BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017B08 577 bp,

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354416.1|  PREDICTED: uncharacterized protein LOC102594...    265   4e-80   Solanum tuberosum [potatoes]
ref|XP_004239250.1|  PREDICTED: uncharacterized protein LOC101257075    259   8e-78   Solanum lycopersicum
ref|XP_009594235.1|  PREDICTED: protein PAT1 homolog 1-like             258   2e-77   Nicotiana tomentosiformis
ref|XP_009781689.1|  PREDICTED: uncharacterized protein LOC104230555    252   4e-75   Nicotiana sylvestris
ref|XP_009602223.1|  PREDICTED: uncharacterized protein LOC104097371    248   8e-74   Nicotiana tomentosiformis
ref|XP_009757677.1|  PREDICTED: uncharacterized protein LOC104210470    244   3e-72   Nicotiana sylvestris
ref|XP_006351984.1|  PREDICTED: protein PAT1 homolog 1-like             235   4e-69   Solanum tuberosum [potatoes]
ref|XP_010313689.1|  PREDICTED: uncharacterized protein LOC101260...    234   2e-68   Solanum lycopersicum
ref|XP_004251557.1|  PREDICTED: uncharacterized protein LOC101260...    234   2e-68   Solanum lycopersicum
ref|XP_011085449.1|  PREDICTED: protein PAT1 homolog 1-like             231   1e-67   Sesamum indicum [beniseed]
gb|EYU42843.1|  hypothetical protein MIMGU_mgv1a001457mg                231   1e-67   Erythranthe guttata [common monkey flower]
ref|XP_009595696.1|  PREDICTED: protein PAT1 homolog 1-like             225   3e-65   Nicotiana tomentosiformis
ref|XP_009797313.1|  PREDICTED: protein PAT1 homolog 1-like             224   6e-65   Nicotiana sylvestris
emb|CDP16041.1|  unnamed protein product                                223   2e-64   Coffea canephora [robusta coffee]
gb|EYU43158.1|  hypothetical protein MIMGU_mgv1a023840mg                217   4e-63   Erythranthe guttata [common monkey flower]
ref|XP_007049006.1|  Topoisomerase II-associated protein PAT1, pu...    214   2e-61   Theobroma cacao [chocolate]
ref|XP_007049005.1|  Topoisomerase II-associated protein PAT1, pu...    213   3e-61   Theobroma cacao [chocolate]
ref|XP_011100381.1|  PREDICTED: uncharacterized protein LOC105178578    212   2e-60   Sesamum indicum [beniseed]
gb|KJB42927.1|  hypothetical protein B456_007G174200                    205   4e-58   Gossypium raimondii
gb|KJB42926.1|  hypothetical protein B456_007G174200                    204   4e-58   Gossypium raimondii
gb|KHG07107.1|  Protein PAT1                                            202   1e-57   Gossypium arboreum [tree cotton]
ref|XP_002264820.1|  PREDICTED: protein PAT1 homolog 1-like             199   5e-56   Vitis vinifera
emb|CAN68728.1|  hypothetical protein VITISV_033604                     199   6e-56   Vitis vinifera
gb|KJB10632.1|  hypothetical protein B456_001G212600                    195   9e-55   Gossypium raimondii
ref|XP_010112872.1|  hypothetical protein L484_017708                   196   9e-55   Morus notabilis
ref|XP_004303935.1|  PREDICTED: protein PAT1 homolog 1                  192   1e-53   Fragaria vesca subsp. vesca
gb|KHG26425.1|  Protein PAT1                                            189   2e-52   Gossypium arboreum [tree cotton]
ref|XP_008342293.1|  PREDICTED: protein PAT1 homolog 1-like             188   3e-52   Malus domestica [apple tree]
ref|XP_007217055.1|  hypothetical protein PRUPE_ppa001180mg             187   1e-51   Prunus persica
ref|XP_009377953.1|  PREDICTED: protein PAT1 homolog 1-like             186   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_008229675.1|  PREDICTED: protein PAT1 homolog 1-like             185   4e-51   Prunus mume [ume]
ref|XP_008378353.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    182   3e-50   
ref|XP_010243918.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    182   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010243919.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    182   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010645008.1|  PREDICTED: protein PAT1 homolog 1 isoform X3       181   7e-50   Vitis vinifera
ref|XP_010645007.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       181   8e-50   Vitis vinifera
ref|XP_010645006.1|  PREDICTED: uncharacterized protein LOC100267...    182   9e-50   Vitis vinifera
gb|KJB08598.1|  hypothetical protein B456_001G092700                    180   3e-49   Gossypium raimondii
gb|KJB08599.1|  hypothetical protein B456_001G092700                    180   3e-49   Gossypium raimondii
ref|XP_010243929.1|  PREDICTED: protein PAT1 homolog 1-like             179   8e-49   Nelumbo nucifera [Indian lotus]
ref|XP_009375341.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    177   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_009375342.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    177   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_002520595.1|  hypothetical protein RCOM_0673440                  176   5e-48   Ricinus communis
ref|XP_010036063.1|  PREDICTED: protein PAT1 homolog 1-like             176   6e-48   Eucalyptus grandis [rose gum]
ref|XP_002513418.1|  conserved hypothetical protein                     172   1e-46   Ricinus communis
gb|KDP44628.1|  hypothetical protein JCGZ_22047                         169   2e-45   Jatropha curcas
gb|KDO64328.1|  hypothetical protein CISIN_1g0038252mg                  167   6e-45   Citrus sinensis [Valencia orange]
gb|KDO64329.1|  hypothetical protein CISIN_1g0038252mg                  167   9e-45   Citrus sinensis [Valencia orange]
ref|XP_002308825.2|  hypothetical protein POPTR_0006s02270g             167   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006429752.1|  hypothetical protein CICLE_v10013436mg             166   1e-44   Citrus clementina
gb|KDO64330.1|  hypothetical protein CISIN_1g0038252mg                  166   1e-44   Citrus sinensis [Valencia orange]
ref|XP_006481341.1|  PREDICTED: uncharacterized protein LOC102618...    166   2e-44   Citrus sinensis [Valencia orange]
ref|XP_010926894.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       167   2e-44   Elaeis guineensis
