BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017C02 470 bp,:Filtered

Length=470
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN41746.1|  hypothetical protein glysoja_003486                     127   8e-35   Glycine soja [wild soybean]
gb|AFK45486.1|  unknown                                                 127   8e-35   Lotus japonicus
gb|ACU15227.1|  unknown                                                 125   4e-34   Glycine max [soybeans]
ref|XP_009385879.1|  PREDICTED: zinc finger protein 706-like            125   7e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953052.1|  PREDICTED: uncharacterized protein LOC101771525    124   2e-33   
ref|XP_002452424.1|  hypothetical protein SORBIDRAFT_04g025570          124   2e-33   Sorghum bicolor [broomcorn]
ref|XP_007158114.1|  hypothetical protein PHAVU_002G125300g             123   3e-33   Phaseolus vulgaris [French bean]
ref|XP_004148981.1|  PREDICTED: uncharacterized protein LOC101206237    123   4e-33   
gb|EPS73739.1|  hypothetical protein M569_01018                         122   6e-33   Genlisea aurea
ref|XP_006854230.1|  hypothetical protein AMTR_s00048p00225630          122   7e-33   
emb|CDP19520.1|  unnamed protein product                                120   3e-32   Coffea canephora [robusta coffee]
emb|CBI29236.3|  unnamed protein product                                120   4e-32   Vitis vinifera
gb|ACG26954.1|  hypothetical protein                                    119   1e-31   Zea mays [maize]
ref|XP_002519888.1|  conserved hypothetical protein                     119   2e-31   
gb|KDP39739.1|  hypothetical protein JCGZ_02759                         118   2e-31   Jatropha curcas
ref|XP_006432829.1|  hypothetical protein CICLE_v10003066mg             117   1e-30   Citrus clementina
ref|XP_004512363.1|  PREDICTED: uncharacterized protein LOC101502200    116   2e-30   
ref|XP_003612571.1|  Zinc finger protein                                115   5e-30   Medicago truncatula
gb|EAY86632.1|  hypothetical protein OsI_08012                          115   5e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006368272.1|  hypothetical protein POPTR_0001s01165g             114   7e-30   Populus trichocarpa [western balsam poplar]
gb|KJB24994.1|  hypothetical protein B456_004G175200                    114   1e-29   Gossypium raimondii
gb|ABK23810.1|  unknown                                                 113   2e-29   Picea sitchensis
ref|XP_010112998.1|  hypothetical protein L484_022722                   110   4e-28   Morus notabilis
ref|XP_007040928.1|  Uncharacterized protein TCM_016739                 109   6e-28   Theobroma cacao [chocolate]
ref|XP_007209783.1|  hypothetical protein PRUPE_ppa013644mg             110   7e-28   Prunus persica
ref|XP_002967959.1|  hypothetical protein SELMODRAFT_408914             112   2e-27   Selaginella moellendorffii
gb|EYU37464.1|  hypothetical protein MIMGU_mgv1a0175392mg             80.5    7e-17   Erythranthe guttata [common monkey flower]
gb|KHN11813.1|  hypothetical protein glysoja_006266                   80.1    1e-16   Glycine soja [wild soybean]
gb|EFA83783.1|  hypothetical protein PPL_02851                        77.0    3e-15   Polysphondylium pallidum PN500
dbj|GAM28775.1|  hypothetical protein SAMD00019534_119510             73.6    5e-14   Acytostelium subglobosum LB1
gb|AFW72259.1|  hypothetical protein ZEAMMB73_015596                  71.6    2e-13   Zea mays [maize]
gb|ACU14534.1|  unknown                                               71.2    4e-13   Glycine max [soybeans]
emb|CEG01387.1|  Zinc finger protein 706                              68.9    3e-12   Ostreococcus tauri
ref|XP_002775737.1|  zinc finger protein, putative                    65.9    3e-11   Perkinsus marinus ATCC 50983
ref|XP_002769016.1|  zinc finger protein, putative                    65.9    3e-11   Perkinsus marinus ATCC 50983
ref|XP_001751855.1|  predicted protein                                67.0    4e-11   Physcomitrella patens
ref|XP_002769882.1|  zinc finger protein, putative                    63.9    2e-10   Perkinsus marinus ATCC 50983
ref|XP_003080665.1|  unnamed protein product                          62.8    7e-10   Ostreococcus tauri
gb|EMS22383.1|  zinc finger protein 706                               60.1    4e-09   Rhodotorula toruloides NP11
emb|CEG80878.1|  hypothetical protein RMATCC62417_15144               60.1    4e-09   Rhizopus microsporus
emb|CEG69138.1|  hypothetical protein RMATCC62417_05266               58.2    2e-08   Rhizopus microsporus
emb|CEI94687.1|  hypothetical protein RMCBS344292_08892               57.8    2e-08   Rhizopus microsporus
gb|EXX68719.1|  hypothetical protein RirG_102600                      57.4    4e-08   Rhizophagus irregularis DAOM 197198w
ref|XP_007410939.1|  hypothetical protein MELLADRAFT_87677            54.7    4e-07   Melampsora larici-populina 98AG31
ref|XP_007902458.1|  PREDICTED: zinc finger protein 706               53.5    9e-07   Callorhinchus milii [Australian ghost shark]
dbj|GAN11900.1|  zinc finger protein                                  53.5    9e-07   Mucor ambiguus
ref|NP_001086088.1|  zinc finger protein 706, gene 2                  52.8    2e-06   Xenopus laevis [clawed frog]
ref|XP_004989021.1|  hypothetical protein PTSG_12994                  52.4    2e-06   Salpingoeca rosetta
ref|XP_003058394.1|  predicted protein                                51.2    5e-06   Micromonas pusilla CCMP1545
ref|XP_005988561.1|  PREDICTED: zinc finger protein 706-like isof...  51.2    6e-06   Latimeria chalumnae
ref|NP_001016744.1|  zinc finger protein 706, gene 2                  50.8    7e-06   Xenopus tropicalis [western clawed frog]
emb|CDS31145.1|  zinc finger protein 706, gene 2                      50.8    8e-06   Hymenolepis microstoma
ref|XP_005988560.1|  PREDICTED: zinc finger protein 706-like isof...  51.2    8e-06   Latimeria chalumnae
ref|XP_003965891.1|  PREDICTED: zinc finger protein 706-like          50.8    9e-06   
gb|EPB91274.1|  hypothetical protein HMPREF1544_01790                 50.1    1e-05   Mucor circinelloides f. circinelloides 1006PhL
gb|ACB47093.1|  SJCHGC02769 protein                                   50.1    2e-05   Schistosoma japonicum
ref|NP_001165203.1|  zinc finger protein 706, gene 2                  50.1    2e-05   Xenopus laevis [clawed frog]
ref|XP_009063333.1|  hypothetical protein LOTGIDRAFT_195511           49.3    3e-05   Lottia gigantea
gb|AAX30290.1|  SJCHGC02770 protein                                   48.9    4e-05   Schistosoma japonicum
ref|NP_001041452.1|  zinc finger protein Ci-ZF(C2H2)-144              48.9    4e-05   Ciona intestinalis [sea vase]
ref|XP_009016379.1|  hypothetical protein HELRODRAFT_77520            48.5    6e-05   Helobdella robusta
gb|EYU37465.1|  hypothetical protein MIMGU_mgv1a0175391mg             47.8    6e-05   Erythranthe guttata [common monkey flower]
ref|XP_007571807.1|  PREDICTED: zinc finger protein 706-like          48.1    6e-05   Poecilia formosa
dbj|GAK65019.1|  zinc finger protein                                  48.1    7e-05   Moesziomyces antarcticus
ref|XP_004073848.1|  PREDICTED: zinc finger protein 706-like          48.1    7e-05   Oryzias latipes [Japanese rice fish]
ref|XP_005797449.1|  PREDICTED: zinc finger protein 706-like          48.1    7e-05   Xiphophorus maculatus
ref|XP_004549218.1|  PREDICTED: zinc finger protein 706-like isof...  48.1    9e-05   
gb|ETS62551.1|  zinc finger protein                                   48.5    9e-05   Moesziomyces aphidis DSM 70725
ref|XP_008420312.1|  PREDICTED: zinc finger protein 706-like          47.8    1e-04   Poecilia reticulata
gb|ACQ58449.1|  Zinc finger protein 706                               47.8    1e-04   Anoplopoma fimbria
ref|XP_010744968.1|  PREDICTED: zinc finger protein 706-like          47.8    1e-04   Larimichthys crocea [croceine croaker]
ref|XP_003444149.1|  PREDICTED: zinc finger protein 706-like          47.8    1e-04   Oreochromis niloticus
ref|XP_004549219.1|  PREDICTED: zinc finger protein 706-like isof...  47.8    1e-04   Maylandia zebra
ref|NP_991175.1|  zinc finger protein 706                             47.4    1e-04   Danio rerio [leopard danio]
gb|KGB38245.1|  Zinc finger protein 706                               47.4    1e-04   Schistosoma haematobium
ref|XP_007550529.1|  PREDICTED: zinc finger protein 706 isoform X1    47.4    1e-04   Poecilia formosa
emb|CCD80177.1|  hypothetical protein Smp_039970                      47.0    2e-04   Schistosoma mansoni
ref|XP_008329724.1|  PREDICTED: zinc finger protein 706-like isof...  47.0    2e-04   Cynoglossus semilaevis
dbj|GAA37349.2|  zinc finger protein 706                              47.4    2e-04   Clonorchis sinensis [oriental liver fluke]
ref|XP_008329723.1|  PREDICTED: zinc finger protein 706-like isof...  47.0    2e-04   Cynoglossus semilaevis
ref|XP_010750640.1|  PREDICTED: zinc finger protein 706               46.2    3e-04   Larimichthys crocea [croceine croaker]
gb|AEA51046.1|  zinc finger protein 706                               46.2    3e-04   Oryzias melastigma [Java medaka]
ref|XP_010789551.1|  PREDICTED: zinc finger protein 706-like          46.2    4e-04   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007230881.1|  PREDICTED: zinc finger protein 706-like          46.2    4e-04   Astyanax mexicanus [blind cave fish]
ref|XP_003379576.1|  conserved domain protein                         47.4    4e-04   Trichinella spiralis
ref|XP_010794229.1|  PREDICTED: zinc finger protein 706-like          45.8    4e-04   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001843968.1|  conserved hypothetical protein                   45.8    5e-04   Culex quinquefasciatus
ref|XP_004077663.1|  PREDICTED: zinc finger protein 706-like          45.8    5e-04   Oryzias latipes [Japanese rice fish]
ref|XP_008290257.1|  PREDICTED: zinc finger protein 706 isoform X2    45.8    5e-04   Stegastes partitus
gb|ENN77575.1|  hypothetical protein YQE_05871                        45.8    5e-04   Dendroctonus ponderosae
dbj|GAC74660.1|  hypothetical protein PANT_12c00080                   48.9    5e-04   Moesziomyces antarcticus T-34
ref|XP_002602402.1|  hypothetical protein BRAFLDRAFT_117036           45.8    6e-04   Branchiostoma floridae
ref|XP_008290244.1|  PREDICTED: zinc finger protein 706 isoform X1    45.8    6e-04   Stegastes partitus
ref|XP_005803519.1|  PREDICTED: zinc finger protein 706-like          45.4    7e-04   Xiphophorus maculatus
ref|XP_004706966.1|  PREDICTED: zinc finger protein 706-like          45.4    8e-04   
emb|CBQ70664.1|  conserved hypothetical protein                       45.4    8e-04   Sporisorium reilianum SRZ2
ref|XP_008431130.1|  PREDICTED: zinc finger protein 706 isoform X1    45.8    8e-04   Poecilia reticulata
gb|KHN84708.1|  Zinc finger protein                                   45.1    8e-04   Toxocara canis
gb|EST06161.1|  hypothetical protein PSEUBRA_SCAF3g03697              45.1    9e-04   Kalmanozyma brasiliensis GHG001
emb|CDH48709.1|  predicted protein                                    45.1    9e-04   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004560098.1|  PREDICTED: zinc finger protein 706-like          45.1    9e-04   Maylandia zebra
ref|XP_007550531.1|  PREDICTED: zinc finger protein 706 isoform X2    45.1    0.001   Poecilia formosa



