein [Arabidopsis thaliana]
 gb|AAM61536.1| polyneuridine aldehyde esterase-like [Arabidopsis thaliana]
 gb|AAO42166.1| putative polyneuridine aldehyde esterase [Arabidopsis thaliana]
 gb|AAO64092.1| putative polyneuridine aldehyde esterase [Arabidopsis thaliana]
 gb|AED97032.1| methyl esterase 18 [Arabidopsis thaliana]
Length=263

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 114/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   + ++G+K +CIDL  AG++P+D N + + DDY++PL  F
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRDNGHKATCIDLKGAGINPTDPNTVSSLDDYDEPLYAF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A   FP K+SLA+Y+AA M+K G    + +K+ +  
Sbjct  65   LSQLPNDQKVILVSHSVGGGSMTAAMCLFPSKVSLAVYVAAAMVKPGTLIPERLKNVMKI  124

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G    PTSI++     R   Y  SP+ED TLA  LLRP P+
Sbjct  125  CSGLIEEETEKIWDFTFGNGPQNLPTSIMMKPEYVRDKFYNESPMEDYTLATTLLRPAPV  184



>ref|XP_009145604.1| PREDICTED: pheophorbidase [Brassica rapa]
Length=263

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 6/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYKL  L+  +G+K + +DL+ AG++ +D+N ++ FD YN+PL   
Sbjct  13   HFVLVHGASHGAWCWYKLTTLLAAAGFKATSVDLTGAGINLTDSNTVVDFDQYNRPLFSL  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LPP+ ++ILVGHS GG SVT+A  KF  KIS+ +Y+AA M++ G TS          
Sbjct  73   LSDLPPHHKIILVGHSIGGGSVTEALCKFTDKISMVVYLAADMVQPGSTSSPH-----DS  127

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                GE  +++++ +G G D PPT +L+ +  +R   Y  SPLED TLA  LLRP P+
Sbjct  128  AMTVGE-EDIWELIYGEGADKPPTGMLMKEEFRRHYYYSQSPLEDVTLACKLLRPAPL  184



>emb|CDY53646.1| BnaA08g30360D [Brassica napus]
Length=262

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWY+L  L+ ++G+K + +DL+SAG++ +DAN +  FD YN+PL   
Sbjct  12   HFVLVHGACHGAWCWYRLTTLLLSAGFKATTVDLTSAGINLTDANTVFEFDHYNRPLFSL  71

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ +P + ++ILVGHS GG SVT A  KF  KIS+A+Y+ A M++ G TS          
Sbjct  72   LSDIPHHHKIILVGHSIGGASVTAALCKFSDKISMAVYLVADMVQPGTTSPPH------S  125

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            +   GE  ++++  +G G D PPTS  + +  +R   Y  SPLED  LA  LLRP P+
Sbjct  126  IMSVGEEEDIWEFTYGEGDDKPPTSAQMKEEYRRHYFYSQSPLEDVILASKLLRPSPV  183



>emb|CDY40511.1| BnaC01g20010D [Brassica napus]
Length=263

 Score =   168 bits (426),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 117/179 (65%), Gaps = 8/179 (4%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG   GAWCWYKL  L++ +G+K + +DL+ AG++ +D+N ++ F+ YN+PL   
Sbjct  13   HFVFVHGASHGAWCWYKLTTLLDAAGFKATSVDLTGAGINLTDSNTVVDFEHYNRPLFSL  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSE-QDIKDGIP  436
            L+ LPP+ ++ILVGHS GG SVT+A  KF  KIS+ +Y+AA M++ G TS   D    + 
Sbjct  73   LSDLPPHHKIILVGHSIGGGSVTEALCKFTDKISMVVYLAADMVQPGSTSSPHDSTMAV-  131

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                 GE  ++++  +G G D PPT +L+ +  +R   Y  SPLED TLA  LLRP P+
Sbjct  132  -----GE-EDIWEFTYGEGDDKPPTGMLMKEEFRRHYYYSQSPLEDPTLACKLLRPAPL  184



>gb|KJB20515.1| hypothetical protein B456_003G152800 [Gossypium raimondii]
Length=126

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV+VH  G GAWCWYK+R L+E SGYKVSCIDL  +G+DPSD N I +F DYNKPL+D 
Sbjct  9    HFVVVHVFGHGAWCWYKIRSLLEASGYKVSCIDLKGSGMDPSDPNTIFSFQDYNKPLIDL  68

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG  400
            L++LP N++VILVGHSAGG+S+T A H+F +KI +AIY+AATMLK G
Sbjct  69   LSNLPHNEKVILVGHSAGGMSLTYAIHRFSKKIRMAIYVAATMLKHG  115



>ref|XP_002870859.1| hypothetical protein ARALYDRAFT_356177 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47118.1| hypothetical protein ARALYDRAFT_356177 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 111/181 (61%), Gaps = 6/181 (3%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   GAWCWYK+  L++ +G+K S +DL+ AG+  +D+N +   D YN+PL
Sbjct  10   PIIHFVFVHGASHGAWCWYKIITLLDAAGFKSSTVDLTGAGISLTDSNTVFHSDQYNRPL  69

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L+ LPP  +VILVGHS GG SVT+A  KF  KIS+AIYI A+M+K G  S  D+   
Sbjct  70   FSLLSDLPPFHKVILVGHSIGGASVTEALCKFTDKISMAIYITASMVKPGSISSPDL---  126

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
               L+      E+ D  FG G D PPT  ++ +  +    Y  SPLED TL+  LLRP P
Sbjct  127  ---LNKLEGYEEICDYTFGEGTDKPPTGFIIKEEFRCHYYYNQSPLEDITLSSKLLRPAP  183

Query  611  I  613
            +
Sbjct  184  M  184



>emb|CDY71711.1| BnaAnng38540D [Brassica napus]
Length=263

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 115/178 (65%), Gaps = 6/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG   GAWCWYKL  L+  +G+K + +DL+ AG++ +D+N ++ FD YN+PL   
Sbjct  13   HFVFVHGASHGAWCWYKLTTLLAAAGFKATSVDLTGAGINLTDSNTVVDFDQYNRPLFSL  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LPP+ ++ILVGHS GG SVT+A  KF  KIS+ +Y+AA M++ G TS          
Sbjct  73   LSDLPPHHKIILVGHSIGGGSVTEALCKFTDKISMVVYLAADMVQPGSTSSPH-----DS  127

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                GE  +++++ +G G D PPT +L+ +  +R   Y  SPLED TLA  LLRP P+
Sbjct  128  AMTVGE-EDIWELIYGEGADKPPTGMLMKEEFRRHYYYSQSPLEDVTLACKLLRPAPL  184



>ref|XP_006279686.1| hypothetical protein CARUB_v10027010mg [Capsella rubella]
 gb|EOA12584.1| hypothetical protein CARUB_v10027010mg [Capsella rubella]
Length=245

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 112/180 (62%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AGV+ +D N + + DDY++PL  F
Sbjct  13   HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGVNSTDPNTVSSLDDYDEPLYAF  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A   FP K+SLA+Y+AA M+K G     ++K+ +  
Sbjct  73   LSQLPNDQKVILVSHSVGGGSMTAAMCLFPSKVSLAVYVAAAMVKPGSLIPDNLKNVMKI  132

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G    PTSI++     R   Y  SP+ED TLA  LLRP P+
Sbjct  133  CSGLIEKETEKIWDFTFGNGPQNLPTSIMMKPEYVRDKFYNESPMEDYTLATTLLRPAPV  192



>emb|CDY50844.1| BnaC08g47900D [Brassica napus]
Length=263

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 114/182 (63%), Gaps = 7/182 (4%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFVLVHG   GAWCWYKL  L+ + G+K + +DL+SAG++ +DAN +  FD YN+PL
Sbjct  9    PIIHFVLVHGASHGAWCWYKLTTLLVSDGFKATTVDLTSAGINLTDANTVFEFDHYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L+ +P + ++ILVGHS GG SVT+A  KF  KIS+A+Y+ A M++ G TS       
Sbjct  69   FSLLSDIPHHYKIILVGHSIGGASVTEALCKFTDKISMAVYLVADMVQPGSTSSPH----  124

Query  431  IPDLSDFGEINE-VYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
               +   GE  E +++  +G G D PPTS  + +  +R   Y  SPLED  LA  LLRP 
Sbjct  125  --SIMYVGEEEENIWEFTYGEGTDKPPTSAQMKEEYRRHYFYSQSPLEDVILASKLLRPC  182

Query  608  PI  613
            P+
Sbjct  183  PV  184



>sp|Q2V0W1.1|PPD_RAPSA RecName: Full=Pheophorbidase; Short=RsPPD [Raphanus sativus]
 dbj|BAE54383.1| pheophorbidase [Raphanus sativus]
Length=263

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 114/178 (64%), Gaps = 6/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG   GAWCWYKL  L+  +G+K + +DL+ AG++ +D+N +  FD YN+PL   
Sbjct  13   HFVFVHGASHGAWCWYKLTTLLVAAGFKATSVDLTGAGINLTDSNTVFDFDHYNRPLFSL  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP + +++LVGHS GG SVT+A  KF  KIS+ +Y+AA M++ G TS     D I  
Sbjct  73   LSDLPSHHKIVLVGHSIGGGSVTEALCKFTDKISMVVYLAADMVQPGSTSST--HDSIMT  130

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            + +     ++++  +G G D PPT +L+ +  +R   Y  SPLED +LA  LLRP P+
Sbjct  131  VGE----EDIWEYIYGEGADKPPTGVLMKEEFRRHYYYSQSPLEDVSLASKLLRPAPV  184



>ref|XP_010483409.1| PREDICTED: methylesterase 18-like [Camelina sativa]
Length=271

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + + DDY++PL  F
Sbjct  13   HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINQTDPNTVTSLDDYDEPLYAF  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A   FP K+SLA+Y+AA M+K G      +K+ +  
Sbjct  73   LSQLPIDQKVILVSHSVGGGSMTAAMCLFPSKVSLAVYVAAVMVKPGALIPDSLKNVMKV  132

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G    PTSI++     R   Y  SP+ED TLA  LLRP P+
Sbjct  133  CSGLIEKEAEKIWDFTFGNGPQNIPTSIMMKPEYVRDKFYNESPMEDYTLATTLLRPAPV  192



>emb|CDY32712.1| BnaA02g07740D [Brassica napus]
Length=263

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + + DDYN+PL DF
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINLTDPNTVSSLDDYNQPLYDF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A  ++P K+S+A+Y+AA M+K G      +K+ +  
Sbjct  65   LSQLPLDQKVILVSHSVGGGSMTAAMCQYPSKVSMAVYVAAAMVKPGTIIPPILKEVLKI  124

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G    PTS+++     R   Y  SP+ED TLA  LLRP P+
Sbjct  125  CSGMIETEAEKIWDFTFGNGPGNLPTSMMMKPEYVRDKYYNESPMEDYTLATTLLRPAPV  184



>ref|XP_010453481.1| PREDICTED: methylesterase 18 [Camelina sativa]
Length=269

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + + DDY++PL  F
Sbjct  11   HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINQTDPNTVTSLDDYDEPLYAF  70

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A   FP K+SLA+Y+AA M+K G      +K+ +  
Sbjct  71   LSQLPIDQKVILVSHSVGGGSMTAAMCLFPSKVSLAVYVAAAMVKPGALIPDSLKNVMKI  130

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G    PTSI++     R   Y  SP+ED TLA  LLRP P+
Sbjct  131  CSGLIEKEAEKIWDFTFGNGPQNIPTSIIMKPEYVRDKFYNESPMEDYTLATTLLRPAPV  190



>ref|XP_009126767.1| PREDICTED: methylesterase 18 [Brassica rapa]
Length=264

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HF  VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + + DDYN+PL DF
Sbjct  6    HFAFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINLTDPNTVSSLDDYNQPLYDF  65

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A  ++P K+S+A+Y+AA M+K G      +K+ +  
Sbjct  66   LSQLPLDQKVILVSHSVGGGSMTAAMCQYPSKVSMAVYVAAAMVKPGTIIPPILKEVLKI  125

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G +  PTS+++     R   Y  SP+ED TLA  LLRP P+
Sbjct  126  CSGMIETEAEKIWDFTFGNGPENLPTSMMMKPEYVRDKYYNESPMEDYTLATTLLRPAPV  185



>ref|NP_001147011.1| esterase PIR7B [Zea mays]
 gb|ACG25055.1| esterase PIR7B [Zea mays]
Length=264

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HF  VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + + DDYN+PL DF
Sbjct  6    HFAFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINLTDPNTVSSLDDYNQPLYDF  65

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A  ++P K+S+A+Y+AA M+K G      +K+ +  
Sbjct  66   LSQLPLDQKVILVSHSVGGGSMTAAMCQYPSKVSMAVYVAAAMVKPGTIIPPILKEVLKI  125

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G +  PTS+++     R   Y  SP+ED TLA  LLRP P+
Sbjct  126  CSGMIETEAEKIWDFTFGNGPENLPTSMMMKPEYVRDKYYNESPMEDYTLATTLLRPAPV  185



>emb|CDY60708.1| BnaC07g50080D [Brassica napus]
Length=261

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 114/181 (63%), Gaps = 7/181 (4%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   G WCWYKL  L+  +G+K + +DL+ AG++ +D+N +  FD YN+PL
Sbjct  9    PIIHFVFVHGACHGGWCWYKLITLLLAAGFKATSVDLTGAGINLTDSNTVFDFDHYNQPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L+ +PP+ ++ILVGHS GG +VT+A  KF  KIS+ IY+AA M++ G TS  +    
Sbjct  69   FSLLSEIPPHHKIILVGHSIGGGTVTEALCKFTDKISMVIYLAAEMVQPGTTSPNNSNMT  128

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            +      GE  ++++  +G G D PPT +L+ +   R   Y  SP+ED TLA  LLRP P
Sbjct  129  V------GE-EDIWEFTYGEGADKPPTGVLMKEEFIRHYYYSQSPIEDVTLASKLLRPAP  181

Query  611  I  613
            I
Sbjct  182  I  182



>ref|XP_010443550.1| PREDICTED: methylesterase 18-like [Camelina sativa]
Length=275

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + + D+Y++PL  F
Sbjct  17   HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINQTDPNTVTSLDEYDEPLYAF  76

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS GG S+T A   FP K+SLA+Y+AA M+K G      +K+ +  
Sbjct  77   LSQLPIDQKVILVSHSVGGGSMTAAMCLFPSKVSLAVYVAAAMVKPGALIPDSLKNVMKI  136

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G    PTSI++     R   Y  SP+ED TLA  LLRP P+
Sbjct  137  CSGLIEKEAEKIWDFTFGNGPQNIPTSIMMKPEYVRDKFYNESPMEDYTLATTLLRPAPV  196