ref|XP_006481340.1|  PREDICTED: uncharacterized protein LOC102618...    166   3e-44   Citrus sinensis [Valencia orange]
ref|XP_004147742.1|  PREDICTED: uncharacterized protein LOC101213130    166   3e-44   Cucumis sativus [cucumbers]
ref|XP_008451848.1|  PREDICTED: uncharacterized protein LOC103493011    166   5e-44   Cucumis melo [Oriental melon]
ref|XP_004165263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    165   5e-44   
ref|XP_010525174.1|  PREDICTED: uncharacterized protein LOC104803017    165   7e-44   Tarenaya hassleriana [spider flower]
gb|KFK23118.1|  hypothetical protein AALP_AAs49591U000400               164   2e-43   Arabis alpina [alpine rockcress]
ref|XP_008775079.1|  PREDICTED: protein PAT1 homolog 1-like             164   2e-43   Phoenix dactylifera
ref|XP_006373646.1|  hypothetical protein POPTR_0016s02130g             163   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010926895.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       163   3e-43   Elaeis guineensis
ref|XP_011008549.1|  PREDICTED: uncharacterized protein LOC105113895    162   5e-43   Populus euphratica
gb|KDP25122.1|  hypothetical protein JCGZ_22657                         161   2e-42   Jatropha curcas
ref|XP_011097653.1|  PREDICTED: protein PAT1 homolog 1                  161   2e-42   Sesamum indicum [beniseed]
ref|XP_003545913.2|  PREDICTED: uncharacterized protein LOC100787648    161   4e-42   Glycine max [soybeans]
ref|XP_010532520.1|  PREDICTED: uncharacterized protein LOC104808528    160   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_007022269.1|  Topoisomerase II-associated protein PAT1, pu...    160   6e-42   Theobroma cacao [chocolate]
ref|XP_010907163.1|  PREDICTED: uncharacterized protein LOC105033889    160   8e-42   Elaeis guineensis
ref|XP_007214538.1|  hypothetical protein PRUPE_ppa002090mg             158   1e-41   Prunus persica
ref|XP_011004464.1|  PREDICTED: uncharacterized protein LOC105110947    157   4e-41   Populus euphratica
ref|XP_008344205.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    156   4e-41   
ref|NP_567452.2|  Topoisomerase II-associated protein PAT1              156   9e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109206.1|  hypothetical protein L484_002129                   156   2e-40   Morus notabilis
ref|XP_002868239.1|  hypothetical protein ARALYDRAFT_915331             155   2e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_004514400.1|  PREDICTED: uncharacterized protein LOC101512706    155   3e-40   Cicer arietinum [garbanzo]
ref|XP_011036076.1|  PREDICTED: protein PAT1 homolog 1-like             155   3e-40   Populus euphratica
gb|KJB26984.1|  hypothetical protein B456_004G270000                    155   3e-40   Gossypium raimondii
ref|XP_003532940.1|  PREDICTED: uncharacterized protein LOC100812...    155   4e-40   Glycine max [soybeans]
gb|KHN26819.1|  Protein PAT1 like 1                                     155   6e-40   Glycine soja [wild soybean]
ref|XP_008383068.1|  PREDICTED: uncharacterized protein LOC103445...    154   6e-40   
ref|XP_006585424.1|  PREDICTED: uncharacterized protein LOC100812...    155   6e-40   Glycine max [soybeans]
gb|KHG10037.1|  Protein PAT1                                            154   6e-40   Gossypium arboreum [tree cotton]
gb|KFK39518.1|  hypothetical protein AALP_AA3G254500                    154   8e-40   Arabis alpina [alpine rockcress]
ref|XP_009361780.1|  PREDICTED: protein PAT1 homolog 1-like             154   9e-40   Pyrus x bretschneideri [bai li]
ref|XP_009345081.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    153   9e-40   Pyrus x bretschneideri [bai li]
gb|EPS66560.1|  hypothetical protein M569_08215                         153   1e-39   Genlisea aurea
ref|XP_006406189.1|  hypothetical protein EUTSA_v10020108mg             153   1e-39   Eutrema salsugineum
ref|XP_008226080.1|  PREDICTED: protein PAT1 homolog 1                  153   2e-39   Prunus mume [ume]
ref|XP_002317021.2|  hypothetical protein POPTR_0011s14710g             152   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_009345080.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    153   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_010062704.1|  PREDICTED: protein PAT1 homolog 1                  153   2e-39   Eucalyptus grandis [rose gum]
ref|XP_010923783.1|  PREDICTED: uncharacterized protein LOC105046771    152   3e-39   Elaeis guineensis
ref|XP_011030730.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       152   4e-39   Populus euphratica
ref|XP_011030729.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       152   4e-39   Populus euphratica
ref|XP_011030731.1|  PREDICTED: protein PAT1 homolog 1 isoform X3       152   5e-39   Populus euphratica
ref|XP_010692206.1|  PREDICTED: protein PAT1 homolog 1                  151   8e-39   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009405382.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    150   9e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11535.1|  Protein PAT1                                            149   9e-39   Gossypium arboreum [tree cotton]
ref|XP_009405381.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    150   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB01945.1|  unnamed protein product                                149   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007022271.1|  Uncharacterized protein TCM_032442                 148   2e-38   Theobroma cacao [chocolate]
ref|XP_007163851.1|  hypothetical protein PHAVU_L011200g                146   2e-38   Phaseolus vulgaris [French bean]
ref|XP_008793553.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    149   2e-38   
ref|XP_008383066.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       150   3e-38   Malus domestica [apple tree]
emb|CBI34052.3|  unnamed protein product                                147   4e-38   Vitis vinifera