>gb|KHN41746.1| hypothetical protein glysoja_003486 [Glycine soja]
Length=68

 Score =   127 bits (319),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++NAE+NQKGKGSQ+EARAVGLKVICPICKAQLANQNQLVDHY SKHPK
Sbjct  1    MTRGKQKIEAQKRNAERNQKGKGSQLEARAVGLKVICPICKAQLANQNQLVDHYASKHPK  60

Query  242  EKPPSNS  262
            EKPP+ S
Sbjct  61   EKPPAES  67



>gb|AFK45486.1| unknown [Lotus japonicus]
Length=68

 Score =   127 bits (319),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ+KNAEKNQKGKGSQ+EARAVGLKVICPICKAQLANQ QLVDHYGSKHPK
Sbjct  1    MTRGKQKIEAQKKNAEKNQKGKGSQLEARAVGLKVICPICKAQLANQKQLVDHYGSKHPK  60

Query  242  EKPPSNS  262
            E+PP+ S
Sbjct  61   EEPPAES  67



>gb|ACU15227.1| unknown [Glycine max]
Length=68

 Score =   125 bits (315),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++NAE+NQKGKGSQ+EARAVGLKVICPICKA LANQNQLVDHY SKHPK
Sbjct  1    MTRGKQKIEAQKRNAERNQKGKGSQLEARAVGLKVICPICKAHLANQNQLVDHYASKHPK  60

Query  242  EKPPSNS  262
            EKPP+ S
Sbjct  61   EKPPAES  67



>ref|XP_009385879.1| PREDICTED: zinc finger protein 706-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   125 bits (315),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQR+NAE+NQK KGSQ+EARAVGLKVICPICK QLAN NQLVDHYGSKHPK
Sbjct  25   MTRGKQKIEAQRRNAERNQKPKGSQLEARAVGLKVICPICKVQLANHNQLVDHYGSKHPK  84

Query  242  EKPPSNS  262
            EKPPS S
Sbjct  85   EKPPSES  91



>ref|XP_004953052.1| PREDICTED: uncharacterized protein LOC101771525 [Setaria italica]
Length=69

 Score =   124 bits (311),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKI+AQR+NAEKNQK KGSQIEARAVGLKV+CPICK QLAN+ QL DHYGSKHPK
Sbjct  1    MTRGKQKIDAQRRNAEKNQKAKGSQIEARAVGLKVVCPICKVQLANEKQLTDHYGSKHPK  60

Query  242  EKPPSNS  262
            EKPPS S
Sbjct  61   EKPPSTS  67



>ref|XP_002452424.1| hypothetical protein SORBIDRAFT_04g025570 [Sorghum bicolor]
 gb|EES05400.1| hypothetical protein SORBIDRAFT_04g025570 [Sorghum bicolor]
Length=70

 Score =   124 bits (310),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKI+AQR+NAE+NQK KGSQ+EARAVGLKV+CPICK QLAN+ QL+DHYGSKHPK
Sbjct  1    MTRGKQKIDAQRRNAERNQKSKGSQLEARAVGLKVVCPICKVQLANEKQLIDHYGSKHPK  60

Query  242  EKPPSNS  262
            EKPPS S
Sbjct  61   EKPPSTS  67



>ref|XP_007158114.1| hypothetical protein PHAVU_002G125300g [Phaseolus vulgaris]
 gb|ESW30108.1| hypothetical protein PHAVU_002G125300g [Phaseolus vulgaris]
Length=68

 Score =   123 bits (308),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++NAEKNQK KGSQ+EARAVGLKVICPICK QLANQNQL DHY SKHPK
Sbjct  1    MTRGKQKIEAQKRNAEKNQKSKGSQLEARAVGLKVICPICKVQLANQNQLADHYASKHPK  60

Query  242  EKPPSNSG  265
            EKPP+ S 
Sbjct  61   EKPPAESS  68



>ref|XP_004148981.1| PREDICTED: uncharacterized protein LOC101206237 [Cucumis sativus]
 ref|XP_004164547.1| PREDICTED: uncharacterized protein LOC101231828 [Cucumis sativus]
Length=68

 Score =   123 bits (308),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++NAEKNQK KGSQ+EARAV LKVICPICK QLANQNQL DHYGSKHPK
Sbjct  1    MTRGKQKIEAQKRNAEKNQKPKGSQLEARAVALKVICPICKVQLANQNQLGDHYGSKHPK  60