>ref|XP_006842540.1| hypothetical protein AMTR_s00077p00129020 [Amborella trichopoda]
 gb|ERN04215.1| hypothetical protein AMTR_s00077p00129020 [Amborella trichopoda]
Length=255

 Score =   163 bits (412),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 119/187 (64%), Gaps = 14/187 (7%)
 Frame = +2

Query  56   VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDD  235
            +V  P   HFVL+HG   GAWCWYK+  L++++GYKVS +DL  AG++  +A+ I TF++
Sbjct  1    MVETPATKHFVLIHGACHGAWCWYKMASLLKSAGYKVSAVDLGGAGINMGNADSISTFEE  60

Query  236  YNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKF-PQKISLAIYIAATMLKTGFTSE  412
            YN+P +D ++ +P N++VILVGHS GG S+T A +KF  +KISL +Y+AA        + 
Sbjct  61   YNRPAIDIISGIPENEKVILVGHSIGGFSLTHAIYKFGKKKISLVVYVAA--------AP  112

Query  413  QDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGM  592
             + +   P  +      ++Y   FG G   PPTS++     QR++LY +S  EDSTLA M
Sbjct  113  ANFRGSGPGFNP-----DIYIYNFGNGSHQPPTSLIFRPEKQREMLYALSSYEDSTLASM  167

Query  593  LLRPGPI  613
            ++R  P+
Sbjct  168  VMRWAPV  174



>ref|NP_193402.1| methyl esterase 16 [Arabidopsis thaliana]
 sp|O23512.1|PPD_ARATH RecName: Full=Probable pheophorbidase; Short=AtPPD; AltName: 
Full=FCC methylesterase; AltName: Full=Methylesterase 16; Short=AtMES16 
[Arabidopsis thaliana]
 emb|CAB10444.1| cyanohydrin lyase like protein [Arabidopsis thaliana]
 emb|CAB78711.1| cyanohydrin lyase like protein [Arabidopsis thaliana]
 gb|AAM65855.1| cyanohydrin lyase like protein [Arabidopsis thaliana]
 gb|AEE83784.1| methyl esterase 16 [Arabidopsis thaliana]
Length=262

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 114/183 (62%), Gaps = 10/183 (5%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   GAWCWYKL  L++ +G+K + +DL+ AG+   D+N +   D YN+PL
Sbjct  9    PVIHFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGISLIDSNIVFDSDQYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L+ LPP+ +VILVGHS GG SVT+A  KF  KIS+AIY+AA+M++ G          
Sbjct  69   FSLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAASMVQPGSIPS------  122

Query  431  IPDLSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
             P LS+   GE  ++++  +G G D PPT +L+     R   Y  SPLED TL+  LLRP
Sbjct  123  -PHLSNIHVGE-EDIWEYTYGEGTDKPPTGVLMKPEFIRHYYYSQSPLEDVTLSSKLLRP  180

Query  605  GPI  613
             P+
Sbjct  181  APM  183



>ref|XP_006414315.1| hypothetical protein EUTSA_v10026004mg [Eutrema salsugineum]
 gb|ESQ55768.1| hypothetical protein EUTSA_v10026004mg [Eutrema salsugineum]
Length=263

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG   GAWCWYKL  L++ +G+K + +DL+ AG++ +D+N +   D YN+PL   
Sbjct  13   HFVFVHGASHGAWCWYKLITLLDAAGFKSTTVDLTGAGINLTDSNSVFDPDHYNRPLFSL  72

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP + +V+LVGHS GG +VT+A  KFP +IS+A+Y+AA M++ G +S          
Sbjct  73   LSDLPAHHKVVLVGHSMGGGTVTEALCKFPGRISMAVYVAADMIQPGSSSSPHSS-----  127

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
               FGE  E+++  +G G D  PT + + K   R+  Y  SPLED TLA  LLRP P+
Sbjct  128  SKRFGE-EEIWEYTYGEGADESPTGVSMKKQFIRQYYYSQSPLEDVTLASKLLRPAPV  184



>ref|XP_010440115.1| PREDICTED: probable pheophorbidase isoform X2 [Camelina sativa]
Length=189

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 110/170 (65%), Gaps = 3/170 (2%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +   D YN+PL
Sbjct  9    PVIHFVFVHGASHGAWCWYKLTTLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L++LPP+ +VILVGHS GG SVTDA  KF  KIS+AIY+AA+M++ G T    +   
Sbjct  69   YSLLSALPPSHKVILVGHSIGGGSVTDALCKFTNKISMAIYLAASMVRPGSTPSPHLSSN  128

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDST  580
            +   +D GE  E+++  +G G+D  PT +++ +   R+  Y  SPLE  T
Sbjct  129  MH--ADAGE-EEIWEFTYGEGKDKSPTGVIMKQQFIRQYYYNQSPLELKT  175



>ref|XP_010440114.1| PREDICTED: probable pheophorbidase isoform X1 [Camelina sativa]
Length=191

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 109/167 (65%), Gaps = 3/167 (2%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +   D YN+PL
Sbjct  9    PVIHFVFVHGASHGAWCWYKLTTLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L++LPP+ +VILVGHS GG SVTDA  KF  KIS+AIY+AA+M++ G T    +   
Sbjct  69   YSLLSALPPSHKVILVGHSIGGGSVTDALCKFTNKISMAIYLAASMVRPGSTPSPHLSSN  128

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLE  571
            +   +D GE  E+++  +G G+D  PT +++ +   R+  Y  SPLE
Sbjct  129  MH--ADAGE-EEIWEFTYGEGKDKSPTGVIMKQQFIRQYYYNQSPLE  172



>emb|CDY02809.1| BnaC02g10800D [Brassica napus]
Length=259

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 112/180 (62%), Gaps = 2/180 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG G G WCWYK+   +  +G+K +CIDL  AG++ +D N + + DDYN+PL DF
Sbjct  5    HFVFVHGAGHGGWCWYKIANSLRENGHKATCIDLKGAGINLTDPNTVSSLDDYNQPLNDF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LP +Q+VILV HS  G S+T A  ++P K+S+A+Y+AA M+K G      +K+ +  
Sbjct  65   LSQLPLDQKVILVSHSVRGGSMTAAMCQYPSKVSMAVYVAAAMVKPGTIIPPILKEVLKI  124

Query  440  LSDF--GEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             S     E  +++D  FG G    PT++++     R   Y  SP+ED TLA  LLRP PI
Sbjct  125  CSGMIETEAEKIWDFTFGNGPCNLPTTMMMKPEYVRDKYYNESPMEDYTLATTLLRPAPI  184



>gb|ABK26618.1| unknown [Picea sitchensis]
Length=276

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+E  G+KVS IDL SAG +P  A+ I++F++YN+PL+ F
Sbjct  24   HFVLVHGAMHGAWCWYKIVELLEKDGHKVSAIDLMSAGTNPVAADSIMSFEEYNQPLMHF  83

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            LA LP  ++++LVGHS GG+S+   +  FP  I++A+Y+ A M + G + +++ +   PD
Sbjct  84   LAKLPVTEKIVLVGHSMGGVSLARESEDFPHLIAVAVYVCALMFRGGESMQREKEIMEPD  143

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILV-TKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
                 +I   Y+ G  +G+  PPTS+LV  K  Q+  LY  +   D+TLA +LLRP P
Sbjct  144  KHILEKIE--YNFGNSIGE--PPTSVLVPKKRFQKDYLYGTTSTLDATLASLLLRPLP  197



>ref|XP_002967870.1| hypothetical protein SELMODRAFT_88885 [Selaginella moellendorffii]
 gb|EFJ31217.1| hypothetical protein SELMODRAFT_88885 [Selaginella moellendorffii]
Length=256

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 113/186 (61%), Gaps = 17/186 (9%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            P HFVLVHG   GAWCWYK+  L++ SG+KV+ +DLSS G    DA  + +F +Y +PL+
Sbjct  4    PCHFVLVHGGSHGAWCWYKIVNLLQASGHKVTALDLSSCGTHTRDAETVTSFAEYTQPLI  63

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGF-TSEQDIK--  424
            DFL+ +    +V+LVGHS GG+SV  A+ +FP+K+++++YIAA M   G  T E +I   
Sbjct  64   DFLSKV--QDKVVLVGHSLGGVSVVHASEQFPEKVAVSVYIAAAMFPVGLQTQEAEINLV  121

Query  425  ---DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGML  595
               +  PD   F          F  G +  PT+++V K   R+  Y +SP ED  LA +L
Sbjct  122  RATESFPDKMHF---------TFANGVENGPTTVMVRKDFVREAFYHLSPAEDVALASIL  172

Query  596  LRPGPI  613
            LRP PI
Sbjct  173  LRPSPI  178



>ref|XP_010533979.1| PREDICTED: methylesterase 18 isoform X1 [Tarenaya hassleriana]
Length=270

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 112/175 (64%), Gaps = 8/175 (5%)
 Frame = +2

Query  98   GLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFLASLPP  277
            G G GAWCWYKL+  +  +G+K +CIDL  AG++ +D N I + ++YNKPLLDFL+ LP 
Sbjct  22   GAGHGAWCWYKLKNKLCENGHKATCIDLKGAGINLADPNTISSLEEYNKPLLDFLSELPG  81

Query  278  NQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGF---TSEQDIKDGIPDLSD  448
            N++VILV HS GG S T A   FP +IS+++Y+AA M+K G     + Q+   G+ +   
Sbjct  82   NEKVILVSHSIGGGSATAAMCSFPHRISMSVYVAAAMVKPGSPVPPTVQNFHQGVQN---  138

Query  449  FGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              E    ++  +G G+D PPTS+++     R+  Y  SP+ED TLA  LLRP PI
Sbjct  139  --EHESKWEYIYGNGKDKPPTSMMMKPEYIRQTYYNQSPMEDYTLATTLLRPSPI  191



>ref|XP_002981647.1| hypothetical protein SELMODRAFT_114920 [Selaginella moellendorffii]
 gb|EFJ17129.1| hypothetical protein SELMODRAFT_114920 [Selaginella moellendorffii]
Length=256

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 113/186 (61%), Gaps = 17/186 (9%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            P HFVLVHG   GAWCWYK+  L++ SG+KV+ +DLSS G    DA  + +F +Y +PL+
Sbjct  4    PCHFVLVHGGSHGAWCWYKIVNLLQASGHKVTALDLSSCGTHTRDAETVTSFAEYTQPLI  63

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGF-TSEQDIK--  424
            DFL+ +    +V+LVGHS GG+SV  A+ +FP+K+++++YIAA M   G  T E +I   
Sbjct  64   DFLSKV--QDKVVLVGHSLGGVSVVHASEQFPEKVAVSVYIAAAMFPVGLQTQEAEINLV  121

Query  425  ---DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGML  595
               +  PD   F          F  G +  PT+++V K   R+  Y +SP ED  LA +L
Sbjct  122  RATESFPDKMHF---------TFANGVENGPTTVMVRKDFVREAFYHLSPAEDVALASIL  172

Query  596  LRPGPI  613
            LRP PI
Sbjct  173  LRPSPI  178



>gb|KFK27361.1| hypothetical protein AALP_AA8G372900 [Arabis alpina]
Length=276

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 115/191 (60%), Gaps = 2/191 (1%)
 Frame = +2

Query  44   IREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDIL  223
            + EE +      HFV VHG   G WCWYK+   +  SG+K +CIDL  AG++ +D N + 
Sbjct  6    VSEERLKKMSEQHFVFVHGACHGGWCWYKVANSLRESGHKATCIDLKGAGINQTDPNTVS  65

Query  224  TFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGF  403
            + DDY++PL DFL+ LP +++VILV HS GG S+T +   FP K+S+A+Y+AA M+K G 
Sbjct  66   SLDDYDQPLNDFLSQLPVDEKVILVSHSVGGGSMTASMCLFPSKVSMAVYVAAAMVKPGT  125

Query  404  TSEQDIKDGIPDLSDFGE--INEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDS  577
                ++K+ +   S   E    +++D  FG G    PTS+++     R   Y  SP+ED 
Sbjct  126  EVPPELKEVLKVCSGLIEEQAEKLWDFTFGNGTQNFPTSMIMKPECVRDKFYNESPMEDY  185

Query  578  TLAGMLLRPGP  610
            TLA  LLRP P
Sbjct  186  TLATTLLRPAP  196



>ref|XP_002313085.2| hypothetical protein POPTR_0009s11070g [Populus trichocarpa]
 gb|EEE87040.2| hypothetical protein POPTR_0009s11070g [Populus trichocarpa]
Length=289

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 111/180 (62%), Gaps = 10/180 (6%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFVLVHG G GAWCWYKL  L+ +SG+ V+ IDL+++G+DP   +D+ +  DY +PL
Sbjct  33   PSKHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPL  92

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGF---TSEQDI  421
             D LASLPPN++VILVGHS GGL+++    + P KIS+A+++ A M        T  Q++
Sbjct  93   RDLLASLPPNEKVILVGHSLGGLALSQTMERLPSKISVAVFLTAVMPGPSLNISTLSQEL  152

Query  422  KDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
               + D+ D           FG G + PPTS+          LYQ+SP+ED TLA  L+R
Sbjct  153  ARRLTDMLD-------TRYTFGNGPNNPPTSLTFGPKYLLLRLYQLSPIEDWTLATTLMR  205



>ref|NP_001176321.1| Os11g0117900 [Oryza sativa Japonica Group]
 dbj|BAH95049.1| Os11g0117900 [Oryza sativa Japonica Group]
Length=139

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + TFDDYN PLLD 
Sbjct  16   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRTFDDYNAPLLDL  75

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            +ASLP   +VIL+GHSAGGLSV  A H F  +I  AI+IAATML+ G+ +EQDIKD I
Sbjct  76   MASLPAGDKVILIGHSAGGLSVVHAMHLFGDRIKQAIFIAATMLQFGYQTEQDIKDVI  133



>gb|KFK23092.1| hypothetical protein AALP_AAs51321U000500 [Arabis alpina]
Length=270

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 109/178 (61%), Gaps = 6/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFV VHG   G WCWYKL  L+ ++G++ + +DL+ AG++ +D+N +   D YN PL   
Sbjct  15   HFVFVHGASHGGWCWYKLITLLVSAGFEATSVDLTGAGINLTDSNTVFESDHYNLPLFTL  74

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L+ LPP+ +V+LVGHS GG SVT+A  KF  KIS+ +Y+AA M++ G  +   +      
Sbjct  75   LSDLPPHHRVVLVGHSIGGSSVTEALCKFTDKISMVVYLAALMVQPGSVASPSLLT----  130

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              + GE   +++  +G G D  PT +++ K   R   Y  SPLED TLA  LLRP P+
Sbjct  131  -MNVGE-EGIWEYTYGEGLDKTPTGVIMKKEFIRHYYYSQSPLEDVTLASKLLRPAPV  186