ref|XP_002883351.1|  hypothetical protein ARALYDRAFT_479740             149   4e-38   Arabidopsis lyrata subsp. lyrata
dbj|BAF00849.1|  hypothetical protein                                   149   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414611.1|  hypothetical protein EUTSA_v10024461mg             149   4e-38   Eutrema salsugineum
ref|NP_188866.1|  Topoisomerase II-associated protein PAT1              149   5e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793552.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    149   5e-38   Phoenix dactylifera
ref|XP_004294192.1|  PREDICTED: protein PAT1 homolog 1                  148   9e-38   Fragaria vesca subsp. vesca
ref|XP_010684289.1|  PREDICTED: uncharacterized protein LOC104898860    148   1e-37   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010497250.1|  PREDICTED: protein PAT1 homolog 1-like             142   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010440363.1|  PREDICTED: protein PAT1 homolog 1-like             147   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010429781.1|  PREDICTED: protein PAT1 homolog 1-like             146   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004162291.1|  PREDICTED: uncharacterized protein LOC101226533    145   1e-36   
gb|KFK42288.1|  hypothetical protein AALP_AA2G236100                    145   1e-36   Arabis alpina [alpine rockcress]
ref|XP_006300753.1|  hypothetical protein CARUB_v10019819mg             145   1e-36   Capsella rubella
ref|XP_010435003.1|  PREDICTED: protein PAT1 homolog 1-like             145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010496132.1|  PREDICTED: protein PAT1 homolog 1-like             145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009406732.1|  PREDICTED: uncharacterized protein LOC103989...    145   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406733.1|  PREDICTED: uncharacterized protein LOC103989...    144   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009604527.1|  PREDICTED: uncharacterized protein LOC104099288    144   2e-36   Nicotiana tomentosiformis
emb|CDP13609.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_010419368.1|  PREDICTED: protein PAT1 homolog 1-like             144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007133386.1|  hypothetical protein PHAVU_011G174900g             144   4e-36   Phaseolus vulgaris [French bean]
ref|XP_010466506.1|  PREDICTED: uncharacterized protein LOC104746679    143   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008444289.1|  PREDICTED: protein PAT1 homolog 1                  143   5e-36   Cucumis melo [Oriental melon]
ref|XP_010539588.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       143   7e-36   Tarenaya hassleriana [spider flower]
ref|XP_010539589.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       143   7e-36   Tarenaya hassleriana [spider flower]
gb|KHN16432.1|  hypothetical protein glysoja_046875                     143   7e-36   Glycine soja [wild soybean]
ref|XP_006597997.1|  PREDICTED: uncharacterized protein LOC100779...    143   7e-36   Glycine max [soybeans]
ref|XP_006597998.1|  PREDICTED: uncharacterized protein LOC100779...    143   7e-36   Glycine max [soybeans]
ref|XP_006597999.1|  PREDICTED: uncharacterized protein LOC100779...    143   8e-36   Glycine max [soybeans]
ref|XP_009397355.1|  PREDICTED: protein PAT1 homolog 1-like             142   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006478033.1|  PREDICTED: uncharacterized protein LOC102611...    142   2e-35   Citrus sinensis [Valencia orange]
ref|XP_006478034.1|  PREDICTED: uncharacterized protein LOC102611...    142   2e-35   Citrus sinensis [Valencia orange]
ref|XP_006416798.1|  hypothetical protein EUTSA_v10006845mg             142   2e-35   Eutrema salsugineum
ref|XP_010511200.1|  PREDICTED: uncharacterized protein LOC104787331    142   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004144681.1|  PREDICTED: uncharacterized protein LOC101207256    141   2e-35   Cucumis sativus [cucumbers]
ref|XP_006297023.1|  hypothetical protein CARUB_v10013016mg             141   3e-35   Capsella rubella
gb|KDP25124.1|  hypothetical protein JCGZ_22659                         141   3e-35   Jatropha curcas
ref|XP_010488248.1|  PREDICTED: uncharacterized protein LOC104766124    140   5e-35   Camelina sativa [gold-of-pleasure]
gb|KJB82134.1|  hypothetical protein B456_013G178200                    138   6e-35   Gossypium raimondii
ref|XP_009104546.1|  PREDICTED: protein PAT1 homolog 1-like             140   7e-35   Brassica rapa
ref|XP_002441360.1|  hypothetical protein SORBIDRAFT_09g025190          140   7e-35   Sorghum bicolor [broomcorn]
ref|XP_006283146.1|  hypothetical protein CARUB_v10004170mg             140   8e-35   Capsella rubella
ref|XP_006344918.1|  PREDICTED: uncharacterized protein LOC102604...    140   9e-35   Solanum tuberosum [potatoes]
ref|XP_006344917.1|  PREDICTED: uncharacterized protein LOC102604...    140   9e-35   Solanum tuberosum [potatoes]
ref|XP_006283147.1|  hypothetical protein CARUB_v10004170mg             140   9e-35   Capsella rubella
emb|CDX79293.1|  BnaC06g20100D                                          140   1e-34   Brassica napus [oilseed rape]
emb|CDX68009.1|  BnaA07g20490D                                          139   1e-34   Brassica napus [oilseed rape]
gb|KDO40141.1|  hypothetical protein CISIN_1g003844mg                   137   1e-34   Citrus sinensis [Valencia orange]
ref|XP_006388794.1|  hypothetical protein POPTR_0098s00230g             138   2e-34   Populus trichocarpa [western balsam poplar]
gb|KDO40142.1|  hypothetical protein CISIN_1g003844mg                   138   2e-34   Citrus sinensis [Valencia orange]
ref|NP_565199.1|  uncharacterized protein                               139   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010497980.1|  PREDICTED: protein PAT1 homolog 1-like             137   2e-34   Camelina sativa [gold-of-pleasure]