Query  242  EKPPSNSG  265
            EKPPS SG
Sbjct  61   EKPPSESG  68



>gb|EPS73739.1| hypothetical protein M569_01018 [Genlisea aurea]
Length=68

 Score =   122 bits (307),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ+KN+EKNQK KGSQ+EARAVGLKV+CPICK QLANQ QLVDHYGSKHPK
Sbjct  1    MTRGKQKIEAQKKNSEKNQKAKGSQLEARAVGLKVVCPICKVQLANQKQLVDHYGSKHPK  60

Query  242  EKPPSNS  262
            E PP NS
Sbjct  61   ENPPGNS  67



>ref|XP_006854230.1| hypothetical protein AMTR_s00048p00225630 [Amborella trichopoda]
 gb|ERN15697.1| hypothetical protein AMTR_s00048p00225630 [Amborella trichopoda]
Length=68

 Score =   122 bits (306),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQRKNAE+N K KGSQ+EARAV LK  CPICK QLANQNQLVDHY SKHPK
Sbjct  1    MTRGKQKIEAQRKNAERNSKAKGSQLEARAVALKSSCPICKVQLANQNQLVDHYASKHPK  60

Query  242  EKPPSNSG  265
            EKPPS+SG
Sbjct  61   EKPPSDSG  68



>emb|CDP19520.1| unnamed protein product [Coffea canephora]
Length=68

 Score =   120 bits (302),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++ AE+NQK KGSQ+EARAV LKV+CPICK QLAN+NQL DHYGSKHPK
Sbjct  1    MTRGKQKIEAQKRKAERNQKPKGSQLEARAVALKVVCPICKVQLANENQLNDHYGSKHPK  60

Query  242  EKPPSNSG  265
            EKPPSNSG
Sbjct  61   EKPPSNSG  68



>emb|CBI29236.3| unnamed protein product [Vitis vinifera]
Length=68

 Score =   120 bits (301),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQR+NAE+NQK KGSQ EARAV LK+ CPICK QLANQNQL DHY SKHPK
Sbjct  1    MTRGKQKIEAQRRNAERNQKPKGSQFEARAVALKITCPICKVQLANQNQLGDHYSSKHPK  60

Query  242  EKPPSNSG  265
            EKPPS+SG
Sbjct  61   EKPPSDSG  68



>gb|ACG26954.1| hypothetical protein [Zea mays]
 gb|ACG34572.1| hypothetical protein [Zea mays]
 gb|ACG36214.1| hypothetical protein [Zea mays]
 gb|ACG44554.1| hypothetical protein [Zea mays]
 gb|AFW72258.1| hypothetical protein ZEAMMB73_015596 [Zea mays]
Length=70

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKI+AQR+NAE+NQK KGSQ+EARAVGLK++C ICK QLAN+ QL DHYGSKHPK
Sbjct  1    MTRGKQKIDAQRRNAERNQKSKGSQLEARAVGLKIVCSICKVQLANEKQLTDHYGSKHPK  60

Query  242  EKPPSNS  262
            EKPPS S
Sbjct  61   EKPPSTS  67



>ref|XP_002519888.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42492.1| conserved hypothetical protein [Ricinus communis]
Length=68

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQR+NAE+NQK KGSQ+EARAV LKVICPICK QLAN NQL DHY SKHPK
Sbjct  1    MTRGKQKIEAQRRNAERNQKPKGSQLEARAVALKVICPICKTQLANHNQLGDHYASKHPK  60

Query  242  EKPPSNSG  265
            EKPPS S 
Sbjct  61   EKPPSESS  68



>gb|KDP39739.1| hypothetical protein JCGZ_02759 [Jatropha curcas]
Length=68

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQRKNAE+NQK KGSQ+EARAV LKV CPICKAQLAN NQL DHY SKHPK
Sbjct  1    MTRGKQKIEAQRKNAERNQKAKGSQLEARAVALKVSCPICKAQLANHNQLGDHYSSKHPK  60

Query  242  EKPPSNSG  265
            EKPP+ S 
Sbjct  61   EKPPAESS  68



>ref|XP_006432829.1| hypothetical protein CICLE_v10003066mg [Citrus clementina]
 gb|ESR46069.1| hypothetical protein CICLE_v10003066mg [Citrus clementina]
Length=68

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++NAE+NQK KGSQIEARAV LKV CPICKAQLANQNQ+ DHY SKHPK
Sbjct  1    MTRGKQKIEAQKRNAERNQKPKGSQIEARAVALKVSCPICKAQLANQNQIGDHYASKHPK  60

Query  242  EKPPSNSG  265
            EKPP+ S 
Sbjct  61   EKPPTESS  68



>ref|XP_004512363.1| PREDICTED: uncharacterized protein LOC101502200 [Cicer arietinum]
Length=68

 Score =   116 bits (291),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++N+EKNQK KGSQ+EARAVGLK+ CPICK QLAN NQL DHY SKHPK
Sbjct  1    MTRGKQKIEAQKRNSEKNQKSKGSQLEARAVGLKLTCPICKVQLANPNQLADHYASKHPK  60

Query  242  EKPPSNSG  265
            EKPP+ S 
Sbjct  61   EKPPAESS  68



>ref|XP_003612571.1| Zinc finger protein [Medicago truncatula]
 gb|AES95529.1| zinc finger protein, putative [Medicago truncatula]
Length=68

 Score =   115 bits (287),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQ++NAEKNQK KGSQIEAR  GLK+ CPICK QLAN NQL DHY SKHPK
Sbjct  1    MTRGKQKIEAQKRNAEKNQKSKGSQIEARGAGLKITCPICKVQLANPNQLADHYASKHPK  60

Query  242  EKPPSNS  262
            EKPP+ S
Sbjct  61   EKPPAES  67



>gb|EAY86632.1| hypothetical protein OsI_08012 [Oryza sativa Indica Group]
 gb|EAZ23766.1| hypothetical protein OsJ_07473 [Oryza sativa Japonica Group]
Length=78

 Score =   115 bits (288),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 63/77 (82%), Gaps = 10/77 (13%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICK----------AQLANQNQL  211
            MTRGKQKI+AQR+NAEKNQK KGSQ+EARAVGLKVICPICK           QLAN+ QL
Sbjct  1    MTRGKQKIDAQRRNAEKNQKSKGSQLEARAVGLKVICPICKYKYHYKAFSPVQLANEKQL  60

Query  212  VDHYGSKHPKEKPPSNS  262
            +DHYGSKHPKEKPPS S
Sbjct  61   IDHYGSKHPKEKPPSPS  77



>ref|XP_006368272.1| hypothetical protein POPTR_0001s01165g [Populus trichocarpa]
 gb|ERP64841.1| hypothetical protein POPTR_0001s01165g [Populus trichocarpa]
Length=68

 Score =   114 bits (286),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQRKNAE+NQK KGSQ EARAV LKV C ICK QLAN NQL DHY SKHPK
Sbjct  1    MTRGKQKIEAQRKNAERNQKSKGSQFEARAVALKVTCSICKVQLANSNQLGDHYASKHPK  60

Query  242  EKPPSNSG  265
            EKPP+ S 
Sbjct  61   EKPPAESS  68



>gb|KJB24994.1| hypothetical protein B456_004G175200 [Gossypium raimondii]
Length=68

 Score =   114 bits (285),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQR+NAEKNQK KGSQ+EARAV LKV CPICK QLAN+ QL DHYGSKHPK
Sbjct  1    MTRGKQKIEAQRRNAEKNQKAKGSQLEARAVALKVSCPICKVQLANEKQLGDHYGSKHPK  60

Query  242  EKPPSNS  262
            E PP+ S
Sbjct  61   ENPPAVS  67



>gb|ABK23810.1| unknown [Picea sitchensis]
Length=68

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQR+NAEKNQK KGSQ EARA  LK  CPICK QLANQNQ+ DHY SKHPK
Sbjct  1    MTRGKQKIEAQRRNAEKNQKAKGSQFEARAAALKFTCPICKVQLANQNQIGDHYSSKHPK  60

Query  242  EKPPSNS  262
            EKPP  S
Sbjct  61   EKPPPQS  67



>ref|XP_010112998.1| hypothetical protein L484_022722 [Morus notabilis]
 gb|EXC35169.1| hypothetical protein L484_022722 [Morus notabilis]
Length=67