>ref|XP_004300554.1| PREDICTED: probable esterase PIR7A isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004300555.2| PREDICTED: probable esterase PIR7A isoform X2 [Fragaria vesca 
subsp. vesca]
Length=296

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 111/178 (62%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK+  L++++G+ V+ +D++++G++P+    + +F DY +PL++F
Sbjct  49   HFVLVHGAGHGAWCWYKVATLLKSAGHNVTALDMAASGINPTQVQQVHSFSDYAEPLIEF  108

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLPP  +VILVGHS GG  ++ A   FPQ+IS+A++  A M     T    I   I  
Sbjct  109  MASLPPLHRVILVGHSMGGAIISLAMEMFPQRISVAVFATAAMPGPNLTYSA-IFAAISS  167

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
               F +   +YD     GQ+ PPTS++          YQ+SP ED TLA  L+RP P+
Sbjct  168  GVSFMDSQFIYDD----GQNNPPTSLVFGPKFMSSSFYQLSPPEDLTLAFSLVRPSPL  221



>ref|XP_006379213.1| hypothetical protein POPTR_0009s11050g [Populus trichocarpa]
 gb|ERP57010.1| hypothetical protein POPTR_0009s11050g [Populus trichocarpa]
Length=289

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFVLVHG G GAWCWYKL  L+ +SG+ V+ IDL+++G+DP   +D+ +  DY +PL
Sbjct  33   PSKHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPL  92

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
             D LASLPPN++VILVGHS GGL+++    + P KIS+A+++ A M           ++ 
Sbjct  93   RDLLASLPPNEKVILVGHSLGGLALSQTMERLPSKISVAVFLTAFMPGPSLNISTLNQER  152

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
            +  L+D  +    +D     G + PPTS +         LYQ+SP+ED TLA  L+R
Sbjct  153  VRRLTDMLDTRFTFD----NGPNNPPTSFIFGPKHLLLRLYQLSPIEDWTLATTLMR  205



>ref|XP_002313084.2| hypothetical protein POPTR_0009s11040g [Populus trichocarpa]
 gb|EEE87039.2| hypothetical protein POPTR_0009s11040g [Populus trichocarpa]
Length=289

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 109/177 (62%), Gaps = 4/177 (2%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFVLVHG G GAWCWYKL  L+ +SG+ V+ IDL+++G+DP   +D+ +  DY +PL
Sbjct  33   PSKHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPL  92

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
             D LASLPPN +VILVGHS GGL+++    + P KIS+A+++ A M           ++ 
Sbjct  93   RDLLASLPPNDKVILVGHSLGGLALSQTMERLPSKISVAVFLTAVMPGPSLNISTLNQER  152

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
            +   +D  +    +D     G + PPTS++         LYQ+SP+ED TLA  L+R
Sbjct  153  VRRQTDMLDTRFTFD----NGPNNPPTSLIFGPKFLLLRLYQLSPIEDWTLATTLMR  205



>ref|XP_010041620.1| PREDICTED: methylesterase 17-like, partial [Eucalyptus grandis]
Length=191

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 92/117 (79%), Gaps = 3/117 (3%)
 Frame = +2

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
            ++LP ++QVILVGHSAGGL VT A+ KFP KI +A+Y+AATMLK G  ++QD+KDG PDL
Sbjct  1    STLPDDKQVILVGHSAGGLCVTQASGKFPGKIGVAVYVAATMLKHGLQTDQDLKDGAPDL  60

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            S FG++N   D+ FG+G D PPTS ++ K  QR I+Y MSPLEDSTLA ML++PGP 
Sbjct  61   SGFGDVN---DLTFGLGPDKPPTSAIIKKEFQRNIIYHMSPLEDSTLAAMLVKPGPF  114



>gb|ABK23030.1| unknown [Picea sitchensis]
Length=278

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 113/180 (63%), Gaps = 7/180 (4%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+E  G++VS IDL SAG +P  A+ I++F++YN+PL+ F
Sbjct  24   HFVLVHGGMHGAWCWYKIMELLEKDGHRVSAIDLMSAGTNPVTADSIMSFEEYNQPLMHF  83

Query  260  LASLPPNQ---QVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
            LA LP  +   Q++LVGHS GG+S+   +  FP  I++A+Y+ A M + G  S Q  K+ 
Sbjct  84   LAKLPRTEKRAQIVLVGHSLGGVSIARGSEDFPHLIAVAVYVCALMFRGG-ESMQREKEM  142

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            +    D  E  E Y+ G G+G+  PPTS  V +  Q+   Y  S   D TLA +LLRP P
Sbjct  143  MELDKDILEKVE-YNFGNGIGE--PPTSGQVPRNFQKDFFYGTSSTLDVTLASLLLRPCP  199



>ref|XP_002522352.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
 gb|EEF40036.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
Length=260

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 113/181 (62%), Gaps = 10/181 (6%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG   GAWCWYK+  L++ +G+KV+ ++L+++GV P   ND+ +F DY +PL++F
Sbjct  7    HFVLIHGACHGAWCWYKVATLLKCAGHKVTALELAASGVHPKQVNDLYSFSDYYEPLMEF  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM---LKTGFTSEQDIKDG  430
            + SLPP ++VILVGHS GGLS++ A  +FP+K+S  ++  A M     + FT +++    
Sbjct  67   MMSLPPEERVILVGHSLGGLSLSVAMERFPEKVSAGVFATAFMPGPELSYFTLKEEFDRQ  126

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
                 D   +       F  G D PPTS+L    +    LYQ+SP ED TLA +L+R  P
Sbjct  127  FNSYMDMQYM-------FDNGPDNPPTSVLFGPNVLADKLYQLSPTEDLTLATLLIRHLP  179

Query  611  I  613
            +
Sbjct  180  L  180



>ref|XP_001763956.1| predicted protein [Physcomitrella patens]
 gb|EDQ71095.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 110/180 (61%), Gaps = 6/180 (3%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            P HFV VHG G GAW WY++   +   G+K + IDL+S G D  D N + +F DYN+PL+
Sbjct  6    PAHFVFVHGAGLGAWTWYRVIDHLRKKGHKATAIDLTSCGRDSVDPNTVTSFMDYNQPLV  65

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            DF+ +L  +++V LVGH  GGLS+T A   FP+ IS+A+++ A ML +GF    ++ +  
Sbjct  66   DFMQTLSSDEKVALVGHDLGGLSLTYAMEHFPKNISVAVFLVAMMLPSGFPLTYELFEMD  125

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            P +S+  E        FG G    PTS+ VT+ +Q ++ Y M P ED  LA +L +P P+
Sbjct  126  PAVSNHIEYT------FGDGTHAMPTSLYVTEKIQPQVFYNMCPSEDVVLASLLSKPVPL  179



>gb|ABA91258.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
Length=263

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 106/182 (58%), Gaps = 18/182 (10%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + TFDDYN PLLD 
Sbjct  18   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRTFDDYNAPLLDL  77

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKT-----GFTSEQDIK  424
            +ASLP   +V            +D    F Q + L + +   M               + 
Sbjct  78   MASLPAGDKV----------GDSDYGSLFHQHLLLKVQLQINMFYVSGQPFNLMHSSLVC  127

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
             G+PDLS++G   +VYD+ FG+G D PPT++ + K  QR ILYQ SP EDS LA +LLRP
Sbjct  128  QGVPDLSEYG---DVYDLTFGLGADRPPTAVALRKEFQRIILYQQSPQEDSALASILLRP  184

Query  605  GP  610
             P
Sbjct  185  WP  186



>ref|XP_001764587.1| predicted protein [Physcomitrella patens]
 gb|EDQ70569.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 108/180 (60%), Gaps = 6/180 (3%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            P HFV +HG G GAW WY++   +   G K + IDL+S G D  D N + +F DYN+PL+
Sbjct  6    PAHFVFIHGGGFGAWTWYRVVDQLRKKGQKATAIDLTSCGRDSVDPNTVTSFMDYNQPLV  65

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            +F+ +L PN++++LVGH  GGLSVT A   F + IS+A++IAA ML +GF    ++ +  
Sbjct  66   EFMQTLAPNERIVLVGHDLGGLSVTYAMEHFHKNISVAVFIAAMMLPSGFPLTLELFELD  125

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            P +    E        FG G    PTS+ V + +Q ++ Y M P ED  LA +L +P P+
Sbjct  126  PKVGSHIEYT------FGDGTHAMPTSLYVMEKMQPQVFYHMCPSEDVVLASLLSKPVPL  179



>ref|XP_006380732.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
 gb|ERP58529.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
Length=259

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 110/178 (62%), Gaps = 4/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+ ++G+KV+ +D++++GV P    ++    DY +PL++F
Sbjct  6    HFVLVHGACHGAWCWYKVATLLTSAGHKVTALDMAASGVHPKRVEELHAISDYFEPLMEF  65

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP ++VILVGHS GGLS + A  +FP+KIS A++ A  M     +     ++    
Sbjct  66   MTSLPPEERVILVGHSMGGLSNSVAMERFPEKISCAVFAACIMPGPDLSFTAAKEENARQ  125

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
               F +   ++D     G + PPTSIL+        LYQ+SP +D TLA +LLRP P+
Sbjct  126  AGSFMDSQYMFD----NGPNNPPTSILLGPDCLSIQLYQLSPAKDLTLAKLLLRPHPL  179



>gb|KDP38248.1| hypothetical protein JCGZ_04891 [Jatropha curcas]
Length=291

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  65   PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK  244
            P    HF+L+HG   GAW WY++  L+  SG++V+ IDL+++G+DP     + +  DY +
Sbjct  30   PKASKHFLLIHGAAHGAWSWYRIVPLLRLSGHEVTTIDLAASGIDPRQPESLRSLSDYIR  89

Query  245  PLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIK  424
            P +DF+ASLPP ++VILVGHS GGL+++     FP KIS+A+++ A M    F      +
Sbjct  90   PAIDFVASLPPQERVILVGHSFGGLAISKVMENFPNKISVAVFLTAFMPGPTFNISTLFE  149

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            +   D  +  E++  Y   +  G D PPT+ L      R  LYQ+SP+ED TLA  L+RP
Sbjct  150  EY--DRKELPELDNSY--SYDDGPDNPPTTELWGPIFLRTFLYQLSPIEDWTLATTLVRP  205

Query  605  GPI  613
             P+
Sbjct  206  RPL  208



>gb|KDP31871.1| hypothetical protein JCGZ_12332 [Jatropha curcas]
Length=260

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 114/182 (63%), Gaps = 13/182 (7%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK+  L++++G+KV+ +D++++GV P   ++I +  DY +PL++F
Sbjct  8    HFVLVHGAGLGAWCWYKVATLLKSAGHKVTALDMAASGVHPKQVSEIQSISDYFEPLMEF  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM--LKTGFTSEQDIKDGI  433
            + S P  ++VILVGHS GGLS++ A  +FP+KIS AI+ +A M      +TS ++     
Sbjct  68   MMSSPQEEKVILVGHSFGGLSISIAMERFPEKISAAIFASAIMPGPDLSYTSARE-----  122

Query  434  PDLSDFGEINEVYDIGFGM--GQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPG  607
                 F +  +  D  F    G D PPTS+L         LYQ+SP ED  LA ML+RP 
Sbjct  123  ----KFSKTFDPMDTKFKFDNGPDHPPTSLLSGPNCLSTQLYQLSPPEDLMLAMMLIRPH  178

Query  608  PI  613
            P+
Sbjct  179  PL  180



>ref|XP_011039242.1| PREDICTED: polyneuridine-aldehyde esterase-like [Populus euphratica]
Length=259

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 109/178 (61%), Gaps = 4/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+ ++G+KV+ +D++++GV P    ++    DY +PL++F
Sbjct  6    HFVLVHGACHGAWCWYKVATLLTSAGHKVTALDMAASGVHPKRVEELHAISDYFEPLMEF  65

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP ++VILVGHS GGL  + A  +FP+KIS A++ A  M     +     ++    
Sbjct  66   MTSLPPEERVILVGHSMGGLCNSVAMERFPEKISCAVFAACIMPGPALSFTAAKEENARQ  125

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
               F +   ++D     G + PPTS+L+        LYQ+SP ED +LA +LLRP P+
Sbjct  126  AGSFMDSQYMFD----NGPNNPPTSMLLGPDCLSIQLYQLSPAEDLSLAKLLLRPHPL  179



>ref|XP_007047136.1| Methyl esterase 10, putative [Theobroma cacao]
 gb|EOX91293.1| Methyl esterase 10, putative [Theobroma cacao]
Length=258

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 115/179 (64%), Gaps = 11/179 (6%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L++++G+KV+ +DL+++GV P   +++ +  DY +PL++F
Sbjct  7    HFVLVHGAFHGAWCWYKVATLLKSTGHKVTALDLAASGVHPKQVHELHSISDYYEPLMEF  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFT----SEQDIKD  427
            +ASLP   +VILVGHS GG+S++ A  +FP+K+S+AI+  A M    F+     E+  + 
Sbjct  67   MASLPVEGKVILVGHSLGGVSLSAAMERFPEKVSVAIFATAVMPGPDFSFASIEEEFTRK  126

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            GI     F +++  Y   F  G D PPTS+L         +YQ+SP ED  LA +L+RP
Sbjct  127  GI-----FSQMDGKYI--FDNGPDHPPTSVLAGHNYISSNVYQLSPPEDLMLATVLIRP  178



>ref|XP_004514191.1| PREDICTED: methylesterase 10-like isoform X1 [Cicer arietinum]
Length=262

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 1/178 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG   GAWCWYK+  ++++ G+ V+ ID+ + G++     DI +  DYN+PL+ F
Sbjct  5    HFVLIHGASYGAWCWYKVATMLKSIGHNVTTIDMGACGLNTKQVQDICSILDYNEPLMTF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLP +++VILVGHS GG+S++ A  KFP KIS+AI++AA ++    T     ++ I  
Sbjct  65   MESLPSHEKVILVGHSFGGISISMAMEKFPNKISIAIFVAAFVISENLTYPTITQELIRK  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              +  +  ++    F  G + PPT++L         +YQ+SP ED TLA  L+RP P+
Sbjct  125  KDENKDSMDIQHFFFN-GPNNPPTALLFGPKFMESKMYQLSPSEDLTLALSLVRPFPL  181



>ref|XP_007047134.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
 gb|EOX91291.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
Length=262

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 109/174 (63%), Gaps = 2/174 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+   +++ G++V+ +D++++GV P   +++ +F DY +PL++F
Sbjct  7    HFVLVHGACHGAWCWYKVATRLKSMGHRVTAMDMAASGVHPKQVHEVHSFSDYFEPLMEF  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLPP ++VILVGHS GG  ++ A  +FP+KIS+A++  A M     TS Q +   + +
Sbjct  67   MASLPPEERVILVGHSKGGFCISAAMERFPEKISVAVFATAFMPGPKLTS-QTLSQEVNE  125