gb|AAC17049.1|  Similar to hypothetical protein product gb|Z97337...    139   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006441043.1|  hypothetical protein CICLE_v10018922mg             139   3e-34   Citrus clementina
gb|KDO40140.1|  hypothetical protein CISIN_1g003844mg                   138   3e-34   Citrus sinensis [Valencia orange]
gb|KJB82133.1|  hypothetical protein B456_013G178200                    138   3e-34   Gossypium raimondii
gb|KHG07822.1|  Protein PAT1                                            138   3e-34   Gossypium arboreum [tree cotton]
ref|XP_002513421.1|  conserved hypothetical protein                     138   3e-34   Ricinus communis
ref|XP_003568135.1|  PREDICTED: protein PAT1 homolog 1-like             138   4e-34   Brachypodium distachyon [annual false brome]
emb|CDY23806.1|  BnaA01g21570D                                          139   4e-34   Brassica napus [oilseed rape]
ref|XP_004961544.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    137   4e-34   Setaria italica
ref|XP_002889231.1|  predicted protein                                  138   5e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_004961543.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    137   7e-34   Setaria italica
ref|XP_006648671.1|  PREDICTED: uncharacterized protein LOC102700029    137   9e-34   Oryza brachyantha
ref|XP_009767161.1|  PREDICTED: uncharacterized protein LOC104218381    137   1e-33   Nicotiana sylvestris
ref|XP_010228365.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    137   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_010228364.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    137   1e-33   
gb|EMT17005.1|  Lipoyl synthase, mitochondrial                          137   1e-33   Aegilops tauschii
ref|XP_006646364.1|  PREDICTED: uncharacterized protein LOC102701783    136   2e-33   Oryza brachyantha
ref|XP_004251956.1|  PREDICTED: protein PAT1 homolog 1                  135   3e-33   Solanum lycopersicum
ref|XP_003569904.1|  PREDICTED: uncharacterized protein LOC100838182    135   3e-33   Brachypodium distachyon [annual false brome]
ref|XP_002890176.1|  hypothetical protein ARALYDRAFT_889054             135   3e-33   Arabidopsis lyrata subsp. lyrata
gb|EMS48493.1|  hypothetical protein TRIUR3_07139                       135   4e-33   Triticum urartu
ref|NP_001140581.1|  uncharacterized protein LOC100272651               135   4e-33   Zea mays [maize]
ref|NP_001169926.1|  uncharacterized protein LOC100383823               133   4e-33   Zea mays [maize]
ref|XP_002300546.2|  hypothetical protein POPTR_0001s46190g             135   5e-33   Populus trichocarpa [western balsam poplar]
ref|NP_001044369.2|  Os01g0769000                                       135   5e-33   
gb|EAZ13676.1|  hypothetical protein OsJ_03596                          135   6e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456407.1|  hypothetical protein SORBIDRAFT_03g035750          135   6e-33   Sorghum bicolor [broomcorn]
gb|EAY75968.1|  hypothetical protein OsI_03887                          135   6e-33   Oryza sativa Indica Group [Indian rice]
emb|CDY10630.1|  BnaA05g17320D                                          134   9e-33   Brassica napus [oilseed rape]
ref|XP_010459204.1|  PREDICTED: protein PAT1 homolog 1-like             134   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009145394.1|  PREDICTED: uncharacterized protein LOC103869095    134   1e-32   Brassica rapa
ref|XP_004952292.1|  PREDICTED: uncharacterized protein LOC101759904    134   1e-32   Setaria italica
ref|NP_001046960.1|  Os02g0517300                                       134   1e-32   
dbj|BAJ94686.1|  predicted protein                                      134   1e-32   Hordeum vulgare subsp. vulgare [barley]
gb|EAY86044.1|  hypothetical protein OsI_07409                          134   1e-32   Oryza sativa Indica Group [Indian rice]
gb|EAZ23222.1|  hypothetical protein OsJ_06910                          134   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970101.1|  PREDICTED: uncharacterized protein LOC101761506    134   1e-32   Setaria italica
ref|XP_004967457.1|  PREDICTED: protein PAT1 homolog 1-like             134   2e-32   Setaria italica
gb|EYU33763.1|  hypothetical protein MIMGU_mgv1a002553mg                132   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_008649853.1|  PREDICTED: uncharacterized protein LOC103630586    133   2e-32   Zea mays [maize]
ref|XP_008655297.1|  PREDICTED: uncharacterized protein LOC100383...    133   2e-32   Zea mays [maize]
ref|XP_006389922.1|  hypothetical protein EUTSA_v10018148mg             132   3e-32   Eutrema salsugineum
gb|EMT11670.1|  Protein PAT1-1-like protein                             132   6e-32   Aegilops tauschii
gb|EMS52590.1|  hypothetical protein TRIUR3_20541                       132   7e-32   Triticum urartu
emb|CDY39512.1|  BnaA01g24760D                                          131   8e-32   Brassica napus [oilseed rape]
ref|XP_003568134.1|  PREDICTED: uncharacterized protein LOC100841028    131   8e-32   Brachypodium distachyon [annual false brome]
emb|CAB10277.1|  hypothetical protein                                   130   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457098.1|  hypothetical protein SORBIDRAFT_03g001160          130   1e-31   Sorghum bicolor [broomcorn]
ref|XP_011038110.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    131   1e-31   Populus euphratica
ref|XP_011038109.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    131   1e-31   Populus euphratica
dbj|BAJ90621.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ88890.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK00541.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [barley]
emb|CDY37402.1|  BnaC05g30280D                                          130   3e-31   Brassica napus [oilseed rape]
ref|XP_006845982.1|  hypothetical protein AMTR_s00155p00028780          130   3e-31   Amborella trichopoda
ref|XP_011014090.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    129   6e-31   Populus euphratica