 Score =   110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQR+NAE+NQK KGSQ+EARAV LK  CPICK QLAN  QL DHY SKHPK
Sbjct  1    MTRGKQKIEAQRRNAERNQKPKGSQLEARAVALKTSCPICKVQLANPKQLGDHYASKHPK  60

Query  242  EKPPSNS  262
            EKPPS +
Sbjct  61   EKPPSEA  67



>ref|XP_007040928.1| Uncharacterized protein TCM_016739 [Theobroma cacao]
 gb|EOY25429.1| Uncharacterized protein TCM_016739 [Theobroma cacao]
Length=68

 Score =   109 bits (273),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            MTRGKQKIEAQR+NAEKNQK KGSQ+EARAV LK  CPICK QLAN  QL DHY SKHPK
Sbjct  1    MTRGKQKIEAQRRNAEKNQKPKGSQMEARAVALKASCPICKVQLANAKQLGDHYTSKHPK  60

Query  242  EKPPSNSG  265
            E+PP+ S 
Sbjct  61   ERPPAESS  68



>ref|XP_007209783.1| hypothetical protein PRUPE_ppa013644mg [Prunus persica]
 gb|EMJ10982.1| hypothetical protein PRUPE_ppa013644mg [Prunus persica]
Length=111

 Score =   110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +2

Query  38   SCGENVR--EMTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQL  211
            S  E VR  +MTRGKQKIEAQ++NAEKNQK KGSQ EARAV LK+ CPICK QLAN  QL
Sbjct  34   SLRERVRPGKMTRGKQKIEAQKRNAEKNQKQKGSQFEARAVALKITCPICKVQLANPKQL  93

Query  212  VDHYGSKHPKEKPPSNS  262
             DHY SKHP+EKPP+ S
Sbjct  94   GDHYASKHPREKPPAES  110



>ref|XP_002967959.1| hypothetical protein SELMODRAFT_408914 [Selaginella moellendorffii]
 gb|EFJ31306.1| hypothetical protein SELMODRAFT_408914 [Selaginella moellendorffii]
Length=209

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  47   ENVREMTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYG  226
            E  R+MTRGKQKIEAQ++NAE+NQK KGSQIEARA  LK+ CPICK+QLAN NQL DH+ 
Sbjct  133  EVARDMTRGKQKIEAQKRNAERNQKPKGSQIEARAAALKINCPICKSQLANYNQLRDHFA  192

Query  227  SKHPKEKPPSNS  262
            SKHPKE PP ++
Sbjct  193  SKHPKEIPPPDT  204



>gb|EYU37464.1| hypothetical protein MIMGU_mgv1a0175392mg, partial [Erythranthe 
guttata]
Length=41

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICK  184
            MTRGKQKIEAQ+KNAEKNQKGKGSQIEARAVGLKVICPICK
Sbjct  1    MTRGKQKIEAQKKNAEKNQKGKGSQIEARAVGLKVICPICK  41



>gb|KHN11813.1| hypothetical protein glysoja_006266 [Glycine soja]
Length=58

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            MTRGKQKIEAQ++NAE+NQKGKGSQ+EARAVGLKVICPICK QL     L+   G  H
Sbjct  1    MTRGKQKIEAQKRNAERNQKGKGSQLEARAVGLKVICPICK-QLLKVKALLMIQGGWH  57



>gb|EFA83783.1| hypothetical protein PPL_02851 [Polysphondylium pallidum PN500]
Length=69

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHP  238
            MTRGKQKI+AQ++N EKNQ  KGSQ+E RA   K+ C IC A L ++NQ+  HY SKHP
Sbjct  1    MTRGKQKIDAQKRNQEKNQPAKGSQLEHRAAAFKIQCNICMAMLTHENQVNQHYESKHP  59



>dbj|GAM28775.1| hypothetical protein SAMD00019534_119510 [Acytostelium subglobosum 
LB1]
Length=68

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHP  238
            MTRGKQKI+AQ++N EK Q  KGSQIE RA   K+ C +C A + ++NQ+  HY SKHP
Sbjct  1    MTRGKQKIDAQKRNQEKQQDQKGSQIEHRAAAFKLQCNVCMANITHENQVAQHYESKHP  59



>gb|AFW72259.1| hypothetical protein ZEAMMB73_015596 [Zea mays]
Length=61

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICK  184
            MTRGKQKI+AQR+NAE+NQK KGSQ+EARAVGLK++C ICK
Sbjct  1    MTRGKQKIDAQRRNAERNQKSKGSQLEARAVGLKIVCSICK  41



>gb|ACU14534.1| unknown [Glycine max]
Length=72

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  235  MF*SIMIHKLILVG*LCLADGADDFEANSSGFDLRPFALLILLRVFSLRFDLLLSPCHL  59
            MF SIMI+KL+L+  L LADGADDFEAN SG +LR  +LLI L V  LRFDLLLSP HL
Sbjct  1    MFGSIMINKLVLICKLGLADGADDFEANGSGLELRALSLLIPLCVSLLRFDLLLSPRHL  59



>emb|CEG01387.1| Zinc finger protein 706 [Ostreococcus tauri]
Length=71

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQ-KGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHP  238
            M RG  K  AQ +NA+K+  K K S+I A A  LKV CP+CK QL N +QL DHY SKHP
Sbjct  1    MVRGAAKAIAQERNAKKHSGKDKKSEIGAGAKALKVTCPMCKLQLINHHQLKDHYASKHP  60

Query  239  KEK-PPSNS  262
            KE  PP+ S
Sbjct  61   KETCPPAES  69



>ref|XP_002775737.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
 gb|EER07553.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
Length=73

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKG--KGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            M RG+QK E+QRKNA K  K   KGSQ+  +   LK+ CP CK Q+ N   L  H+ SKH
Sbjct  1    MARGQQKAESQRKNALKKAKDAHKGSQLAGQKAALKMTCPQCKLQMTNYKVLTQHFESKH  60

Query  236  PKEK-PPSNS  262
            PKE  PP +S
Sbjct  61   PKETCPPESS  70



>ref|XP_002769016.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
 gb|EER01734.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
Length=73

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKG--KGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            M RG+QK E+QRKNA K  K   KGSQ+  +   LK+ CP CK Q+ N   L  H+ SKH
Sbjct  1    MARGQQKAESQRKNALKKAKDAHKGSQLAGQKAALKMTCPQCKLQMTNYKVLTQHFESKH  60

Query  236  PKEK-PPSNS  262
            PKE  PP +S
Sbjct  61   PKESCPPESS  70



>ref|XP_001751855.1| predicted protein [Physcomitrella patens]
 gb|EDQ83290.1| predicted protein [Physcomitrella patens]
Length=152

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICK--AQLANQNQLVDH  220
            M RGKQKIEAQ++ AE+N+K KGSQIEAR+ GLK IC +CK   +L + ++L+ H
Sbjct  1    MVRGKQKIEAQKRAAERNEKPKGSQIEARSAGLKTICVVCKLVCRLLSSDELMFH  55



>ref|XP_002769882.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
 gb|EER02600.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
Length=73

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKG--KGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            M RG+QK E+QRKNA K  K   KGSQ+  +   LK+ CP C  Q+ N   L  H+ SKH
Sbjct  1    MARGQQKAESQRKNALKKAKDAHKGSQLAGQKAALKMTCPQCMLQMTNYKVLTQHFESKH  60

Query  236  PKEK-PPSNS  262
            PKE  PP +S
Sbjct  61   PKETCPPESS  70



>ref|XP_003080665.1| unnamed protein product [Ostreococcus tauri]
Length=102

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 46/85 (54%), Gaps = 11/85 (13%)
 Frame = +2

Query  41   CGENVREMTRGKQKIEAQRKNAEKNQ----------KGKGSQIEARAVGLKVICPICKAQ  190
            C      M RG  K  AQ +NA+K+           +   S+I A A  LKV CP+CK Q
Sbjct  16   CAPRSCTMVRGAAKAIAQERNAKKHSGKDKKCHIRLRSPRSEIGAGAKALKVTCPMCKLQ  75

Query  191  LANQNQLVDHYGSKHPKEK-PPSNS  262
            L N +QL DHY SKHPKE  PP+ S
Sbjct  76   LINHHQLKDHYASKHPKETCPPAES  100