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
              D  +  +    GF  G D P TS+L         LYQ+SP ED TLA  L R
Sbjct  126  RLDSDKFMDA-QFGFHNGLDEPATSLLFGPNFMASKLYQLSPPEDLTLALTLAR  178



>ref|XP_004514196.1| PREDICTED: methylesterase 10-like isoform X1 [Cicer arietinum]
Length=262

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 110/178 (62%), Gaps = 1/178 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG   GAWCWYK+  ++++ G+ V+ ID+ + G++     DI +  DYN+PL+ F
Sbjct  5    HFVLIHGASYGAWCWYKVATMLKSIGHNVTTIDMGACGLNTKQVQDICSILDYNEPLMTF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLP +++VILVGHS GG+S++ A  KFP KIS+AI+ AA ++    T     ++ I  
Sbjct  65   MESLPSHEKVILVGHSFGGISISMAMEKFPNKISIAIFAAAFVISENLTYPTITQELIRK  124

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              +  +  ++    F  G + PPT++L         +YQ+SP ED TLA  L+RP P+
Sbjct  125  RDENKDSMDIQHFFFN-GPNNPPTALLFGPKFMESKMYQLSPFEDLTLALSLVRPFPL  181



>ref|XP_002310760.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
 gb|EEE91210.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
Length=264

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 111/183 (61%), Gaps = 9/183 (5%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+ ++G+KV+ +D++++GV P    ++    DY +PL++F
Sbjct  6    HFVLVHGACHGAWCWYKVATLLTSAGHKVTALDMAASGVHPKRVEELHAISDYFEPLMEF  65

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM-----LKTGFTSEQDIK  424
            + SLPP ++VILVGHS GGLS + A  +FP+KIS A++ A  M      KT   + +   
Sbjct  66   MTSLPPEERVILVGHSMGGLSNSVAMERFPEKISCAVFAACIMPAFSLCKTVIFTLEIYY  125

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
                    F +   ++D     G + PPTSIL+        LYQ+SP +D TLA +LLRP
Sbjct  126  QNARQAGSFMDSQYMFD----NGPNNPPTSILLGPDCLSIQLYQLSPAKDLTLAKLLLRP  181

Query  605  GPI  613
             P+
Sbjct  182  HPL  184



>ref|XP_007047135.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
 gb|EOX91292.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
Length=262

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 109/174 (63%), Gaps = 2/174 (1%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+   +++ G++V+ +D++++GV P   +++ +F DY +PL++F
Sbjct  7    HFVLVHGACHGAWCWYKVATRLKSMGHRVTAMDMAASGVHPKQVHEVHSFSDYFEPLMEF  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLPP ++VILVGHS GG  ++ A  +FP+KIS+A++  A M     TS Q +   + +
Sbjct  67   MASLPPEERVILVGHSKGGFCISAAMERFPEKISVAVFATAFMPGPKLTS-QTLSQEVNE  125

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
              D  +  +    GF  G D P TS+L         LYQ+SP ED TLA  L R
Sbjct  126  RLDSDKFMDA-QFGFHNGLDEPATSLLFGPNFMASKLYQLSPPEDLTLALTLAR  178



>ref|XP_004234676.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Solanum 
lycopersicum]
Length=262

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 115/182 (63%), Gaps = 14/182 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HF+LVHG   GAWCWYK+  ++ + G+KVS +D++++G++P   ND+ +  DYN+PL++F
Sbjct  8    HFLLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVNDLNSMADYNEPLMEF  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM-----LKTGFTSEQDIK  424
            + SLP  ++V+LVGHS GG++++ A  KFPQKI++A+++ A+M          T +   +
Sbjct  68   MNSLPQQERVVLVGHSLGGINISLAMEKFPQKIAVAVFVTASMPGPDLNIVAVTQQYSEQ  127

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
               P  ++F     VY+ G     D  PTS+++       I YQ SP ED TLA  L+RP
Sbjct  128  VEAPMDTEF-----VYNNGL----DKTPTSLVLGPKDLATIFYQYSPPEDLTLATYLVRP  178

Query  605  GP  610
            GP
Sbjct  179  GP  180



>ref|XP_004301853.2| PREDICTED: probable esterase PIR7A [Fragaria vesca subsp. vesca]
Length=298

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 110/180 (61%), Gaps = 7/180 (4%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCW+K+  L+E++G+ V+ +D++++G++P+    + +F DY +PL++F
Sbjct  49   HFVLVHGAGHGAWCWFKVATLLESAGHNVTALDMAASGINPTQVQKVHSFSDYAEPLIEF  108

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLPP  +VILVGHS GG  ++ A   FP +IS A++  A M     T        I  
Sbjct  109  MASLPPLHRVILVGHSMGGAIISLAMEMFPLRISAAVFATAAMPGPDLT-----YSAIVA  163

Query  440  LSDFGEINEVYDIGFGM--GQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              + G  + + D  F    GQ+ PPTS++         LYQ+SP ED TLA  L+RP P+
Sbjct  164  AINSGATSSLMDSQFIYDDGQNNPPTSLVFGPKFMSSSLYQLSPPEDLTLAFSLVRPSPL  223



>ref|XP_008241857.1| PREDICTED: LOW QUALITY PROTEIN: methylesterase 10 [Prunus mume]
Length=261

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 115/192 (60%), Gaps = 12/192 (6%)
 Frame = +2

Query  56   VVAPPPPP-----HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  220
            + +P P P     HFVLVHG G GAWCWYKL  L+ ++GY V+ +DL+++G +P   N +
Sbjct  1    MCSPSPNPEAQKKHFVLVHGAGHGAWCWYKLSALLTSAGYNVTALDLAASGDNPKQINQV  60

Query  221  LTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG  400
              F DY +PL++F+ SLPPN++VILVGHS GG  ++ A  +FP+KIS A++  AT L  G
Sbjct  61   HCFADYVEPLIEFIESLPPNERVILVGHSMGGACISIAMERFPEKISAAVF--ATALMPG  118

Query  401  FT-SEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDS  577
             T S   I + +   S+F +    +D G     + PPTS +        + YQ+SP ED 
Sbjct  119  PTISYLTIFEEVSSRSEFMDSQYRFDKGL----NNPPTSAIFGPQRMTSVFYQLSPPEDL  174

Query  578  TLAGMLLRPGPI  613
             LA   LR  P+
Sbjct  175  ALALSSLRFFPL  186



>ref|NP_001239778.1| uncharacterized protein LOC100803613 [Glycine max]
 gb|ACU19012.1| unknown [Glycine max]
 gb|KHN42051.1| Polyneuridine-aldehyde esterase [Glycine soja]
Length=261

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 113/179 (63%), Gaps = 8/179 (4%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG+G GAWCWYKL+ L+E++G+KV+ +DL+++G+D  D  DI TF +Y+KPLLD 
Sbjct  10   HFVLVHGIGHGAWCWYKLKPLLESAGHKVTVLDLAASGIDTHDIEDIHTFSEYSKPLLDL  69

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            LASL PN++V+LVGHS GG+S+  A  KFP+KISL I++ A +  T       +++ I  
Sbjct  70   LASLAPNEKVVLVGHSFGGISIALAMDKFPEKISLGIFLTAFVPDTQHKPSHVLEEYIDR  129

Query  440  LSDFGEIN-EVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
                G ++ E+++ G      G  T +   K L  K  YQ+   ED  L   L R G +
Sbjct  130  YPYTGWMDTELWNSG------GKTTLLFGIKFLSTK-FYQLCSTEDLELVKTLRRKGSL  181



>ref|XP_008230905.1| PREDICTED: putative methylesterase 11, chloroplastic [Prunus 
mume]
Length=379

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 109/183 (60%), Gaps = 13/183 (7%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E  G+KV+ IDL+ +G+  SDAN + +   Y KPL DF
Sbjct  127  HFVLVHGGGFGAWCWYKTIALLEEVGFKVTAIDLTGSGIHSSDANSVTSLSQYVKPLTDF  186

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFT-----SEQDIK  424
            L +LP   +VILVGH  GG  ++ A   FP K+S AI+IAA MLK G +     S+Q   
Sbjct  187  LENLPEGNKVILVGHDFGGACISYAMELFPHKVSKAIFIAAAMLKNGQSTLEMFSQQATS  246

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            D   DL    +I       +  G + PPT+I + K++ + +L+  SP +D  LA + +RP
Sbjct  247  D---DLMRQAQI-----FLYANGNNQPPTAIDLDKSMLKDLLFNQSPAKDVALASVSMRP  298

Query  605  GPI  613
             P 
Sbjct  299  IPF  301



>ref|XP_007215535.1| hypothetical protein PRUPE_ppa007173mg [Prunus persica]
 gb|EMJ16734.1| hypothetical protein PRUPE_ppa007173mg [Prunus persica]
Length=379

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 109/183 (60%), Gaps = 13/183 (7%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E  G+KV+ IDL+ +G+  SDAN + +   Y KPL DF
Sbjct  127  HFVLVHGGGFGAWCWYKTIALLEEVGFKVTAIDLTGSGIHSSDANSVTSLSQYVKPLTDF  186

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFT-----SEQDIK  424
            L +LP   +VILVGH  GG  ++ A   FP K+S AI+IAA MLK G +     S+Q   
Sbjct  187  LENLPEGNKVILVGHDFGGACISYAMELFPHKVSKAIFIAAAMLKNGQSTLEMFSQQATS  246

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            D   DL    +I       +  G + PPT+I + K++ + +L+  SP +D  LA + +RP
Sbjct  247  D---DLMRQAQI-----FLYANGNNQPPTAIDLDKSMLKDLLFNQSPAKDVALASVSMRP  298

Query  605  GPI  613
             P 
Sbjct  299  IPF  301



>ref|XP_006480147.1| PREDICTED: methylesterase 10-like [Citrus sinensis]
Length=289

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 110/182 (60%), Gaps = 8/182 (4%)
 Frame = +2

Query  65   PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK  244
            P P  HFVLVHG   GAW WYKL  ++++SG+ V+  DL+++GV+P   N++ +  D+ K
Sbjct  31   PLPTKHFVLVHGSCHGAWSWYKLVAMIKSSGHNVTAFDLAASGVEPQQVNNLRSISDFFK  90

Query  245  PLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIK  424
            PL+DF+A+LP ++ VILVGHS GGL+V  +  +FP KIS+A+++ A M         D+ 
Sbjct  91   PLIDFMAALPLDKMVILVGHSYGGLAVAQSMERFPNKISVAVFVTALM------PGPDLN  144

Query  425  DGIPDLSDFGEINEVYDIGFGM--GQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
                +   F     + D  +    G D PPT+ +      +  +YQ+SP+ED  LA ML+
Sbjct  145  ISTLNQESFSRQGPLLDCKYAYDDGPDSPPTTFIFGPLYLKSKVYQLSPVEDWALATMLM  204

Query  599  RP  604
            RP
Sbjct  205  RP  206



>gb|KJB43607.1| hypothetical protein B456_007G209600 [Gossypium raimondii]
Length=261

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 107/182 (59%), Gaps = 14/182 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG   GAWCWYK+  L++ +G++V+ +DL ++GVDP    ++ +F DY +PL+DF
Sbjct  6    HFVLIHGSCHGAWCWYKVVNLLKTAGHQVTALDLGASGVDPKRLEEVTSFSDYLQPLMDF  65

Query  260  LASLPPNQ--QVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG-----FTSEQD  418
             ASLP  Q  +VILVGHS  GL ++ A  +FP+KIS+A++IAA M            E  
Sbjct  66   FASLPDEQDRKVILVGHSYAGLCISLAMERFPKKISVAVFIAAYMPHHSSPPGTLIQEYF  125

Query  419  IKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
             +  +  L D        +  FG G D PPTS L      + I YQ  PLED  L  ML+
Sbjct  126  KRTKVEFLMD-------CEFTFGNGLDKPPTSALFGPNFMKAIAYQHCPLEDLELGKMLV  178

Query  599  RP  604
            RP
Sbjct  179  RP  180



>ref|XP_011039240.1| PREDICTED: salicylic acid-binding protein 2-like [Populus euphratica]
Length=333

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 111/178 (62%), Gaps = 4/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+   ++++G+ V+ +D++++GV P   +++ +F+DY +PL++F
Sbjct  83   HFVLVHGACHGAWCWYKVSAQLKSAGHNVTALDMAASGVHPKQVHELHSFEDYFEPLMEF  142

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP ++V+LVGHS  G+ ++ A  +FP+KIS A++ AA M     + +   +     
Sbjct  143  MESLPPEERVVLVGHSMSGICISVAMERFPEKISAAVFAAAVMPGPDLSFKAIAEKSSQT  202

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
               + +   V    FG G D PPT++++         Y +SP ED TLA +L+RP PI
Sbjct  203  SVSYMDTQYV----FGNGPDNPPTAVVLGPNYMASRFYHLSPPEDLTLATLLVRPFPI  256



>ref|XP_009123030.1| PREDICTED: pheophorbidase-like [Brassica rapa]
Length=244

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 105/181 (58%), Gaps = 24/181 (13%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFVLVHG   GAWCWY+L  L+ ++G+K + +DL+SAG++ +DAN +  FD YN+PL
Sbjct  9    PIIHFVLVHGACHGAWCWYRLTTLLLSAGFKATTVDLTSAGINLTDANTVFEFDHYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L+ +P + ++ILVGHS GG SVT A  KF  KIS+A+Y+ A M++ G TS       
Sbjct  69   FSLLSDIPHHHKIILVGHSIGGASVTAALCKFSDKISMAVYLVADMVQPGTTSPPH----  124

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
               +   GE  ++++  +G G D                    SPLED  LA  LLRP P
Sbjct  125  --SIMSVGEEEDIWEFTYGEGDD------------------SQSPLEDVILASKLLRPSP  164

Query  611  I  613
            +
Sbjct  165  V  165



>ref|XP_009782139.1| PREDICTED: putative methylesterase 11, chloroplastic [Nicotiana 
sylvestris]
Length=385

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 110/178 (62%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E +G+KV+ +DL+ +G+   D N I +   Y KPL DF
Sbjct  133  HFVLVHGGGFGAWCWYKTIALLEEAGFKVTAVDLTGSGIHSFDTNSITSLSQYAKPLTDF  192

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L +L   ++VILVGH  GG  ++ A   +P K+S AI++AATML +G  S  DI     +
Sbjct  193  LETLADGKKVILVGHDFGGACISFAMELYPSKVSKAIFVAATMLISG-QSALDIFSDKTN  251

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D    ++V+   +  G D PPT+I + K+L R +L+  SP +D  LA + +RP P 
Sbjct  252  SNDLMRQSQVFI--YANGNDKPPTAIDLDKSLLRDLLFNHSPAKDVALASVSMRPIPF  307



>ref|XP_006423079.1| hypothetical protein CICLE_v10028977mg [Citrus clementina]
 gb|ESR36319.1| hypothetical protein CICLE_v10028977mg [Citrus clementina]
Length=289