ref|XP_011014091.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    129   6e-31   Populus euphratica
ref|XP_009149098.1|  PREDICTED: protein PAT1 homolog 1-like             128   1e-30   Brassica rapa
ref|XP_009416762.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    127   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY35105.1|  BnaA06g11150D                                          125   2e-30   Brassica napus [oilseed rape]
ref|NP_001145976.1|  hypothetical protein                               127   2e-30   Zea mays [maize]
ref|XP_009416761.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    127   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416760.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    127   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009108983.1|  PREDICTED: uncharacterized protein LOC103834...    126   6e-30   Brassica rapa
ref|XP_009108988.1|  PREDICTED: uncharacterized protein LOC103834...    126   6e-30   Brassica rapa
emb|CDX87408.1|  BnaA07g34650D                                          125   7e-30   Brassica napus [oilseed rape]
ref|XP_009106629.1|  PREDICTED: protein PAT1 homolog 1                  125   7e-30   Brassica rapa
ref|XP_009419548.1|  PREDICTED: protein PAT1 homolog 1 isoform X1       125   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC72953.1|  hypothetical protein OsI_06835                          125   2e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001046606.2|  Os02g0294700                                       124   2e-29   
ref|XP_009419549.1|  PREDICTED: protein PAT1 homolog 1 isoform X2       125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB84264.1|  hypothetical protein B456_N0144002                      120   2e-29   Gossypium raimondii
ref|XP_006585425.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    124   2e-29   
gb|KHN27739.1|  Protein PAT1 like 1                                     124   3e-29   Glycine soja [wild soybean]
ref|XP_003545912.1|  PREDICTED: protein PAT1 homolog 1-like             124   3e-29   Glycine max [soybeans]
ref|XP_007149274.1|  hypothetical protein PHAVU_005G056500g             124   4e-29   Phaseolus vulgaris [French bean]
gb|EAZ22672.1|  hypothetical protein OsJ_06342                          124   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647188.1|  PREDICTED: protein PAT1 homolog 1-like             123   6e-29   Oryza brachyantha
emb|CDY40046.1|  BnaC05g12690D                                          122   1e-28   Brassica napus [oilseed rape]
emb|CDX88505.1|  BnaC06g39490D                                          122   1e-28   Brassica napus [oilseed rape]
gb|KEH38343.1|  topoisomerase II-associated protein PAT1                122   1e-28   Medicago truncatula
gb|EAY85452.1|  hypothetical protein OsI_06832                          122   2e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001172909.1|  Os02g0295700                                       121   3e-28   
ref|XP_003578526.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    121   3e-28   Brachypodium distachyon [annual false brome]
ref|XP_010238435.1|  PREDICTED: protein PAT1 homolog 1-like isofo...    120   4e-28   
ref|XP_004488835.1|  PREDICTED: uncharacterized protein LOC101501...    118   5e-27   Cicer arietinum [garbanzo]
ref|XP_004488834.1|  PREDICTED: uncharacterized protein LOC101500903    117   8e-27   Cicer arietinum [garbanzo]
ref|XP_009399054.1|  PREDICTED: protein PAT1 homolog 1-like             115   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY54867.1|  BnaC01g22630D                                          115   6e-26   Brassica napus [oilseed rape]
emb|CDY46332.1|  BnaC01g31660D                                          113   3e-25   Brassica napus [oilseed rape]
emb|CDY50269.1|  BnaAnng10330D                                          111   7e-25   Brassica napus [oilseed rape]
ref|XP_009147964.1|  PREDICTED: protein PAT1 homolog 1                  111   9e-25   Brassica rapa
gb|KEH38344.1|  topoisomerase II-associated protein PAT1, putative      109   5e-24   Medicago truncatula
gb|EMT27507.1|  hypothetical protein F775_52260                         107   4e-23   Aegilops tauschii
gb|EPS71565.1|  hypothetical protein M569_03193                         103   6e-23   Genlisea aurea
ref|XP_002962712.1|  hypothetical protein SELMODRAFT_165728           96.7    4e-20   Selaginella moellendorffii
ref|XP_002980379.1|  hypothetical protein SELMODRAFT_112306           96.7    5e-20   Selaginella moellendorffii
ref|XP_010480501.1|  PREDICTED: protein PAT1 homolog 1-like           86.3    4e-16   Camelina sativa [gold-of-pleasure]
gb|KHM98853.1|  hypothetical protein glysoja_022263                   85.5    9e-16   Glycine soja [wild soybean]
ref|XP_001783364.1|  predicted protein                                76.6    4e-13   Physcomitrella patens
ref|XP_001755124.1|  predicted protein                                75.9    6e-13   Physcomitrella patens
dbj|BAD94175.1|  hypothetical protein                                 61.6    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005850599.1|  expressed protein                                62.0    6e-08   Chlorella variabilis
ref|XP_007510136.1|  predicted protein                                56.6    2e-06   Bathycoccus prasinos
ref|XP_003081708.1|  unnamed protein product                          54.7    9e-06   Ostreococcus tauri
ref|XP_005649516.1|  hypothetical protein COCSUDRAFT_83665            54.3    2e-05   Coccomyxa subellipsoidea C-169
ref|XP_003291556.1|  hypothetical protein DICPUDRAFT_57424            49.7    4e-04   Dictyostelium purpureum
gb|KIZ00029.1|  hypothetical protein MNEG_7931                        49.3    6e-04   Monoraphidium neglectum
ref|XP_011396702.1|  PAT1-like protein 1                              49.3    7e-04   Auxenochlorella protothecoides
ref|XP_001420179.1|  predicted protein                                48.9    7e-04   Ostreococcus lucimarinus CCE9901