>gb|EMS22383.1| zinc finger protein 706 [Rhodosporidium toruloides NP11]
 emb|CDR47010.1| RHTO0S13e04676g1_1 [Rhodosporidium toruloides]
Length=73

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            M RG QKIEAQ+K   K   G  S ++ARA   K++CP CK  L++     +H+ SKHPK
Sbjct  1    MARGLQKIEAQQKAQAKKNAGGKSNLKARAAAFKIVCPSCKLPLSDYKNFKEHFESKHPK  60

Query  242  EKPPS  256
               P+
Sbjct  61   LPLPT  65



>emb|CEG80878.1| hypothetical protein RMATCC62417_15144 [Rhizopus microsporus]
Length=74

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 7/72 (10%)
 Frame = +2

Query  62   MTRGKQKIEA----QRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK +A    Q+K AE++   KGSQ+ ARA GL++ CP C   LAN   LV H+ +
Sbjct  1    MARGAQKEQARQRAQKKAAERS--NKGSQLGARAAGLQIKCPKCLIALANYKLLVQHFEA  58

Query  230  KHPKEK-PPSNS  262
            KHPK+K PP N 
Sbjct  59   KHPKDKVPPEND  70



>emb|CEG69138.1| hypothetical protein RMATCC62417_05266 [Rhizopus microsporus]
 emb|CEJ05262.1| hypothetical protein RMCBS344292_19207 [Rhizopus microsporus]
Length=74

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = +2

Query  62   MTRGKQKIEA----QRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK +A    Q+K AE++   KGSQ+ ARA GL++ CP C   LAN   LV H+ +
Sbjct  1    MARGAQKEQARQRAQKKAAERS--NKGSQLGARAAGLQIKCPKCLIALANYKLLVQHFEA  58

Query  230  KHPKEKPPSNS  262
            KHPK+  P  S
Sbjct  59   KHPKDNVPPES  69



>emb|CEI94687.1| hypothetical protein RMCBS344292_08892 [Rhizopus microsporus]
Length=74

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = +2

Query  62   MTRGKQKIEA----QRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK +A    Q+K AE++   KGSQ+ ARA GL++ CP C   LAN   LV H+ +
Sbjct  1    MARGAQKEQARQRAQKKAAERS--NKGSQLGARAAGLQIKCPKCLIALANYKLLVQHFEA  58

Query  230  KHPKEKPPSNS  262
            KHPK+  P  S
Sbjct  59   KHPKDNVPPES  69



>gb|EXX68719.1| hypothetical protein RirG_102600 [Rhizophagus irregularis DAOM 
197198w]
Length=72

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQ---RKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSK  232
            M RGKQK +A+   +K AE  Q GK SQ+ ARA GL++ CP+CK  +AN   +V H  +K
Sbjct  1    MARGKQKEQAREKAQKQAENRQGGK-SQLGARAAGLQLKCPVCKTPVANYKIIVQHMEAK  59

Query  233  HPKEKPP  253
            HPKE  P
Sbjct  60   HPKETIP  66



>ref|XP_007410939.1| hypothetical protein MELLADRAFT_87677 [Melampsora larici-populina 
98AG31]
 gb|EGG05883.1| hypothetical protein MELLADRAFT_87677 [Melampsora larici-populina 
98AG31]
Length=73

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPK  241
            M RG  K +AQ++NA K    KGSQ+ A+    KV C ICKA   +   LV HY +KH K
Sbjct  1    MVRGHAKAQAQQRNAAKQGSQKGSQLGAQQAVTKVACQICKAPTPSYKLLVTHYEAKHTK  60

Query  242  EKPPS  256
            E  P+
Sbjct  61   ESIPT  65



>ref|XP_007902458.1| PREDICTED: zinc finger protein 706 [Callorhinchus milii]
 ref|XP_007902459.1| PREDICTED: zinc finger protein 706 [Callorhinchus milii]
Length=75

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSK  232
            M RG+QKI++Q+KNA+K    +KG   Q  A  V L   CP+CK Q+ +      H+ SK
Sbjct  1    MARGQQKIQSQQKNAKKQAEKKKGGSDQKAAAKVALVHTCPVCKTQMPDPKTFKQHFESK  60

Query  233  HPKEKPP  253
            HPK   P
Sbjct  61   HPKSPMP  67



>dbj|GAN11900.1| zinc finger protein [Mucor ambiguus]
Length=74

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQK--GKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            M RG QK +A++K  ++  K  GKGSQ+ ARA GL++ C  C   LAN N L  H  +KH
Sbjct  1    MARGAQKEQARQKAQKEAAKRAGKGSQLGARAAGLQIKCSKCFIALANYNLLKQHMEAKH  60

Query  236  PKEKPPSNS  262
            PK+  P  S
Sbjct  61   PKDPIPPES  69



>ref|NP_001086088.1| zinc finger protein 706, gene 2 [Xenopus laevis]
 gb|AAH74174.1| MGC81992 protein [Xenopus laevis]
Length=75

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEK--NQKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGSK  232
            MTRG+QKI++Q+KNA+K   +K  GS  +A A   L   CP+C+ Q+ +      H+ SK
Sbjct  1    MTRGQQKIQSQQKNAKKQAEKKKHGSDQKAAAKAALVFTCPVCRTQMPDPKTFKQHFESK  60

Query  233  HPKEKPP  253
            HPK   P
Sbjct  61   HPKSPMP  67



>ref|XP_004989021.1| hypothetical protein PTSG_12994 [Salpingoeca rosetta]
 gb|EGD79540.1| hypothetical protein PTSG_12994 [Salpingoeca rosetta]
Length=72

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIE----ARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M+RG  K +A+ K A+KNQK KGS       ARA  LK++C +C+A +++++    H+ +
Sbjct  1    MSRGLAKQQAKEKAAKKNQKLKGSSKHDHKAARAAQLKLVCSVCRAPMSDKSVYKSHFQA  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKAPTP  68



>ref|XP_003058394.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56849.1| predicted protein [Micromonas pusilla CCMP1545]
Length=71

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 41/71 (58%), Gaps = 4/71 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKG--SQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            M RG  K  AQ KNA+KN   K   S ++ARA   K  CPIC AQL N N +  HY +KH
Sbjct  1    MARGNAKANAQEKNAKKNAGKKEAKSDLKARAAAFKASCPICAAQLINYNMMKVHYEAKH  60

Query  236  PKEK--PPSNS  262
            PKE   PP  S
Sbjct  61   PKETCPPPPES  71



>ref|XP_005988561.1| PREDICTED: zinc finger protein 706-like isoform X2 [Latimeria 
chalumnae]
 ref|XP_005988562.1| PREDICTED: zinc finger protein 706-like isoform X3 [Latimeria 
chalumnae]
 ref|XP_005988563.1| PREDICTED: zinc finger protein 706-like isoform X4 [Latimeria 
chalumnae]
Length=76

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEK---NQKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG+QKI+AQ+KNA++    +K  GS  +A A   L   CP+CK Q+ +      H+ S
Sbjct  1    MARGQQKIQAQQKNAKRLADMKKKHGSDQKAAAKAALVFTCPVCKTQMPDPKTFKQHFES  60

Query  230  KHPKEKPPS  256
            KHPK   P+
Sbjct  61   KHPKSPLPA  69



>ref|NP_001016744.1| zinc finger protein 706, gene 2 [Xenopus (Silurana) tropicalis]
 emb|CAJ82757.1| novel protein [Xenopus (Silurana) tropicalis]
 gb|AAI57780.1| hypothetical protein LOC549498 [Xenopus (Silurana) tropicalis]
Length=75

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNA----EKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG+QKI+AQ+KNA    EK + G   +  A+A  L   CP+C+ Q+ +      H+ S
Sbjct  1    MARGQQKIQAQQKNAKKQAEKKKHGNDQKAAAKA-ALVFTCPVCRTQMPDPKTFKQHFES  59

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  60   KHPKSPMP  67



>emb|CDS31145.1| zinc finger protein 706, gene 2 [Hymenolepis microstoma]
Length=73

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQI---EARAVGLKVICPICKAQLANQNQLVDHYGSK  232
            M RG QKI++Q+KN EK Q+ K +      +  V L  +C ICKAQ+ +      H+ SK
Sbjct  1    MARGLQKIQSQKKNLEKQQQSKKASSGGKNSAEVKLTYLCQICKAQMPDPKTYKSHFESK  60