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 8/182 (4%)
 Frame = +2

Query  65   PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNK  244
            P P  HFVLVHG   GAW WYKL  ++++SG+ V+  DL+++GV+P   +++ +  D+ K
Sbjct  31   PLPTKHFVLVHGSCHGAWSWYKLVAMIKSSGHNVTAFDLAASGVEPQQVHNLRSISDFFK  90

Query  245  PLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIK  424
            PL+DF+A+LP +++VILVGHS GGL+V  +  +FP KIS+A++++A M         D+ 
Sbjct  91   PLIDFMAALPLDKKVILVGHSYGGLAVAQSMERFPNKISVAVFVSALM------PGPDLN  144

Query  425  DGIPDLSDFGEINEVYDIGFGM--GQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
                +   F     + D  +    G D PPT+ +      +  +YQ+SP+ED  LA ML+
Sbjct  145  ISTLNQESFSRQGPLLDCKYAYDDGPDSPPTTFIFGPLYLKSKVYQLSPVEDWALATMLM  204

Query  599  RP  604
            RP
Sbjct  205  RP  206



>ref|NP_001275411.1| methyl jasmonate esterase [Solanum tuberosum]
 gb|AAV87151.1| methyl jasmonate esterase [Solanum tuberosum]
Length=262

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 115/183 (63%), Gaps = 14/183 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  ++ + G+KVS +D++++G++P    D+ +  DYN+PL++F
Sbjct  8    HFVLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVEDLNSMADYNEPLMEF  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM-----LKTGFTSEQDIK  424
            + SLP  ++V+LVGHS GG++++ A  KFP KI++A++++A+M          T +   +
Sbjct  68   MNSLPQQERVVLVGHSMGGINISLAMEKFPHKIAVAVFVSASMPGPDLNLVAVTQQYSQQ  127

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
               P  ++F     VY+ G   G    PTS+++   +   I YQ SP ED TLA  L+RP
Sbjct  128  VETPMDTEF-----VYNNGLDKG----PTSVVLGPKVLATIYYQFSPPEDLTLATYLVRP  178

Query  605  GPI  613
             P+
Sbjct  179  VPL  181



>ref|XP_007042333.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
 gb|EOX98164.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
Length=300

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 112/185 (61%), Gaps = 12/185 (6%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            PP HFVLVHG   GAW WYKL  L+++ G+ V+ IDL+ +GVDP   N + +  DY KPL
Sbjct  44   PPKHFVLVHGSCHGAWSWYKLVPLLKSEGHNVTGIDLAGSGVDPQQVNTLRSISDYIKPL  103

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM----LKTGFTSEQD  418
             DF+ SLP  Q+V+LVGHS GGL+++ A  +FP+KIS+A+++ A M    L     S++ 
Sbjct  104  RDFMESLPDQQKVVLVGHSLGGLAISQAMERFPEKISVAVFLTALMPGPTLNISTLSQRA  163

Query  419  IKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
             K+         +++ +Y   +  G +  PT+ +         +YQ+SP ED  LA +L+
Sbjct  164  FKE------QDSQMDSLYT--YDNGPNNAPTTFIFGPLYLSSQVYQLSPREDWALANVLM  215

Query  599  RPGPI  613
            RP P+
Sbjct  216  RPIPL  220



>ref|XP_007202197.1| hypothetical protein PRUPE_ppa018866mg, partial [Prunus persica]
 gb|EMJ03396.1| hypothetical protein PRUPE_ppa018866mg, partial [Prunus persica]
Length=250

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 109/178 (61%), Gaps = 5/178 (3%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK+  L+ + G+ V+ +DL+++GV+P     + +  DY +PL+ F
Sbjct  5    HFVLVHGAGHGAWCWYKVSTLLTSIGHNVTALDLAASGVNPKQVQQLHSLSDYVEPLMRF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP ++VILVGHS GG +++ A  KFP+KI +A++  A M      +  ++   I +
Sbjct  65   MKSLPPKERVILVGHSMGGAAISIAMEKFPEKIYIAVFATALMPGPAL-NYSNLSSQILN  123

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              DF +    YD     G + PPT+ L+   L    +YQ+SP ED TLA  L+R  P+
Sbjct  124  SVDFMDSQFRYD----RGPNNPPTATLIGPKLLSSSMYQLSPPEDLTLALSLVRFSPL  177



>ref|XP_010070490.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
 gb|KCW59292.1| hypothetical protein EUGRSUZ_H01973 [Eucalyptus grandis]
Length=265

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 106/175 (61%), Gaps = 4/175 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+++SG+K + +D+++AGV P    ++ +  +Y +PL +F
Sbjct  11   HFVLVHGACHGAWCWYKVATLLKSSGHKATALDMAAAGVHPKQPQELNSIVEYVEPLFEF  70

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
               LP  ++VILVGHS GG+ ++ A  +FP+KI++A+++AA M     + E   ++ +  
Sbjct  71   FEGLPRGEKVILVGHSMGGVVISLAMERFPEKIAVAVFVAAFMYGPELSFETVYEEHVRR  130

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            L  F +    +D     G + PPTS L         LYQ+SP ED TLA  L RP
Sbjct  131  LDSFMDTKYAFDD----GPEKPPTSFLFGYNFMASKLYQLSPPEDLTLASYLARP  181



>ref|XP_010026413.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
 gb|KCW59299.1| hypothetical protein EUGRSUZ_H01980 [Eucalyptus grandis]
Length=265

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 107/175 (61%), Gaps = 4/175 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+E+SG+KV+ +D++++GV P    ++ +  +Y  PL +F
Sbjct  11   HFVLVHGACHGAWCWYKVATLLESSGHKVTALDMAASGVHPKQPRELNSIVEYVDPLFEF  70

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
               LP  ++VILVGHS GG+ ++ A  KFP+KI++A+++AA M     +    I++    
Sbjct  71   FEGLPQGEKVILVGHSMGGIVISMAMEKFPEKIAVAVFVAAFMYGPKLSVTSVIEEYARR  130

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            L  + +     +  F  G + PPT++L         LYQ+SP ED TLA  L+RP
Sbjct  131  LDSYMDT----EYAFDDGPEKPPTTLLFGYNFVASKLYQLSPPEDLTLASYLMRP  181



>emb|CDO97130.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 111/181 (61%), Gaps = 10/181 (6%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HF+LVHG   GAW WYKL  L+ ++G+ V+ +DL+++G++P    D+    DY +PL
Sbjct  36   PSKHFILVHGACHGAWSWYKLVALLRSAGHNVTALDLAASGINPKQVYDVKYISDYFQPL  95

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
             DF+ASL  N++VILVGHS GGL+++ A   FP+KI++A++I A M         ++K  
Sbjct  96   RDFMASLSSNERVILVGHSFGGLAISQAMEIFPKKITVAVFITALM------PGPELKIS  149

Query  431  IPDLSDFGEINEVYDIGF--GMGQDGPPTSILV-TKTLQRKILYQMSPLEDSTLAGMLLR  601
            I +   F   N + D  F    G + PPT+ +   K L  K+ YQ SP+ED  LA MLLR
Sbjct  150  ILNQESFRRQNSLLDSHFLYDNGPNNPPTAFVFGPKHLSAKV-YQRSPIEDLALATMLLR  208

Query  602  P  604
            P
Sbjct  209  P  209



>ref|NP_001233813.1| methylesterase [Solanum lycopersicum]
 gb|AAS10488.1| methylesterase [Solanum lycopersicum]
Length=262

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 113/185 (61%), Gaps = 18/185 (10%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  ++ + G+KVS +D++++G++P   +D+ +  DYN+PL++F
Sbjct  8    HFVLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVDDLNSMADYNEPLMEF  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM-------LKTGFTSEQD  418
            + SLP  ++V+LVGHS GG++++ A  KFPQKI +A+++ A M       +  G    Q 
Sbjct  68   MNSLPQLERVVLVGHSMGGINISLAMEKFPQKIVVAVFVTAFMPGPDLNLVALGQQYNQQ  127

Query  419  IKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
            ++  +             +  +  GQD  PTS+++   +     YQ+SP ED TLA  L+
Sbjct  128  VESHMDT-----------EFVYNNGQDKAPTSLVLGPEVLATNFYQLSPPEDLTLATYLV  176

Query  599  RPGPI  613
            RP P+
Sbjct  177  RPVPL  181



>ref|XP_006436459.1| hypothetical protein CICLE_v10032394mg [Citrus clementina]
 ref|XP_006485627.1| PREDICTED: methylesterase 1-like [Citrus sinensis]
 gb|ESR49699.1| hypothetical protein CICLE_v10032394mg [Citrus clementina]
Length=272

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 114/201 (57%), Gaps = 15/201 (7%)
 Frame = +2

Query  17   ETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  196
            + KK AE K R+         HFVLVHG   GAWCWYK++  +E +GY+V+ +DL++ G+
Sbjct  6    KIKKMAEAKKRK---------HFVLVHGSNHGAWCWYKVKPQLEAAGYRVTALDLAATGI  56

Query  197  DPSDANDILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYI  376
            +     D+ +F +YN+PLL+FLASL   ++V+LVGHSAGGLS+  A  KFP KIS+AI++
Sbjct  57   NMKKIQDVHSFYEYNEPLLEFLASLSAGEKVVLVGHSAGGLSLALAADKFPHKISVAIFL  116

Query  377  AATMLKTGFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPT--SILVTKTLQRKIL  550
             A M  T       ++     +       E  D  F +     P+  +I          L
Sbjct  117  TAFMPDTKHQPSYVVERFFEKIPS----GEWLDTQFSVIDSSNPSRKTIFFGHNFLTLKL  172

Query  551  YQMSPLEDSTLAGMLLRPGPI  613
            YQ+SP ED  L  MLLRPG +
Sbjct  173  YQLSPPEDVELGKMLLRPGLV  193



>ref|XP_008341788.1| PREDICTED: putative methylesterase 11, chloroplastic [Malus domestica]
 ref|XP_008353502.1| PREDICTED: putative methylesterase 11, chloroplastic [Malus domestica]
Length=379

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 108/183 (59%), Gaps = 13/183 (7%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E  G+KV+ +DL+ +G+  SD N + +   Y KPL DF
Sbjct  127  HFVLVHGGGFGAWCWYKTIALLEEGGFKVTAVDLTGSGIHSSDTNSVTSLSQYVKPLSDF  186

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFT-----SEQDIK  424
            L +LP  ++VILVGH  GG  ++ A   FP K++ AI+IAA MLK G +     S+Q   
Sbjct  187  LENLPEGKKVILVGHDFGGACISYAMELFPHKVAKAIFIAAAMLKNGQSTLEMFSQQASS  246

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            D +        + +     +  G D PPT+I + K++ + +L+  SP +D  LA + +RP
Sbjct  247  DDL--------MRQAQVFLYANGNDRPPTAIDLDKSMLKDLLFNQSPSKDVALASVSMRP  298

Query  605  GPI  613
             P 
Sbjct  299  IPF  301



>gb|KDP31864.1| hypothetical protein JCGZ_12325 [Jatropha curcas]
Length=259

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 108/181 (60%), Gaps = 10/181 (6%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVL+HG   GAWCWYK+  L++++G+KV+ +DL+++GV    ANDI +F +Y +P  +F
Sbjct  7    HFVLIHGACHGAWCWYKVAALLKSAGHKVTALDLAASGVHTKQANDIYSFLEYFEPFNEF  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP  +VILV HS GGL ++ A  +FP+KIS  ++ AA M           ++    
Sbjct  67   MTSLPPEDRVILVAHSFGGLVISVAMERFPEKISAGVFAAALMPGPDLNCMAVKEELNRQ  126

Query  440  LSDFGEINEVYDIGFGMGQDGP---PTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
            L  F +    +D       DGP   PTSIL    +    LYQ+SP ED  LA +L+RP P
Sbjct  127  LGSFMDSQYTFD-------DGPSSLPTSILFGPNITETKLYQLSPPEDLVLAKLLMRPHP  179

Query  611  I  613
            +
Sbjct  180  L  180



>ref|XP_009628221.1| PREDICTED: putative methylesterase 11, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=346

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 112/184 (61%), Gaps = 15/184 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L++ SGY+V  IDL+ +G    D+N+I T   Y KPL DF
Sbjct  87   HFVLVHGGGFGAWCWYKTTTLLKESGYQVDAIDLTGSGAHFFDSNNITTLSQYVKPLTDF  146

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD----  427
            L +L  N++VILVGH  GG+ ++ A   +P K+S AI++AA+MLK G    Q+I D    
Sbjct  147  LENLDDNKKVILVGHDIGGVCISYAMELYPSKVSAAIFVAASMLKNG----QNILDMFSV  202

Query  428  --GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
              G+ +L    ++       +  G++ PPT+I   K+L +++L+  +P +D  LA + +R
Sbjct  203  QLGLNNLCQRAQV-----FRYANGKNHPPTAIDYDKSLIKEVLFNQTPTKDVELASVSMR  257

Query  602  PGPI  613
              P 
Sbjct  258  QVPF  261



>ref|XP_010088992.1| hypothetical protein L484_020275 [Morus notabilis]
 gb|EXB37219.1| hypothetical protein L484_020275 [Morus notabilis]
Length=259

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 109/185 (59%), Gaps = 24/185 (13%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+   ++++G+KV+ +D++++GV P   +++ +  DY +PL DF
Sbjct  7    HFVLVHGSCHGAWCWYKVAAQLKSTGHKVTALDMAASGVHPKKVHEVSSVSDYAEPLSDF  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            +ASLPP ++VILVGHSAGG+  + A   FPQKIS+ +++AA M               PD
Sbjct  67   MASLPPEEKVILVGHSAGGVCTSLAMEMFPQKISVGVFVAAFMPG-------------PD  113

Query  440  LSDFGEINEVY--------DIGFG--MGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAG  589
            LS F  IN  Y        D  F    G   PPT+ +         LYQ+SPLED  LA 
Sbjct  114  LS-FSTINGEYGRSIDSFMDTQFTSDQGPGHPPTAAIFGPKFLESKLYQLSPLEDLVLAR  172

Query  590  MLLRP  604
             L+RP
Sbjct  173  SLVRP  177



>gb|KEH17958.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=281

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 112/185 (61%), Gaps = 19/185 (10%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G G WCWYK+  +++++G+ V+ ID++++G++P    +I +   Y +PL+ F
Sbjct  28   HFVLVHGAGHGEWCWYKVATMLKSAGHNVTTIDMAASGINPIQVQEIHSISKYYEPLMTF  87

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLK--TGFTS-----EQD  418
            + SLPP ++VILVGHS GG+ ++ A  KF +K+S+A+++ A ++     FTS     E+ 
Sbjct  88   MESLPPKEKVILVGHSYGGIPLSVAMEKFSKKVSVAVFVTALVMSETLNFTSVIQENERR  147