>ref|XP_006354416.1| PREDICTED: uncharacterized protein LOC102594467 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354417.1| PREDICTED: uncharacterized protein LOC102594467 isoform X2 [Solanum 
tuberosum]
Length=821

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 165/188 (88%), Gaps = 5/188 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLS---VQPSLAHFSALRSQLYNSFPAPAHLS  380
            L++VL HQFPHQN LLSPQL+SPQQ +       VQPSLAHFSALRSQLYNSFP+P+HL 
Sbjct  295  LDSVLQHQFPHQNSLLSPQLLSPQQLQQQRLHLSVQPSLAHFSALRSQLYNSFPSPSHLG  354

Query  379  KYGMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            KYG+ D RDSR+K SHK + +VRFS+QGSDAAS KSESN PQFRSKYMTG+EIESILKMQ
Sbjct  355  KYGLADFRDSRSKPSHKVRQNVRFSKQGSDAASHKSESNVPQFRSKYMTGDEIESILKMQ  414

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H+++H NDPYVDDYYHQA LAK+A ESRSKHRFCPNKEQSSRSRNS ES PHLHVDA+GR
Sbjct  415  HSAAHGNDPYVDDYYHQARLAKKAAESRSKHRFCPNKEQSSRSRNSAESQPHLHVDAQGR  474

Query  25   VSFSSIRR  2
            VSFSSIRR
Sbjct  475  VSFSSIRR  482



>ref|XP_004239250.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321026.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321027.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321028.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
Length=820

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 5/188 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLS---VQPSLAHFSALRSQLYNSFPAPAHLS  380
            L++VL HQFPHQN LLSPQL+SPQQ +       VQPSLAHFSALRSQLYNSFP+P+HL 
Sbjct  294  LDSVLQHQFPHQNSLLSPQLLSPQQLQQQRLHLSVQPSLAHFSALRSQLYNSFPSPSHLG  353

Query  379  KYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            KYG+ D RDSR+K  +   ++VRFS+QGSDAA  KSESN PQFRSKYMTG+EIESILKMQ
Sbjct  354  KYGLADFRDSRSKPSQKVRQNVRFSKQGSDAACHKSESNVPQFRSKYMTGDEIESILKMQ  413

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H+++H NDPYVDDYYHQA LAK+A ESRSK+RFCPNKEQSSRSRNS ES PHLHVDA+GR
Sbjct  414  HSAAHGNDPYVDDYYHQARLAKKAAESRSKYRFCPNKEQSSRSRNSAESQPHLHVDAQGR  473