Query  233  HPKEKPPS  256
            HPK + P+
Sbjct  61   HPKAELPA  68



>ref|XP_005988560.1| PREDICTED: zinc finger protein 706-like isoform X1 [Latimeria 
chalumnae]
Length=90

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEK---NQKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG+QKI+AQ+KNA++    +K  GS  +A A   L   CP+CK Q+ +      H+ S
Sbjct  15   MARGQQKIQAQQKNAKRLADMKKKHGSDQKAAAKAALVFTCPVCKTQMPDPKTFKQHFES  74

Query  230  KHPKEKPPS  256
            KHPK   P+
Sbjct  75   KHPKSPLPA  83



>ref|XP_003965891.1| PREDICTED: zinc finger protein 706-like [Takifugu rubripes]
Length=76

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            MTRG QK++AQ+KNA+K    +KGKG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MTRGHQKLQAQQKNAKKQADIKKGKGHDQKAAAKAALVYTCTVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPMP  68



>gb|EPB91274.1| hypothetical protein HMPREF1544_01790 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=82

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 42/77 (55%), Gaps = 10/77 (13%)
 Frame = +2

Query  62   MTRGKQKIEA-QRKNAEKNQK---------GKGSQIEARAVGLKVICPICKAQLANQNQL  211
            M RG QK ++ Q +N  K QK         GKGSQ+ ARA GL++ C  C   LAN N L
Sbjct  1    MARGAQKEQSRQVENMVKRQKAQKEAAKRAGKGSQLGARAAGLQIKCSKCFIALANYNLL  60

Query  212  VDHYGSKHPKEKPPSNS  262
              H  +KHPK+  P  S
Sbjct  61   KQHMEAKHPKDPIPPES  77



>gb|ACB47093.1| SJCHGC02769 protein [Schistosoma japonicum]
 emb|CAX75544.1| Zinc finger protein 706 [Schistosoma japonicum]
 emb|CAX75545.1| Zinc finger protein 706 [Schistosoma japonicum]
 emb|CAX75546.1| Zinc finger protein 706 [Schistosoma japonicum]
Length=74

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVI---CPICKAQLANQNQLVDHYGSK  232
            M RG+QKI++Q+KNA+K  + K S  + +    K +   CP+CK Q+ +      H+ +K
Sbjct  1    MARGQQKIQSQQKNAKKQAELKKSTTDTKKAAAKALHHTCPVCKTQMPDLKTYKQHFENK  60

Query  233  HPKEKPP  253
            HPK   P
Sbjct  61   HPKSSLP  67



>ref|NP_001165203.1| zinc finger protein 706, gene 2 [Xenopus laevis]
 gb|AAH99006.1| MGC115377 protein [Xenopus laevis]
Length=75

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNA----EKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG+QKI++Q+KNA    EK + G   +  A+A  L   CP+C+ Q+ +      H+ S
Sbjct  1    MARGQQKIQSQQKNAKKQAEKKKHGNDQKAAAKA-ALVFTCPVCRTQMPDPKTFKQHFES  59

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  60   KHPKSPMP  67



>ref|XP_009063333.1| hypothetical protein LOTGIDRAFT_195511 [Lottia gigantea]
 gb|ESO86090.1| hypothetical protein LOTGIDRAFT_195511 [Lottia gigantea]
Length=72

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGK--GSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            M RG+QKI++Q+KNAEK  K K   SQ +A    L   C +CK+Q+ +      H+ SKH
Sbjct  1    MARGQQKIQSQQKNAEKLAKSKKGTSQKKAAQNALVHTCTVCKSQMPDPKTYKQHFESKH  60

Query  236  PKEKPP  253
            PK   P
Sbjct  61   PKNDLP  66



>gb|AAX30290.1| SJCHGC02770 protein [Schistosoma japonicum]
Length=74

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVI---CPICKAQLANQNQLVDHYGSK  232
            M RG+QK+++Q+KNA+K  + K S  + +    K +   CP+CK Q+ +      H+ +K
Sbjct  1    MARGQQKMQSQQKNAKKQAELKKSTTDTKKAAAKALHHTCPVCKTQMPDLKTYKQHFENK  60

Query  233  HPKEKPP  253
            HPK   P
Sbjct  61   HPKSSLP  67



>ref|NP_001041452.1| zinc finger protein Ci-ZF(C2H2)-144 [Ciona intestinalis]
 tpd|FAA00202.1| TPA: zinc finger protein [Ciona intestinalis]
Length=72

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 2/66 (3%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVI--CPICKAQLANQNQLVDHYGSKH  235
            M RG QKI++Q+KN EK  K K       A    +I  CP+C++Q+ +      H+ SKH
Sbjct  1    MARGHQKIQSQKKNQEKQAKLKNKTDHKSAAKAALIHTCPVCRSQMPDPKTFKQHFESKH  60

Query  236  PKEKPP  253
            PK   P
Sbjct  61   PKSPLP  66



>ref|XP_009016379.1| hypothetical protein HELRODRAFT_77520 [Helobdella robusta]
 gb|ESO05746.1| hypothetical protein HELRODRAFT_77520 [Helobdella robusta]
Length=76

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGS-QIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG+QKI++Q+KNAEK    +K +GS Q ++    L   C +CKAQ+ +      H+ +
Sbjct  1    MARGQQKIQSQQKNAEKQAKLKKAQGSDQKKSAQAALVYSCSVCKAQMPDAKTYKQHFEN  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSALP  68



>gb|EYU37465.1| hypothetical protein MIMGU_mgv1a0175391mg, partial [Erythranthe 
guttata]
Length=27

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +2

Query  185  AQLANQNQLVDHYGSKHPKEK-PPSNS  262
             QLANQNQL+DHYGSKHPKE  PPSNS
Sbjct  1    VQLANQNQLIDHYGSKHPKENPPPSNS  27



>ref|XP_007571807.1| PREDICTED: zinc finger protein 706-like [Poecilia formosa]
Length=76

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +CK+Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEMKKSKGHDQKTAAKAALVFTCSVCKSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKSPLPPELEG  73



>dbj|GAK65019.1| zinc finger protein [Pseudozyma antarctica]
Length=74

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +2

Query  122  GKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPKEKPPSNS  262
            GK    EARA GLK  CP CKAQ  N   L +H+ +KHPK+  P  S
Sbjct  24   GKSQLGEARAKGLKFTCPTCKAQSPNYKVLKEHFDNKHPKDTCPPES  70



>ref|XP_004073848.1| PREDICTED: zinc finger protein 706-like [Oryzias latipes]
Length=76

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +CK+Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEMKKAKGHDQKTAAKAALVFTCSVCKSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKAPLPPELEG  73



>ref|XP_005797449.1| PREDICTED: zinc finger protein 706-like [Xiphophorus maculatus]
Length=76

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 7/74 (9%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN-----QKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYG  226
            M RG QKI++Q+KNA+K       KG   ++ A+A  L   C +CK+Q+ +      H+ 
Sbjct  1    MARGHQKIQSQQKNAKKQAEMKKSKGHDQKMAAKA-ALVFTCSVCKSQMPDPKTFKQHFE  59

Query  227  SKHPKEK-PPSNSG  265
            SKHPK   PP   G
Sbjct  60   SKHPKSPLPPELEG  73



>ref|XP_004549218.1| PREDICTED: zinc finger protein 706-like isoform X1 [Maylandia 
zebra]
Length=92

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 5/76 (7%)
 Frame = +2

Query  53   VREMTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDH  220
            +  M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H
Sbjct  14   IPSMARGHQKIQSQQKNAKKQAEMKKAKGHDQKTAAKAALVFTCAVCRSQMPDPKTFKQH  73

Query  221  YGSKHPKEK-PPSNSG  265
            + SKHPK   PP   G
Sbjct  74   FESKHPKSPLPPELEG  89



>gb|ETS62551.1| zinc finger protein [Pseudozyma aphidis DSM 70725]
Length=106

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +2

Query  122  GKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPKEKPPSNS  262
            GK    EARA GLK  CP CKAQ  N   L +H+ +KHPK+  P  S
Sbjct  56   GKSQLGEARAKGLKFTCPTCKAQSPNYKVLKEHFDNKHPKDTCPPES  102