Query  419  IKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
             +   P L  F             G + PPT++L+   L    LYQ+SP ED TL   L+
Sbjct  148  TQQNPPQLLFFN------------GPNSPPTALLLGSKLLASHLYQLSPNEDLTLGSSLV  195

Query  599  RPGPI  613
            RP PI
Sbjct  196  RPHPI  200



>gb|KEH17957.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=286

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 4/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            +FVL+HG   GAWCWYK+  +++++G+ V+ I+L+++G++P    +I +   Y +PL+ F
Sbjct  32   NFVLIHGGSHGAWCWYKVVTMLKSAGHNVTTIELAASGINPIQVQEIHSISKYYEPLMTF  91

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPPN++VILVGHS GG+S + A  KFPQKIS+A+++ A +L    +    +++    
Sbjct  92   MESLPPNEKVILVGHSLGGVSTSVAMEKFPQKISVAVFVTAYVLSQNLSYPVVLQEQARR  151

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            LS   +        F  G + P T+ LV        +YQ+SP ED TLA  L+RP PI
Sbjct  152  LSSLMDTK----FFFFDGPNKPATARLVGPKFMASKMYQLSPSEDLTLALSLVRPVPI  205



>ref|XP_004304220.1| PREDICTED: putative methylesterase 11, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=387

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 109/183 (60%), Gaps = 13/183 (7%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E  GYKV+ IDL+ +G+  SD N I +  +Y KPL DF
Sbjct  135  HFVLVHGGGFGAWCWYKTIALLEEGGYKVNAIDLTGSGIHSSDTNTIASLSEYVKPLTDF  194

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFT-----SEQDIK  424
            L  LP  ++VILVGH  GG  ++ A   FP K++ AI++AA MLK G +     S+Q   
Sbjct  195  LEKLPEGKKVILVGHDFGGACISYAMELFPFKVAKAIFLAAAMLKNGQSTLDTFSQQATS  254

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            D   DL    +I       +  G + PPT+I + K++ + +L+  SP +D  LA + +RP
Sbjct  255  D---DLMRQAQI-----FLYANGNNQPPTAIDLDKSMLKDLLFNQSPSKDVALASVSMRP  306

Query  605  GPI  613
             P 
Sbjct  307  IPF  309



>ref|XP_009628220.1| PREDICTED: putative methylesterase 11, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=401

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 112/184 (61%), Gaps = 15/184 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L++ SGY+V  IDL+ +G    D+N+I T   Y KPL DF
Sbjct  142  HFVLVHGGGFGAWCWYKTTTLLKESGYQVDAIDLTGSGAHFFDSNNITTLSQYVKPLTDF  201

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD----  427
            L +L  N++VILVGH  GG+ ++ A   +P K+S AI++AA+MLK G    Q+I D    
Sbjct  202  LENLDDNKKVILVGHDIGGVCISYAMELYPSKVSAAIFVAASMLKNG----QNILDMFSV  257

Query  428  --GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
              G+ +L    ++       +  G++ PPT+I   K+L +++L+  +P +D  LA + +R
Sbjct  258  QLGLNNLCQRAQV-----FRYANGKNHPPTAIDYDKSLIKEVLFNQTPTKDVELASVSMR  312

Query  602  PGPI  613
              P 
Sbjct  313  QVPF  316



>ref|XP_006346482.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=273

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = +2

Query  56   VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDD  235
            V+ P    HFVLVH LG GAW WYK+  LM +SG+ V+ IDL ++G++P  A +I  F D
Sbjct  12   VLGPKAKKHFVLVHTLGHGAWSWYKIVALMTSSGHNVTAIDLGASGINPKQALEIPHFSD  71

Query  236  YNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQ  415
            Y  PL++F+ASLP ++ V+LVGHS GG +++ A   FP+KIS+A++++A M      +  
Sbjct  72   YLSPLMEFMASLPADKNVVLVGHSLGGFAISKAMETFPEKISVAVFLSALM-PGPIHNVT  130

Query  416  DIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGML  595
            DI     + +     N V    +  G   PP ++++        +YQ+SP+ED TLA  L
Sbjct  131  DIYTKALNATIVQLDNRV---AYDNGPTNPPATLILGLNYLAASVYQLSPIEDLTLATTL  187

Query  596  LRP  604
            +RP
Sbjct  188  VRP  190



>gb|KDP41318.1| hypothetical protein JCGZ_15725 [Jatropha curcas]
Length=391

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 106/178 (60%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H +LVHG G GAWCWYK+  L+E SG+KV  IDL+ +G   SD N I T   Y KPL+D 
Sbjct  139  HLILVHGGGFGAWCWYKIMTLLEESGFKVDAIDLTGSGTHSSDTNTIATLSHYIKPLIDI  198

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  L   ++VILVGH  GG  ++ A   FP KI+ +++I+ATML  G  S  DI     D
Sbjct  199  LVKLKQGEKVILVGHDIGGACISCAMELFPSKIAKSVFISATMLSNG-QSAFDILSQQTD  257

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D     +V+   +G G+D PPT+I + K   R +L+  +  +D  LA + +RP PI
Sbjct  258  STDLMRQAQVF--LYGNGKDNPPTAIDLDKAFLRDLLFNQTSPKDIALASVSMRPIPI  313



>ref|XP_002310759.2| hypothetical protein POPTR_0007s11740g [Populus trichocarpa]
 gb|EEE91209.2| hypothetical protein POPTR_0007s11740g [Populus trichocarpa]
Length=333

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 110/178 (62%), Gaps = 4/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+   ++++G+ V+ +D++++GV P   +++ +F+DY +PL++F
Sbjct  83   HFVLVHGACHGAWCWYKVSAQLKSAGHNVTALDMAASGVHPKQVHELHSFEDYFEPLMEF  142

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP ++V+LVGHS  G+ ++ A  +FP+KIS A++ AA M     + +   +     
Sbjct  143  MESLPPEERVVLVGHSMSGICISVAMERFPEKISAAVFAAAVMPGPDLSFKAIAEKSSQT  202

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
               + +   V    FG G   PPT++++         Y +SP ED TLA +L+RP PI
Sbjct  203  SVSYMDTQYV----FGNGPGNPPTAVVLGPNYMASRFYHLSPPEDLTLATLLVRPFPI  256



>gb|KJB47436.1| hypothetical protein B456_008G026500 [Gossypium raimondii]
Length=287

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 106/178 (60%), Gaps = 4/178 (2%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            PP HFVLVHG   GAW WYK+  L+++ G+ V+ +DL  +GVDP   N + +  DY KPL
Sbjct  29   PPKHFVLVHGSCHGAWSWYKVVPLLKSGGHNVTALDLGGSGVDPQQVNTLRSISDYIKPL  88

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
             +F+ASLP  ++V+LVGHS GGL+++ A   FP+K+++A+++ A+M          I+  
Sbjct  89   REFMASLPDEEKVVLVGHSLGGLAISQAMEMFPEKVAVAVFVTASMPGPTLNVSILIQKA  148

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            + D     + +  YD     G   PPT+           +YQ+SP EDS LA ML+RP
Sbjct  149  LRDQDSQMDNHYTYDD----GPSSPPTTFTFGPMFLSSKVYQLSPPEDSALASMLMRP  202



>gb|KCW55258.1| hypothetical protein EUGRSUZ_I01184, partial [Eucalyptus grandis]
Length=272

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 111/179 (62%), Gaps = 12/179 (7%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK+  L+ ++G++V+ +DL+++G+D   A  + +  +Y KPL D 
Sbjct  19   HFVLVHGSGHGAWCWYKIATLLRSAGHRVTALDLAASGIDLLQAKSLQSISEYFKPLRDV  78

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM----LKTGFTSEQDIKD  427
            +  L  +++VIL+GHS GGL+++    KFP++I+LA++++A M    L     +++ ++ 
Sbjct  79   MEGLASHERVILIGHSLGGLALSQVMEKFPERIALAVFVSALMPGPELNVSTLNQESLRR  138

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
              P L      +  YD     G + PPT+     T     +YQ+SP+ED TLA MLLRP
Sbjct  139  SPPVLDS----HYTYD----NGPNNPPTTFSFGPTFLASTVYQLSPIEDLTLANMLLRP  189



>ref|XP_003626748.1| Methyl jasmonate esterase [Medicago truncatula]
 gb|AET01224.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=278

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 105/183 (57%), Gaps = 17/183 (9%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  +++ +G+ V+ IDL++ G+ P    +I +   Y +P + F
Sbjct  27   HFVLVHGAFHGAWCWYKVATMLKLAGHNVTTIDLAACGISPIQVQEIHSISQYYEPFMTF  86

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLK-----TGFTSEQDIK  424
            + SLPP ++VILVGHS GG+ ++ A  KFP+KIS+A++I A +L      T F  E   +
Sbjct  87   MESLPPKEKVILVGHSFGGIPLSVAMEKFPKKISVAVFITALVLSENLNFTSFNQENSTR  146

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
             G   L             F  G + PPT+ L    +    LYQ+SP ED TL   L+RP
Sbjct  147  QGESQL------------FFSNGINNPPTASLWGPKIMSSNLYQLSPHEDLTLGLSLVRP  194

Query  605  GPI  613
             PI
Sbjct  195  HPI  197



>ref|XP_010028516.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
Length=284

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 111/179 (62%), Gaps = 12/179 (7%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK+  L+ ++G++V+ +DL+++G+D   A  + +  +Y KPL D 
Sbjct  31   HFVLVHGSGHGAWCWYKIATLLRSAGHRVTALDLAASGIDLLQAKSLQSISEYFKPLRDV  90

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM----LKTGFTSEQDIKD  427
            +  L  +++VIL+GHS GGL+++    KFP++I+LA++++A M    L     +++ ++ 
Sbjct  91   MEGLASHERVILIGHSLGGLALSQVMEKFPERIALAVFVSALMPGPELNVSTLNQESLRR  150

Query  428  GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
              P L      +  YD     G + PPT+     T     +YQ+SP+ED TLA MLLRP
Sbjct  151  SPPVLDS----HYTYD----NGPNNPPTTFSFGPTFLASTVYQLSPIEDLTLANMLLRP  201



>dbj|BAJ88088.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 109/177 (62%), Gaps = 3/177 (2%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VLVHG G GAWCWYK   L+E+SG+KV+ IDL+ +G++ SD N I +  +Y +PL  +L
Sbjct  116  IVLVHGGGFGAWCWYKTMSLLEDSGFKVNAIDLTGSGINSSDTNKISSLSEYAEPLTSYL  175

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
              L   ++ ILVGH  GG  ++ A  KFP K++ A+++ ATML  G  S  DI     D 
Sbjct  176  KGLDDAEKAILVGHDFGGACISHAMEKFPSKVAKAVFLCATMLTNGH-SALDIFQQQMDT  234

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            +  G + +  ++ +  G+D PPT+I + K L R +L+  SP +D +LA + +RP P 
Sbjct  235  N--GMLQKAQELVYSNGKDRPPTAINIDKALVRDLLFNQSPAKDVSLASVSMRPIPF  289



>ref|XP_007199380.1| hypothetical protein PRUPE_ppa025654mg [Prunus persica]
 gb|EMJ00579.1| hypothetical protein PRUPE_ppa025654mg [Prunus persica]
Length=268

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 105/180 (58%), Gaps = 5/180 (3%)
 Frame = +2

Query  68   PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKP  247
            P   HFVLVHG   GAW WYKL  LM++SG+ V+ IDL+++GVDP  A D+ +  DY KP
Sbjct  10   PSKKHFVLVHGSCFGAWSWYKLVTLMKSSGHNVTAIDLAASGVDPQQAKDLQSISDYFKP  69

Query  248  LLDFLASL-PPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIK  424
            L DF+A+L PP+ +VILVGHS GGL+++ A  +FP KISLA+++ A M           +
Sbjct  70   LTDFMAALDPPHDKVILVGHSLGGLAISHAMERFPDKISLAVFVTALMPGPTLNISTLNQ  129

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            +         +    YD     G + PP ++          +YQ+SP ED  L  +L+RP
Sbjct  130  ESFRRQGSLLDSKYTYD----QGPNNPPITLTFGPLFLATNMYQLSPTEDVALGTILMRP  185



>ref|XP_010921786.1| PREDICTED: probable esterase PIR7A [Elaeis guineensis]
Length=308

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 117/183 (64%), Gaps = 16/183 (9%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HF+LVHG+  GAWCWYKL  L+ ++G +V+ +DL+++GV P   +++ +F DY  PL++ 
Sbjct  8    HFILVHGMCHGAWCWYKLATLLRSAGQRVTALDLAASGVHPKRLDELRSFSDYFAPLMEA  67

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTS-----EQDIK  424
            +AS+P  ++V+LVGHS GG  +  A  KFP+K+S+A++++ATM   GF++     EQ+  
Sbjct  68   MASIPSGERVVLVGHSYGGYGIALAAEKFPEKVSVAVFVSATM--PGFSAPLSAIEQEFF  125

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGP--PTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
            +  P   +F       D  F + QD     TSI++     ++ +YQ+ P ED TLA ML+
Sbjct  126  NSHP--PEF-----FMDSKFMISQDPQICSTSIVLGPNYMKEKVYQLCPPEDLTLATMLV  178

Query  599  RPG  607
            RPG
Sbjct  179  RPG  181



>ref|XP_003626737.1| Methyl jasmonate esterase [Medicago truncatula]
 gb|AET01213.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=284

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 111/179 (62%), Gaps = 3/179 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILT-FDDYNKPLLD  256
            HFVLVHG G GAWCWYK+  +++++G+ V+ I+L++ G+ P    +I +    Y++PL+ 
Sbjct  27   HFVLVHGAGHGAWCWYKVATMLKSAGHNVTTIELAACGISPIQVQEIHSSISKYHEPLIS  86

Query  257  FLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIP  436
            F+ SLPP ++VILVGHS GG+ ++ A  KFP+KISLA+++ A ++         +++   
Sbjct  87   FIESLPPKEKVILVGHSFGGIPLSVAMEKFPKKISLAVFVTAFVISENLNFTSLLQENQR  146

Query  437  DLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             L+   +  +   + F  G + PPT +L    L    LYQ+SP ED TL   L+RP PI
Sbjct  147  RLNSSQQ--DPPQLVFSDGPNSPPTGLLFGSKLLASNLYQLSPNEDLTLGSSLVRPHPI  203



>ref|XP_004514835.1| PREDICTED: putative methylesterase 11, chloroplastic-like [Cicer 
arietinum]
Length=370

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 106/181 (59%), Gaps = 9/181 (5%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H+VLVHG G GAWCWYK   L+E SGYKVS IDL+ +GV   D N+I +   Y KPL DF
Sbjct  120  HYVLVHGGGFGAWCWYKTIALLEESGYKVSAIDLTGSGVHSFDTNNITSLSQYVKPLTDF  179