Query  25   VSFSSIRR  2
            VSFSSIRR
Sbjct  474  VSFSSIRR  481



>ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
 ref|XP_009594236.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=822

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 160/188 (85%), Gaps = 5/188 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGlls---pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            L++VL HQFPHQ+ LLS         QQQRLH SVQPSLAHFSALRSQL++SF +P+HL 
Sbjct  296  LDSVLQHQFPHQSSLLSPQFMSPQQLQQQRLHPSVQPSLAHFSALRSQLFSSFSSPSHLG  355

Query  379  KYGMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            KYGM D RD R+K SHK + +VRFS+Q SDAAS KSESN PQFRSKYMTG+EIESILKMQ
Sbjct  356  KYGMADLRDPRSKPSHKVRQNVRFSKQSSDAASHKSESNVPQFRSKYMTGDEIESILKMQ  415

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H+++H NDPYVDDYYHQA LAK+A ESRSKHRFCPNKEQSSRSRNSTES PHLHVDA GR
Sbjct  416  HSAAHGNDPYVDDYYHQARLAKKAAESRSKHRFCPNKEQSSRSRNSTESQPHLHVDAHGR  475

Query  25   VSFSSIRR  2
            VSFSSIRR
Sbjct  476  VSFSSIRR  483



>ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
 ref|XP_009781690.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
Length=814

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 159/187 (85%), Gaps = 5/187 (3%)
 Frame = -2

Query  547  NNVLPHQFPHQNGlls---pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSK  377
            + +L HQFPHQ+GLLS         QQQRLHLSVQPSLAHFSALRSQL++SFP+P+HL K
Sbjct  290  SGLLQHQFPHQSGLLSPQFMSPQQLQQQRLHLSVQPSLAHFSALRSQLFSSFPSPSHLGK  349

Query  376  YGMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
            YGM D RD R+K SHK + +V FS+Q SDAAS KSES  PQFRSKYMTG+EIESILKMQH
Sbjct  350  YGMADLRDPRSKPSHKVRQNVHFSKQSSDAASHKSESYVPQFRSKYMTGDEIESILKMQH  409

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGRV  23
            +++H NDPYVDDYYHQA LAK+A ESRSKHRFCPNKEQSSRSRNSTES PHLHVDA GRV
Sbjct  410  SAAHGNDPYVDDYYHQARLAKKASESRSKHRFCPNKEQSSRSRNSTESQPHLHVDAHGRV  469

Query  22   SFSSIRR  2
            SFSSIRR
Sbjct  470  SFSSIRR  476



>ref|XP_009602223.1| PREDICTED: uncharacterized protein LOC104097371 [Nicotiana tomentosiformis]
Length=814

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 3/186 (2%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlms-pqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKY  374
            LN++LPHQFPHQNGLLSPQ+MS  QQQRLHL+VQPSL HFSAL+SQL+NS+P+P+HLSKY
Sbjct  290  LNSILPHQFPHQNGLLSPQIMSPLQQQRLHLAVQPSLGHFSALQSQLFNSYPSPSHLSKY  349

Query  373  GMPDARDSRAKS-HKSKSVRFS-QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            G+ D R+ R+KS HK +   +S +Q +D ++ K ESN  QFRSKYMTG+EIESILKMQH+
Sbjct  350  GLADFRNPRSKSSHKGRQSEYSSKQVTDGSNHKRESNVSQFRSKYMTGDEIESILKMQHS  409

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGRVS  20
            ++H NDPYVDDYYHQA LAK+A ESRS  RFCPNKEQSSRSRNSTE+ PHLHVDA+GRVS
Sbjct  410  ATHRNDPYVDDYYHQARLAKKAAESRSMRRFCPNKEQSSRSRNSTETQPHLHVDAQGRVS  469

Query  19   FSSIRR  2
            FSSIRR
Sbjct  470  FSSIRR  475



>ref|XP_009757677.1| PREDICTED: uncharacterized protein LOC104210470 [Nicotiana sylvestris]
Length=814

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlms-pqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKY  374
            LN++LPHQFPHQNGLLSPQ+MS  QQQRLHL+VQPSL HFSAL+SQL+NS P+P HLSKY
Sbjct  290  LNSILPHQFPHQNGLLSPQIMSPLQQQRLHLAVQPSLGHFSALQSQLFNSCPSPLHLSKY  349

Query  373  GMPDARDSRAKS-HKSKSVRFS-QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            G+ D R+ R+KS HK +   +S +Q +D ++ + ESN  QFRSKYMTG+EIESILKMQH+
Sbjct  350  GLADFRNPRSKSSHKGRQSEYSSKQVTDGSNHRRESNVSQFRSKYMTGDEIESILKMQHS  409

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGRVS  20
            ++H NDPYVDDYYHQA LAK+A ESRS  RFCPNKEQSSRSRNSTE+ PHLHVDA+GRVS
Sbjct  410  ATHRNDPYVDDYYHQARLAKKAAESRSMRRFCPNKEQSSRSRNSTETQPHLHVDAQGRVS  469

Query  19   FSSIRR  2
            FSSIRR
Sbjct  470  FSSIRR  475



>ref|XP_006351984.1| PREDICTED: protein PAT1 homolog 1-like [Solanum tuberosum]
Length=816