>ref|XP_008420312.1| PREDICTED: zinc finger protein 706-like [Poecilia reticulata]
Length=76

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +CK+Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEMKKSKGHDQKTAAKAALVFTCSVCKSQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPLP  68



>gb|ACQ58449.1| Zinc finger protein 706 [Anoplopoma fimbria]
Length=76

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK+++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H+ S
Sbjct  1    MARGHQKLQSQQKNAKKQAEMKKAKGHDQKTAAKAALVFTCAVCRSQMPDPKTFKQHFES  60

Query  230  KHPKEKPPS  256
            KHPK   PS
Sbjct  61   KHPKSPLPS  69



>ref|XP_010744968.1| PREDICTED: zinc finger protein 706-like [Larimichthys crocea]
Length=76

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +CK+Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEIKKAKGHDQKTAAKAALVFTCLVCKSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKSPLPPELEG  73



>ref|XP_003444149.1| PREDICTED: zinc finger protein 706-like [Oreochromis niloticus]
Length=76

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEMKKAKGHDQKTAAKAALVFTCSVCRSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKSPLPPELEG  73



>ref|XP_004549219.1| PREDICTED: zinc finger protein 706-like isoform X2 [Maylandia 
zebra]
 ref|XP_005728556.1| PREDICTED: zinc finger protein 706-like [Pundamilia nyererei]
 ref|XP_005917607.1| PREDICTED: zinc finger protein 706-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005917608.1| PREDICTED: zinc finger protein 706-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_006787958.1| PREDICTED: zinc finger protein 706-like [Neolamprologus brichardi]
 ref|XP_008298998.1| PREDICTED: zinc finger protein 706-like [Stegastes partitus]
Length=76

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEMKKAKGHDQKTAAKAALVFTCAVCRSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKSPLPPELEG  73



>ref|NP_991175.1| zinc finger protein 706 [Danio rerio]
 ref|NP_001185818.1| zinc finger protein 706 [Danio rerio]
 ref|NP_001185819.1| zinc finger protein 706 [Danio rerio]
 ref|NP_001185820.1| zinc finger protein 706 [Danio rerio]
 gb|AAQ97809.1| HSPC038 protein [Danio rerio]
 gb|AAH76112.1| Zgc:92624 protein [Danio rerio]
 gb|AAI54200.1| Zgc:92624 protein [Danio rerio]
Length=76

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEIKKSKGHDQKTAAKAALVFTCAVCRSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKSPLPPELEG  73



>gb|KGB38245.1| Zinc finger protein 706, partial [Schistosoma haematobium]
Length=74

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVI---CPICKAQLANQNQLVDHYGSK  232
            M RG+QKI++Q++NA+K    K   I+++    K +   CP+CK Q+ +      H+ +K
Sbjct  1    MARGQQKIQSQQRNAKKQADLKKPTIDSKKAAAKALHHTCPVCKTQVPDVKTYKQHFENK  60

Query  233  HPKEKPP  253
            HPK   P
Sbjct  61   HPKNPLP  67



>ref|XP_007550529.1| PREDICTED: zinc finger protein 706 isoform X1 [Poecilia formosa]
 ref|XP_008431131.1| PREDICTED: zinc finger protein 706 isoform X2 [Poecilia reticulata]
Length=85

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 4/75 (5%)
 Frame = +2

Query  41   CGENVREMTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQ  208
            C     +M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +   
Sbjct  3    CLRVTSDMARGHQKFQSQQKNAKKQAEIKKSKGHDQKAAAKAALVYTCSVCRTQMPDPKT  62

Query  209  LVDHYGSKHPKEKPP  253
               H+ SKHPK   P
Sbjct  63   FKQHFESKHPKSPMP  77



>emb|CCD80177.1| hypothetical protein Smp_039970 [Schistosoma mansoni]
Length=74

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVI---CPICKAQLANQNQLVDHYGSK  232
            M RG+QKI++Q++NA+K    K   I+++    K +   CP+CK Q+ +      H+ +K
Sbjct  1    MARGQQKIQSQQRNAKKQADLKKPAIDSKKAAAKALHHTCPVCKTQVPDVKTYKQHFENK  60

Query  233  HPKEKPP  253
            HPK   P
Sbjct  61   HPKNPLP  67



>ref|XP_008329724.1| PREDICTED: zinc finger protein 706-like isoform X2 [Cynoglossus 
semilaevis]
Length=76

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK+++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H+ S
Sbjct  1    MARGHQKVQSQQKNAKKQAEMKKSKGHDQKTAAKAALVFTCAVCRSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKSPLPPELEG  73



>dbj|GAA37349.2| zinc finger protein 706 [Clonorchis sinensis]
Length=98

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 3/67 (4%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQIEARAVGLKVI---CPICKAQLANQNQLVDHYGSK  232
            MTRG+QKI+AQ++NA+K    K S  + +    K +   C +CK Q+ +      H+ +K
Sbjct  24   MTRGQQKIQAQQRNAKKQADLKKSTTDQKKAASKALIHQCTVCKTQMPDLKTYRQHFENK  83

Query  233  HPKEKPP  253
            HPK   P
Sbjct  84   HPKNPLP  90



>ref|XP_008329723.1| PREDICTED: zinc finger protein 706-like isoform X1 [Cynoglossus 
semilaevis]
Length=89

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK+++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H+ S
Sbjct  14   MARGHQKVQSQQKNAKKQAEMKKSKGHDQKTAAKAALVFTCAVCRSQMPDPKTFKQHFES  73

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  74   KHPKSPLPPELEG  86



>ref|XP_010750640.1| PREDICTED: zinc finger protein 706 [Larimichthys crocea]
 ref|XP_010750649.1| PREDICTED: zinc finger protein 706 [Larimichthys crocea]
Length=76

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQADIKKSKGHDQKAAAKAALVYTCTVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPLP  68



>gb|AEA51046.1| zinc finger protein 706 [Oryzias melastigma]
Length=76

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKFQSQQKNAKKQAEIKKAKGHDQKAAAKAALVYTCAVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP  +G
Sbjct  61   KHPKSPLPPELAG  73



>ref|XP_010789551.1| PREDICTED: zinc finger protein 706-like [Notothenia coriiceps]
Length=76

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKN----AEKNQKGKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG+QK+++Q+KN    A+K +     Q  A    L   CP+C+ Q+ +      H+ S
Sbjct  1    MARGQQKLQSQQKNLKKAADKKKGQAADQKTAAMAALVHTCPVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPMP  68



>ref|XP_007230881.1| PREDICTED: zinc finger protein 706-like [Astyanax mexicanus]
Length=76

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNA+K    +K KG  Q  A    L   C +C++Q+ +      H+ S
Sbjct  1    MARGHQKIQSQQKNAKKQAEIKKSKGHDQKTAAKAALVFTCGVCRSQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKNPLPPELEG  73



>ref|XP_003379576.1| conserved domain protein [Trichinella spiralis]
 gb|EFV60822.1| conserved domain protein [Trichinella spiralis]
Length=154

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +2

Query  44   GENVREMTRGKQKIEAQRKNAEKNQKG-KGSQIE---ARAVGLKVICPICKAQLANQNQL  211
             EN  +M RG+QK+++Q++N +K Q+  KGS ++   A   GL   C +C++Q+ +    
Sbjct  68   SENELQMARGQQKLQSQQRNLKKQQEAKKGSAVDHKKAAQKGLIYQCVVCRSQMPDLKTY  127

Query  212  VDHYGSKHPK-EKPP  253
              H+ +KHPK  KPP
Sbjct  128  GQHFENKHPKSSKPP  142



>ref|XP_010794229.1| PREDICTED: zinc finger protein 706-like [Notothenia coriiceps]
Length=76

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKG-SQIEARAVGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK+++Q+KNA+K    +K KG  Q  A    L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKLQSQQKNAKKQTEMKKAKGHDQKTAAKAALVFTCLVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP   G
Sbjct  61   KHPKSPLPPELEG  73



>ref|XP_001843968.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS35467.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=77

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 7/72 (10%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQK-------GKGSQIEARAVGLKVICPICKAQLANQNQLVDH  220
            M RG QKI++Q+K  EKN K       G   Q++A    L   C +CK+Q+ +      H
Sbjct  1    MARGHQKIQSQQKAQEKNAKLKKQQGHGLSDQMKAAQKALVFSCAVCKSQMPDPKTYKQH  60