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDI---KDG  430
            L  LP + +VILVGH  GG  ++ A   FP KIS AI+IAA M   G  S  DI   + G
Sbjct  180  LEKLPEDGKVILVGHDFGGACISYAMELFPIKISKAIFIAAAMPTNG-QSTLDIISQQAG  238

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
              DL    +I       +  G D PPT+  + K+L R +L+ +SP +D  LA + +R  P
Sbjct  239  SNDLMPQAQI-----FLYANGNDRPPTAFDLEKSLLRDLLFNLSPTKDVALASVSMRSVP  293

Query  611  I  613
             
Sbjct  294  F  294



>ref|XP_006659045.1| PREDICTED: putative methylesterase 14, chloroplastic-like [Oryza 
brachyantha]
Length=397

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 109/183 (60%), Gaps = 14/183 (8%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VLVHG G GAWCWYK   L+E +G     +DL+ +G+D +D N I T  DY+KPL+D+L
Sbjct  113  IVLVHGEGFGAWCWYKTISLLEEAGLDPIALDLTGSGIDNADINSIATLADYSKPLIDYL  172

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTG------FTSEQDIK  424
              LP N++VILVGHS GG SV+ A  K P+KIS A+++ ATM+K G      F+ E    
Sbjct  173  NKLPENEKVILVGHSCGGASVSYAIEKCPKKISKAVFLTATMVKDGQRPFDVFSEELASA  232

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            D     S F        + +G G+D PPT ++  K   + + +  SP +D+ LA + +RP
Sbjct  233  DVFLQESQF--------LLYGNGKDKPPTGLMFDKQQIKGLYFNQSPSKDTALAAVSMRP  284

Query  605  GPI  613
             P+
Sbjct  285  IPL  287



>gb|AFK46482.1| unknown [Medicago truncatula]
 gb|KEH21703.1| methylesterase [Medicago truncatula]
Length=374

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 106/178 (60%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E SG+KV+ IDL+ +GV   D N+I +   Y KPL +F
Sbjct  124  HFVLVHGGGFGAWCWYKTIALLEESGFKVAAIDLTGSGVHSFDTNNITSLSQYVKPLTNF  183

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L +LP  Q+VILVGH  GG  ++ A   FP KIS A++IAA M   G  S  DI      
Sbjct  184  LENLPEGQKVILVGHDFGGACISYAMELFPLKISKAVFIAAAMPTNG-QSTLDIISQQAG  242

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D   + +     +  G D PPT+  + K+L R++L+ +SP +D  LA + +R  P 
Sbjct  243  SNDL--MPQAQKFLYANGNDHPPTAFDLDKSLLRELLFNLSPTKDVALASVSMRSVPF  298



>ref|XP_008241854.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=277

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 112/192 (58%), Gaps = 10/192 (5%)
 Frame = +2

Query  53   EVVAPPPPP-----HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDAND  217
             +  P P P     HFVLVHG G GAWCWYK+  L+ + G+ V+ +DL+++GV+P     
Sbjct  20   RICTPSPNPDANQKHFVLVHGAGHGAWCWYKVSTLLTSIGHNVTALDLAASGVNPKQVQQ  79

Query  218  ILTFDDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKT  397
            + +  DY +PL+ F+ SLPP ++VILVGHS GG +++ A  KFP+KI +A++  A M   
Sbjct  80   LHSLSDYVEPLMRFMKSLPPKERVILVGHSMGGAALSIAMEKFPKKIYIAVFATAVMTGP  139

Query  398  GFTSEQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDS  577
               +  ++   I +  D  +    YD     G + PPT+ L+   L    +YQ+SP ED 
Sbjct  140  AL-NYLNLSSQILNSRDLMDNQFRYD----RGPNNPPTAALLGPKLMSSSMYQLSPPEDL  194

Query  578  TLAGMLLRPGPI  613
            TLA  L+R  P+
Sbjct  195  TLALSLVRFTPL  206



>ref|XP_009341927.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
 ref|XP_009341930.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
Length=288

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 110/186 (59%), Gaps = 21/186 (11%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYKL  L+ ++G+ V+ +D++++G++P     + +F DY +PL++F
Sbjct  43   HFVLVHGAGVGAWCWYKLATLLNSTGHNVTTLDMAASGINPKQVQQVNSFSDYVEPLIEF  102

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP ++VILVGHS GG S++ A  +FPQKI +A+++ A M               PD
Sbjct  103  MESLPPKERVILVGHSFGGASISIAMERFPQKIYVAVFVTALMPG-------------PD  149

Query  440  LSDFGEINEV------YDIGFGMGQDG--PPTSILVTKTLQRKILYQMSPLEDSTLAGML  595
            L+    +NEV       D  F    +   P TS+L        + YQ+SP ED TLA  L
Sbjct  150  LNYSTVLNEVAGKLNFLDSIFRQDNETGHPQTSVLFGPKFVSSMFYQLSPPEDVTLAISL  209

Query  596  LRPGPI  613
            +R  PI
Sbjct  210  VRFFPI  215



>ref|XP_003552586.1| PREDICTED: putative methylesterase 11, chloroplastic-like [Glycine 
max]
Length=361

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 104/178 (58%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H VLVHG G GAWCWYK   L+E SGYKV+ IDL+ +GV   D N I +   Y KPL DF
Sbjct  111  HIVLVHGGGFGAWCWYKSIALLEESGYKVAAIDLTGSGVSSFDTNIITSLSQYVKPLTDF  170

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  LP  ++VILVGH  GG  ++ A   FP KIS A+++AA ML +G  S  DI      
Sbjct  171  LEKLPEGKKVILVGHDFGGACISYAMEMFPLKISKAVFVAAAMLTSG-QSTLDIISQQAG  229

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D  +  + +   +  G D PPTS  + K+L R +L+  SP +D  LA + +R  P 
Sbjct  230  SNDLMQQAQTFI--YANGNDHPPTSFDMDKSLLRDLLFNQSPTKDIALASVSMRSVPF  285



>ref|XP_010089652.1| hypothetical protein L484_021045 [Morus notabilis]
 gb|EXB38123.1| hypothetical protein L484_021045 [Morus notabilis]
Length=438

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 107/181 (59%), Gaps = 9/181 (5%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E  G+KV+ IDL+ +G+  SD+N I     Y KPL DF
Sbjct  186  HFVLVHGGGFGAWCWYKTIALLEEGGFKVTAIDLTGSGIHSSDSNSITNLSQYVKPLTDF  245

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDI---KDG  430
            L +L   ++VILVGH  GG  ++ A   FP KIS A+++ A MLK G  S  D+   + G
Sbjct  246  LENLAEEEKVILVGHDFGGSCISYAMELFPLKISKAVFLTAAMLKNG-QSTLDMFSQQAG  304

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
              DL    +I       +  G D PPT+I + K+L R +L+  SP +D  LA + +RP P
Sbjct  305  SDDLMRQAQI-----FLYANGNDRPPTAIDLDKSLLRDLLFNQSPSKDIALASVSMRPIP  359

Query  611  I  613
             
Sbjct  360  F  360



>ref|XP_007203473.1| hypothetical protein PRUPE_ppa024619mg, partial [Prunus persica]
 gb|EMJ04672.1| hypothetical protein PRUPE_ppa024619mg, partial [Prunus persica]
Length=252

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 110/183 (60%), Gaps = 15/183 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYKL  L+ ++G+ V+ +DL+++G +P   N +  F DY +PL++F
Sbjct  5    HFVLVHGAGHGAWCWYKLSALLTSAGHNVTALDLAASGDNPKQINQVHCFADYVEPLIEF  64

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP+++VILVGHS GG  ++ A  +FP+KIS A++  AT L  G T        I  
Sbjct  65   MESLPPDERVILVGHSMGGAGISIAMERFPEKISAAVF--ATALMPGPT--------ISY  114

Query  440  LSDFGEINEVYDI-----GFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRP  604
            L+ F E++   +       F  G + PPTS +        +LYQ+SP ED  LA   LR 
Sbjct  115  LTIFEEVSSRLEFMDSQYRFDKGLNNPPTSAIFGPQRMTSVLYQLSPPEDLALALSSLRF  174

Query  605  GPI  613
             P+
Sbjct  175  FPL  177



>ref|XP_009376503.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
Length=288

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 110/186 (59%), Gaps = 21/186 (11%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYKL  L+ ++G+ V+ +D++++G++P     + +F DY +PL++F
Sbjct  43   HFVLVHGAGVGAWCWYKLATLLNSTGHNVTTLDMAASGINPKQVQQVNSFSDYVEPLIEF  102

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SLPP ++VILVGHS GG S++ A  +FPQKI +A+++ A M               PD
Sbjct  103  MESLPPKERVILVGHSFGGASISIAMERFPQKIYVAVFVTALMPG-------------PD  149

Query  440  LSDFGEINEV------YDIGFGMGQDG--PPTSILVTKTLQRKILYQMSPLEDSTLAGML  595
            L+    +NEV       D  F    +   P TS+L        + YQ+SP ED TLA  L
Sbjct  150  LNYSTVLNEVAGKLNFLDSIFRQDNETGHPQTSVLFGPKFVSSMFYQLSPPEDVTLAISL  209

Query  596  LRPGPI  613
            +R  PI
Sbjct  210  VRFFPI  215



>gb|KHN13537.1| Putative esterase [Glycine soja]
Length=361

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 104/178 (58%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H VLVHG G GAWCWYK   L+E SGYKV+ IDL+ +GV   D N I +   Y KPL DF
Sbjct  111  HIVLVHGGGFGAWCWYKSIALLEESGYKVAAIDLTGSGVSSFDTNIITSLSQYVKPLTDF  170

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  LP  ++VILVGH  GG  ++ A   FP KIS A+++AA ML +G  S  DI      
Sbjct  171  LEKLPEGKKVILVGHDFGGACISYAMEMFPLKISKAVFVAAAMLTSG-QSTLDIISQQAG  229

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D  +  + +   +  G D PPTS  + K+L R +L+  SP +D  LA + +R  P 
Sbjct  230  SNDLMQQAQTFI--YANGNDHPPTSFDMDKSLLRDLLFNQSPTKDIALASVSMRSVPF  285



>ref|XP_004232153.1| PREDICTED: putative methylesterase 11, chloroplastic [Solanum 
lycopersicum]
Length=379

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 108/178 (61%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E +G+KV+ +DL+ +G+   D N I +   Y +PL DF
Sbjct  129  HFVLVHGGGFGAWCWYKTIALLEEAGFKVTAVDLTGSGIHSFDTNSIASLSQYVQPLTDF  188

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  L   ++VILVGH  GG  ++ A  + P K+S A+++AA ML +G  S  D+     D
Sbjct  189  LEKLADGEKVILVGHDFGGACISFAMERHPLKVSKAVFVAAAMLTSG-QSALDMFSQKTD  247

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D    ++++   +  G D PPT+I + K+L R +L+  SP +D  LA + +RP P 
Sbjct  248  SNDLMRQSQIFI--YANGNDKPPTAIDLDKSLLRDLLFNHSPAKDVALASVSMRPIPF  303



>ref|XP_002533543.1| Esterase PIR7B, putative [Ricinus communis]
 gb|EEF28846.1| Esterase PIR7B, putative [Ricinus communis]
Length=388

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 107/178 (60%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E +G++V+ IDL+ +G+   D N I++   Y KPL DF
Sbjct  135  HFVLVHGGGFGAWCWYKTIALLEEAGFRVTAIDLTGSGIHSFDTNGIISLSQYVKPLSDF  194

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  L   ++VILVGH  GG  ++ A   FP K S AIYIAA ML  G  S  D+     +
Sbjct  195  LEKLADGEKVILVGHDFGGACISYAMEMFPYKTSKAIYIAAAMLTNG-QSTLDMFSQQGN  253

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D  +  +++    G G   PPT+I + K+L R++L+  SP +D  LA + +RP P 
Sbjct  254  SNDLMKQAQIFVYANGNGH--PPTAIELDKSLLRELLFNQSPTKDVALASVSMRPIPF  309



>ref|XP_002985678.1| hypothetical protein SELMODRAFT_424768 [Selaginella moellendorffii]
 gb|EFJ13256.1| hypothetical protein SELMODRAFT_424768 [Selaginella moellendorffii]
Length=252

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 108/180 (60%), Gaps = 14/180 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG GGGAW W+KL  ++ +SG++V  ++L+++G+D     D+ + DDYN+PLL++
Sbjct  3    HFVLVHGGGGGAWYWFKLVDMLLSSGHEVEALNLAASGIDTRTPADVFSLDDYNQPLLEY  62

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSE---QDIKDG  430
            LA+LP N +VILV HS GG S   AT   P KI+LA+Y+AA         E   + IKD 
Sbjct  63   LAALPENDKVILVSHSLGGRSAAYATELHPDKIALAVYLAAPFCSNHLGPEFWYERIKD-  121

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
                        VYD+ +  G+D  PT+++  K+L     +Q+   ED TL+ ML R  P
Sbjct  122  ----------TSVYDLFYERGKDNLPTAVMKKKSLDPDYAHQLCSSEDRTLSRMLDRAIP  171



>ref|XP_001781125.1| predicted protein [Physcomitrella patens]
 gb|EDQ54073.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 104/180 (58%), Gaps = 6/180 (3%)
 Frame = +2

Query  74   PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLL  253
            P HFV VHG G GAW W+++   +   G+K + IDL+S G D  D N + +F DYN+PL+
Sbjct  6    PAHFVFVHGGGLGAWTWFRVVDFLRKKGHKATAIDLTSCGRDTIDPNTVSSFLDYNQPLV  65

Query  254  DFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGI  433
            DF  +L    +VILVGH  GGLSVT A   F QKI   +++AA ML +GF    ++ +  
Sbjct  66   DFFNTLSSTDKVILVGHDLGGLSVTYAMEHFHQKIQAGVFLAAMMLPSGFPLTLELFELD  125

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
            P +    E        FG G +  PT++ V + +Q ++ Y + P ED  LA +L +P P+
Sbjct  126  PAVGRHIEYT------FGDGINNMPTALYVMEKMQHQVFYHLCPSEDVVLASLLSKPVPL  179



>ref|XP_009800171.1| PREDICTED: putative methylesterase 11, chloroplastic [Nicotiana 
sylvestris]
Length=400

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 110/184 (60%), Gaps = 15/184 (8%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L++ +GY+V  IDL+ +G    D+N+I T   Y KPL DF
Sbjct  142  HFVLVHGGGFGAWCWYKTTTLLKEAGYQVDAIDLTGSGAHFFDSNNITTLSQYVKPLTDF  201

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKD----  427
            L +L   ++VILVGH  GG  ++ A   +P K+S+AI++AA MLK G    Q+I D    
Sbjct  202  LENLDDGKKVILVGHDIGGACISYAMELYPSKVSVAIFVAAAMLKNG----QNILDMFSV  257

Query  428  --GIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLR  601
              G+ +L    ++       +  G++ PPT+I   KTL +++L+  +P +D  LA + +R
Sbjct  258  QLGLNNLCQRAQV-----FRYANGKNNPPTAIDYDKTLLKEVLFNQTPTKDVELASLSMR  312

Query  602  PGPI  613
              P 
Sbjct  313  QVPF  316



>ref|XP_010646596.1| PREDICTED: salicylic acid-binding protein 2 [Vitis vinifera]
Length=261

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 111/188 (59%), Gaps = 26/188 (14%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG   GAWCWYK+  L+ ++G++V+ +DL++AG +    +++ +  DY +PL++F
Sbjct  7    HFVLVHGACHGAWCWYKVATLLRSAGHRVTALDLAAAGANGKRLDELNSISDYYEPLIEF  66

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            + SL   ++VILV HS GG+SV+ A  +FPQKIS+A+++AA M               PD
Sbjct  67   MTSLVTGEKVILVAHSLGGVSVSVAMERFPQKISVAVFVAALMPG-------------PD  113

Query  440  LSDFGEINEVYDI-------------GFGMGQDGPPTSILVTKTLQRKILYQMSPLEDST  580
            L+    I EVY +              F  G + PPTS++        +LYQ+SP ED  
Sbjct  114  LNLPTVIQEVYSLHQRSPGASMDTQYTFDRGPNNPPTSVIFGPEYLAAMLYQLSPPEDLM  173

Query  581  LAGMLLRP  604
            LA ML+RP
Sbjct  174  LATMLMRP  181



>ref|XP_009589631.1| PREDICTED: putative methylesterase 11, chloroplastic [Nicotiana 
tomentosiformis]
Length=378

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 107/178 (60%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L+E +G+KV+ +DL+ +G+   D N I +   Y KPL DF
Sbjct  126  HFVLVHGGGFGAWCWYKTIALLEEAGFKVTAVDLTGSGIHSFDTNSITSLSQYAKPLTDF  185

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  L   + VILVGH  GG  ++ +   +P K+S AI++AATML +G  S  DI      
Sbjct  186  LEKLADGETVILVGHDFGGACISFSMELYPSKVSKAIFVAATMLISG-QSALDIFSDKTI  244

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D    ++V+   +  G D PPT+I + K++ R +L+  SP +D  LA + +RP P 
Sbjct  245  SNDLMRQSQVFI--YASGNDKPPTAIDLDKSVLRDLLFNHSPAKDVALASVSMRPIPF  300



>ref|XP_010921787.1| PREDICTED: probable esterase PIR7A [Elaeis guineensis]
Length=284

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 113/183 (62%), Gaps = 16/183 (9%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HF+LVHG+G GAWCWYKL  L+ ++G +V+ +DL+++G +P   N++ +F DY+ PL++ 
Sbjct  32   HFILVHGMGHGAWCWYKLAPLLRSAGQRVTALDLAASGRNPEPLNELRSFSDYSAPLMEA  91

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKT-----GFTSEQDIK  424
            +AS+P  ++V+LVGHS GG S+  A  KFP+KIS+A+++ A M  T       T E +I+
Sbjct  92   MASIPSGERVVLVGHSHGGYSIALAAEKFPEKISVAVFVTAIMPSTTTPLSTITQEYNIR  151

Query  425  DGIPDLSDFGEINEVYDIGFGMGQDG--PPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
               P+           D  F +GQD     T+I       ++ LY++S  ED TLA  L+
Sbjct  152  HP-PEY--------FLDTKFVIGQDHDISWTTITFGPNYMKERLYRLSAPEDLTLATTLV  202

Query  599  RPG  607
            RPG
Sbjct  203  RPG  205



>ref|NP_001060815.1| Os08g0110000 [Oryza sativa Japonica Group]
 dbj|BAD09533.1| putative PIR7A protein [Oryza sativa Japonica Group]
 dbj|BAF22729.1| Os08g0110000 [Oryza sativa Japonica Group]
 dbj|BAG93620.1| unnamed protein product [Oryza sativa Japonica Group]
Length=398

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VLVHG G GAWCWYK   L+E +G     +DL+ +G+D +D N I T  DY+KPL+D+L
Sbjct  117  IVLVHGEGFGAWCWYKTISLLEEAGLDPIALDLTGSGIDNADTNSIATLADYSKPLIDYL  176

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
              LP N++VILVGHS GG SV+ A  + P+KIS AI++ ATM+K G        + +   
Sbjct  177  NKLPENEKVILVGHSCGGASVSYALEQCPKKISKAIFLTATMVKDGQRPFDVFSEELASA  236

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              F  + E   + +G G+D PPT ++  K   + + +  SP +D+ LA + +RP P+
Sbjct  237  DVF--LQESQLLIYGNGKDKPPTGLMFDKQQIKGLYFNTSPSKDTVLAAVSMRPIPL  291



>ref|XP_004239042.1| PREDICTED: putative methylesterase 11, chloroplastic [Solanum 
lycopersicum]
Length=419

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 109/180 (61%), Gaps = 7/180 (4%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            HFVLVHG G GAWCWYK   L++ SGY V  IDL+ +G    D+N+I T   Y KPL+DF
Sbjct  161  HFVLVHGGGFGAWCWYKTTTLLKESGYHVDAIDLTGSGAHFFDSNNISTLSQYVKPLIDF  220

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQ--DIKDGI  433
            L     +++VILVGH  GG  ++ A   +P K+S AI++AA MLK+G ++     ++ G+
Sbjct  221  LEKFDDDKKVILVGHDIGGACISYAMELYPSKVSAAIFVAAAMLKSGQSTLDMFSVQLGL  280

Query  434  PDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +L    +I       +  G+D PPTSI   K+L +++L+  +P +D  LA + +R  P 
Sbjct  281  NNLCQRAQI-----FRYANGKDQPPTSIDYDKSLVKEVLFNQTPTKDVELASVSMRQVPF  335



>gb|KHN14024.1| Putative esterase [Glycine soja]
Length=366

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 103/178 (58%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H VLVHG G GAWCWYK   L+E SGYKV+ IDL+ +GV   DAN I +   Y KPL +F
Sbjct  116  HVVLVHGGGFGAWCWYKSIALLEESGYKVTAIDLTGSGVSSFDANSITSLSQYVKPLTNF  175

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  L   ++VILVGH  GG+ ++ A   FP KIS A++IAA ML  G  S  DI      
Sbjct  176  LEKLLEGEKVILVGHDFGGVCISYAMEMFPLKISKAVFIAAAMLTNG-QSTLDIISQQAG  234

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D   + +     +  G D PPTS  + K+L R +L+  SP +D  LA + +R  P 
Sbjct  235  SNDL--MRQAQTFVYANGNDHPPTSFDLDKSLSRDLLFNQSPTKDIALACVSMRSVPF  290



>gb|EAZ05349.1| hypothetical protein OsI_27553 [Oryza sativa Indica Group]
Length=399

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VLVHG G GAWCWYK   L+E +G     +DL+ +G+D +D N I T  DY+KPL+D+L
Sbjct  118  IVLVHGEGFGAWCWYKTISLLEEAGLDPIALDLTGSGIDNADTNSIATLADYSKPLIDYL  177

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
              LP N++VILVGHS GG SV+ A  + P+KIS AI++ ATM+K G        + +   
Sbjct  178  NKLPENEKVILVGHSCGGASVSYALEQCPKKISKAIFLTATMVKDGQRPFDVFSEELASA  237

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              F  + E   + +G G+D PPT ++  K   + + +  SP +D+ LA + +RP P+
Sbjct  238  DVF--LQESQLLIYGNGKDKPPTGLMFDKQQIKGLYFNTSPSKDTVLAAVSMRPIPL  292



>gb|EAZ41273.1| hypothetical protein OsJ_25780 [Oryza sativa Japonica Group]
Length=387

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 108/177 (61%), Gaps = 2/177 (1%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
             VLVHG G GAWCWYK   L+E +G     +DL+ +G+D +D N I T  DY+KPL+D+L
Sbjct  117  IVLVHGEGFGAWCWYKTISLLEEAGLDPIALDLTGSGIDNADTNSIATLADYSKPLIDYL  176

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPDL  442
              LP N++VILVGHS GG SV+ A  + P+KIS AI++ ATM+K G        + +   
Sbjct  177  NKLPENEKVILVGHSCGGASVSYALEQCPKKISKAIFLTATMVKDGQRPFDVFSEELASA  236

Query  443  SDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
              F  + E   + +G G+D PPT ++  K   + + +  SP +D+ LA + +RP P+
Sbjct  237  DVF--LQESQLLIYGNGKDKPPTGLMFDKQQIKGLYFNTSPSKDTVLAAVSMRPIPL  291



>emb|CBI32481.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 110/182 (60%), Gaps = 12/182 (7%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  H+VLVHG   GAW WYK+  L+++SG+KV+ +DL+++G++P    D+ +  +Y +PL
Sbjct  10   PVKHYVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISEYFQPL  69

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM----LKTGFTSEQD  418
             DF+ SLP +++V+LVGHS GGL+++ A  KFP+K+S+A+++ A+M    L     +++ 
Sbjct  70   RDFMESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQES  129

Query  419  IKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
            ++   P L             +  G + PPT+           +YQ+SP ED  L  ML+
Sbjct  130  LRRQGPLLDS--------QFTYDNGPNNPPTTFTFGPLFSSLNVYQLSPTEDLALGTMLM  181

Query  599  RP  604
            RP
Sbjct  182  RP  183



>ref|XP_004230826.1| PREDICTED: polyneuridine-aldehyde esterase [Solanum lycopersicum]
 gb|ADK38537.1| methylketone synthase Ia [Solanum lycopersicum]
Length=265

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 111/185 (60%), Gaps = 4/185 (2%)
 Frame = +2

Query  50   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  229
            E+  +P    HFVLVH    GAWCWYK+  LM +SG+ V+ +DL ++G++P  A +I  F
Sbjct  2    EKSTSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALEIPNF  61

Query  230  DDYNKPLLDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTS  409
             DY+ PL++F+ASLP N+++ILVGH+ GGL+++ A   FP+KIS+A++++  M      +
Sbjct  62   SDYSSPLMEFMASLPANEKLILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDA  121

Query  410  EQDIKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAG  589
                      +   G+++    + +  G   PPT+++         +Y +SP+ED  LA 
Sbjct  122  TTVYTKAASAV--IGQLDNC--VTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALAT  177

Query  590  MLLRP  604
             L+RP
Sbjct  178  ALVRP  182



>ref|XP_002284944.1| PREDICTED: methylesterase 10 [Vitis vinifera]
 emb|CBI32475.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 110/182 (60%), Gaps = 12/182 (7%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  H+VLVHG   GAW WYK+  L+++SG+KV+ +DL+++G++P    D+ +  +Y +PL
Sbjct  10   PVKHYVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISEYFQPL  69

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATM----LKTGFTSEQD  418
             DF+ SLP +++V+LVGHS GGL+++ A  KFP+K+S+A+++ A+M    L     +++ 
Sbjct  70   RDFMESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQES  129

Query  419  IKDGIPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLL  598
            ++   P L             +  G + PPT+           +YQ+SP ED  L  ML+
Sbjct  130  LRRQGPLLDS--------QFTYDNGPNNPPTTFTFGPLFSSLNVYQLSPTEDLALGTMLM  181

Query  599  RP  604
            RP
Sbjct  182  RP  183



>ref|XP_006584519.1| PREDICTED: uncharacterized protein LOC100526862 isoform X1 [Glycine 
max]
Length=367

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 103/178 (58%), Gaps = 3/178 (2%)
 Frame = +2

Query  80   HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDF  259
            H VLVHG G GAWCWYK   L+E SGYKV+ IDL+ +GV   DAN I +   Y KPL +F
Sbjct  117  HVVLVHGGGFGAWCWYKSIALLEESGYKVTAIDLTGSGVSSFDANSITSLSQYVKPLTNF  176

Query  260  LASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDGIPD  439
            L  L   ++VILVGH  GG+ ++ A   FP KIS A++IAA ML  G  S  DI      
Sbjct  177  LEKLLEGEKVILVGHDFGGVCISYAMEMFPLKISKAVFIAAAMLTNG-QSTLDIISQQAG  235

Query  440  LSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGPI  613
             +D   + +     +  G D PPTS  + K+L R +L+  SP +D  LA + +R  P 
Sbjct  236  SNDL--MRQAQTFVYANGNDHPPTSFDLDKSLSRDLLFNQSPTKDIALACVSMRSVPF  291



>ref|XP_007156846.1| hypothetical protein PHAVU_002G022300g [Phaseolus vulgaris]
 gb|ESW28840.1| hypothetical protein PHAVU_002G022300g [Phaseolus vulgaris]
Length=262

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +2

Query  83   FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPLLDFL  262
            FVLVHGLG G WCWYKL+ ++E++G+KV+ +DL+++G+ P    DI TF  Y+KPLLD L
Sbjct  15   FVLVHGLGHGGWCWYKLKPVLESAGHKVTVLDLAASGIKPEKIEDIHTFSHYSKPLLDLL  74

Query  263  ASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAA----TMLKTGFTSEQDIKDG  430
            ASL P + ++LVGHS GG+++  A  KFP+KIS A+++AA    T  K  +  EQ     
Sbjct  75   ASLAPTETIVLVGHSFGGMTIALAMDKFPEKISFAVFLAAFVPDTHHKPSYVLEQ-----  129

Query  431  IPDLSDFGEINEVYDIGFGMGQDGPPTSILVTKTLQRKILYQMSPLEDSTLAGMLLRPGP  610
                 D   I+E  D    + ++G  T+ L         +YQ    ED  LA  L+R G 
Sbjct  130  ---FCDRYPISEWMDC--EVSKNGSKTTTLFGTKFLSTAVYQFCSTEDLELAKTLVRKGS  184

Query  611  I  613
            +
Sbjct  185  L  185



>ref|XP_010440116.1| PREDICTED: probable pheophorbidase isoform X3 [Camelina sativa]
Length=159

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +2

Query  71   PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFDDYNKPL  250
            P  HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +   D YN+PL
Sbjct  9    PVIHFVFVHGASHGAWCWYKLTTLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYNRPL  68

Query  251  LDFLASLPPNQQVILVGHSAGGLSVTDATHKFPQKISLAIYIAATMLKTGFTSEQDIKDG  430
               L++LPP+ +VILVGHS GG SVTDA  KF  KIS+AIY+AA+M++ G T    +   
Sbjct  69   YSLLSALPPSHKVILVGHSIGGGSVTDALCKFTNKISMAIYLAASMVRPGSTPSPHLSSN  128

Query  431  IPDLSDFGEINEVYDIGFGMGQD  499
            +   +D GE  E+++  +G  ++
Sbjct  129  MH--ADAGE-EEIWEFTYGEAKN  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660