Query  221  YGSKHPKEKPPS  256
            + +KHPK + P+
Sbjct  61   FENKHPKSELPA  72



>ref|XP_004077663.1| PREDICTED: zinc finger protein 706-like [Oryzias latipes]
Length=76

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKFQSQQKNAKKQAEIKKTKGHDQKAAAKAALVYTCAVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEK-PPSNSG  265
            KHPK   PP  +G
Sbjct  61   KHPKSPLPPELAG  73



>ref|XP_008290257.1| PREDICTED: zinc finger protein 706 isoform X2 [Stegastes partitus]
 ref|XP_008290265.1| PREDICTED: zinc finger protein 706 isoform X2 [Stegastes partitus]
Length=76

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKFQSQQKNAKKQAEIKKSKGHDQKAAAKAALVFTCTVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPMP  68



>gb|ENN77575.1| hypothetical protein YQE_05871, partial [Dendroctonus ponderosae]
 gb|ERL95157.1| hypothetical protein D910_12426 [Dendroctonus ponderosae]
Length=82

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 7/71 (10%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEK-----NQKGKGSQIEARAV--GLKVICPICKAQLANQNQLVDH  220
            M RGKQKIE+Q K  EK      Q+G  +  + +A    L  +C +CKAQ+ +    + H
Sbjct  1    MARGKQKIESQNKAVEKAAKLKKQQGHSANDQKKAAQKALVHVCSVCKAQMPDSKTYLQH  60

Query  221  YGSKHPKEKPP  253
            + +KHPK   P
Sbjct  61   FLNKHPKITIP  71



>dbj|GAC74660.1| hypothetical protein PANT_12c00080 [Pseudozyma antarctica T-34]
Length=898

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +2

Query  122  GKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPKEKPPSNS  262
            GK    EARA GLK  CP CKAQ  N   L +H+ +KHPK+  P  S
Sbjct  848  GKSQLGEARAKGLKFTCPTCKAQSPNYKVLKEHFDNKHPKDTCPPES  894



>ref|XP_002602402.1| hypothetical protein BRAFLDRAFT_117036 [Branchiostoma floridae]
 gb|EEN58414.1| hypothetical protein BRAFLDRAFT_117036 [Branchiostoma floridae]
Length=76

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 38/68 (56%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKGSQ--IEARAVGLKVI--CPICKAQLANQNQLVDHYGS  229
            M RG QKI++Q+KNAEK  K K  Q   +  A G  +I  C +CK Q+ +      H+ S
Sbjct  1    MARGHQKIQSQKKNAEKQAKMKKQQGHDQKSAAGKALIYQCVVCKTQMPDPKTYKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKAPMP  68



>ref|XP_008290244.1| PREDICTED: zinc finger protein 706 isoform X1 [Stegastes partitus]
 ref|XP_008290250.1| PREDICTED: zinc finger protein 706 isoform X1 [Stegastes partitus]
Length=90

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  15   MARGHQKFQSQQKNAKKQAEIKKSKGHDQKAAAKAALVFTCTVCRTQMPDPKTFKQHFES  74

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  75   KHPKSPMP  82



>ref|XP_005803519.1| PREDICTED: zinc finger protein 706-like [Xiphophorus maculatus]
Length=76

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKFQSQQKNAKKQAEIKKSKGHDQKAAAKAALVYTCSVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPMP  68



>ref|XP_004706966.1| PREDICTED: zinc finger protein 706-like [Echinops telfairi]
Length=76

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 37/69 (54%), Gaps = 6/69 (9%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGK-----GSQIEARAVGLKVICPICKAQLANQNQLVDHYG  226
            M RG+QKI++Q+KNA KNQ G+       Q  A    L   C +C+ Q+ +      H+ 
Sbjct  1    MARGQQKIQSQQKNA-KNQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFE  59

Query  227  SKHPKEKPP  253
            SKHPK   P
Sbjct  60   SKHPKTPLP  68



>emb|CBQ70664.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=77

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  EARAVGLKVICPICKAQLANQNQLVDHYGSKHPKEK-PPSNS  262
            EARA GLK  CP CK Q  N   L +H+ +KHPKE  PP +S
Sbjct  33   EARAKGLKFTCPTCKGQNPNYKVLKEHFENKHPKETCPPESS  74



>ref|XP_008431130.1| PREDICTED: zinc finger protein 706 isoform X1 [Poecilia reticulata]
Length=120

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 5/74 (7%)
 Frame = +2

Query  59   EMTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYG  226
            +M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ 
Sbjct  44   DMARGHQKFQSQQKNAKKQAEIKKSKGHDQKAAAKAALVYTCSVCRTQMPDPKTFKQHFE  103

Query  227  SKHPKE-KPPSNSG  265
            SKHPK   PP   G
Sbjct  104  SKHPKSPMPPELVG  117



>gb|KHN84708.1| Zinc finger protein [Toxocara canis]
Length=76

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQ---KGKGSQIEARAVGLKVI---CPICKAQLANQNQLVDHY  223
            M RG QK ++Q+KN +K +   K KGS  + +A  LK +   C +C AQ+ +      H+
Sbjct  1    MARGHQKFQSQQKNLKKQEELRKSKGS--DQKAAALKALTHKCTVCMAQMPDLKTYKQHF  58

Query  224  GSKHPKEKPPS  256
             SKHPK   P+
Sbjct  59   ESKHPKATMPA  69



>gb|EST06161.1| hypothetical protein PSEUBRA_SCAF3g03697 [Pseudozyma brasiliensis 
GHG001]
Length=74

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 27/47 (57%), Gaps = 0/47 (0%)
 Frame = +2

Query  122  GKGSQIEARAVGLKVICPICKAQLANQNQLVDHYGSKHPKEKPPSNS  262
            GK    EAR  GLK  CP+CK Q  N   L +H+ +KHPK+  P  S
Sbjct  24   GKSQLGEARTKGLKFTCPVCKGQNPNYKVLKEHFENKHPKDTCPPES  70



>emb|CDH48709.1| predicted protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=73

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKNQKGKG--SQIEARAVGLKVICPICKAQLANQNQLVDHYGSKH  235
            M RG QK +A++K  ++  K     SQ+ ARA GL+V CP C   +     LV+H  +KH
Sbjct  1    MARGAQKEQARQKAQKEAAKKGKAKSQLGARAAGLQVKCPKCFVTMPTYKTLVNHMEAKH  60

Query  236  PKEKPPSNS  262
            PK+  P  S
Sbjct  61   PKDPVPPES  69



>ref|XP_004560098.1| PREDICTED: zinc finger protein 706-like [Maylandia zebra]
 ref|XP_005456825.1| PREDICTED: zinc finger protein 706-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_005456826.1| PREDICTED: zinc finger protein 706-like isoform X2 [Oreochromis 
niloticus]
 ref|XP_005456827.1| PREDICTED: zinc finger protein 706-like isoform X3 [Oreochromis 
niloticus]
 ref|XP_005742987.1| PREDICTED: zinc finger protein 706-like [Pundamilia nyererei]
 ref|XP_005930236.1| PREDICTED: zinc finger protein 706-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005930237.1| PREDICTED: zinc finger protein 706-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_006796046.1| PREDICTED: zinc finger protein 706-like isoform X1 [Neolamprologus 
brichardi]
 ref|XP_006796047.1| PREDICTED: zinc finger protein 706-like isoform X2 [Neolamprologus 
brichardi]
Length=76

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKFQSQQKNAKKQAEIKKSKGHDQKAAAKAALVYTCTVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPMP  68



>ref|XP_007550531.1| PREDICTED: zinc finger protein 706 isoform X2 [Poecilia formosa]
Length=76

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +2

Query  62   MTRGKQKIEAQRKNAEKN---QKGKGSQIEARA-VGLKVICPICKAQLANQNQLVDHYGS  229
            M RG QK ++Q+KNA+K    +K KG   +A A   L   C +C+ Q+ +      H+ S
Sbjct  1    MARGHQKFQSQQKNAKKQAEIKKSKGHDQKAAAKAALVYTCSVCRTQMPDPKTFKQHFES  60

Query  230  KHPKEKPP  253
            KHPK   P
Sbjct  61   KHPKSPMP  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556930065965