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 158/188 (84%), Gaps = 7/188 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrL---HLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LN++ PHQFP QNGLLSP L+S QQ +    H  VQPSLAHFSAL SQ +NSFP+PAHL 
Sbjct  293  LNSLSPHQFP-QNGLLSPLLISSQQLQQRRLHHLVQPSLAHFSALPSQ-FNSFPSPAHLG  350

Query  379  KYGMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            K+G+ D RDS++KS HK + +VRFS+ GS+  SQKSE+N P+FRSKYMTG+EIESILKMQ
Sbjct  351  KHGLADFRDSKSKSSHKGRQNVRFSKLGSEGGSQKSENNVPKFRSKYMTGDEIESILKMQ  410

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H ++H NDPY DDYY+QA LAK+A ESRSKHRFCPNKEQ SRSRNST+S PHLHVDA+G+
Sbjct  411  HPATHGNDPYADDYYYQARLAKKAAESRSKHRFCPNKEQPSRSRNSTDSQPHLHVDAKGQ  470

Query  25   VSFSSIRR  2
            +SFSSIRR
Sbjct  471  ISFSSIRR  478



>ref|XP_010313689.1| PREDICTED: uncharacterized protein LOC101260608 isoform X1 [Solanum 
lycopersicum]
Length=818

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 157/188 (84%), Gaps = 7/188 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGlls---pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LN++ PHQFP +NGLLS         QQQRLH SVQPSLAHFSAL SQ +NSFP+PAHL 
Sbjct  295  LNSLSPHQFP-RNGLLSPLLISSQQLQQQRLHHSVQPSLAHFSALPSQ-FNSFPSPAHLG  352

Query  379  KYGMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            K+G+ D RDS++KS HK + +VRFS+  S+ +SQKSE+N P+FRSKYMTG+EIESILKMQ
Sbjct  353  KHGLDDFRDSKSKSSHKGRQNVRFSKLSSEGSSQKSENNVPKFRSKYMTGDEIESILKMQ  412

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H ++HCNDPY DDYY+QA LAK+A ESRSKHRFCPNKEQ SRSRNST+S PHLHVDA+G+
Sbjct  413  HPATHCNDPYADDYYYQARLAKKAAESRSKHRFCPNKEQPSRSRNSTDSQPHLHVDAKGQ  472

Query  25   VSFSSIRR  2
            +SFS IRR
Sbjct  473  ISFSFIRR  480



>ref|XP_004251557.1| PREDICTED: uncharacterized protein LOC101260608 isoform X2 [Solanum 
lycopersicum]
Length=817

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 157/188 (84%), Gaps = 7/188 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGlls---pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LN++ PHQFP +NGLLS         QQQRLH SVQPSLAHFSAL SQ +NSFP+PAHL 
Sbjct  294  LNSLSPHQFP-RNGLLSPLLISSQQLQQQRLHHSVQPSLAHFSALPSQ-FNSFPSPAHLG  351

Query  379  KYGMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            K+G+ D RDS++KS HK + +VRFS+  S+ +SQKSE+N P+FRSKYMTG+EIESILKMQ
Sbjct  352  KHGLDDFRDSKSKSSHKGRQNVRFSKLSSEGSSQKSENNVPKFRSKYMTGDEIESILKMQ  411

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H ++HCNDPY DDYY+QA LAK+A ESRSKHRFCPNKEQ SRSRNST+S PHLHVDA+G+
Sbjct  412  HPATHCNDPYADDYYYQARLAKKAAESRSKHRFCPNKEQPSRSRNSTDSQPHLHVDAKGQ  471

Query  25   VSFSSIRR  2
            +SFS IRR
Sbjct  472  ISFSFIRR  479



>ref|XP_011085449.1| PREDICTED: protein PAT1 homolog 1-like [Sesamum indicum]
Length=812

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 6/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            LNN+L HQ+  QNGLL  QL+SPQQQRLHLS QP LAHFSAL+S ++NS P+P+HLSKYG
Sbjct  289  LNNILQHQY--QNGLLPSQLISPQQQRLHLSYQPPLAHFSALQSPMFNSVPSPSHLSKYG  346

Query  370  MPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D R+S+ KS  K K SVRFS QGSDA S +S+S  PQFRSKYMT EEIESILKMQHA+
Sbjct  347  LSDKRESKHKSSQKGKHSVRFSHQGSDAISHRSDSTLPQFRSKYMTAEEIESILKMQHAA  406

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQA LAK++ E+RSK+RFCP+  +EQSSRSRNS ES PHLHVDA GRV
Sbjct  407  THGNDPYVDDYYHQARLAKKSSETRSKYRFCPSHPREQSSRSRNSVESQPHLHVDALGRV  466

Query  22   SFSSIRR  2
             FSS+RR
Sbjct  467  CFSSVRR  473



>gb|EYU42843.1| hypothetical protein MIMGU_mgv1a001457mg [Erythranthe guttata]
Length=816

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 154/188 (82%), Gaps = 7/188 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqr-LHLSVQPSLAHFSALRSQLYNSFPAPAHLSKY  374
            LNNVL HQ+  QNGLL  Q +  QQQ+  H+S  PSLAHFSA++SQ++N+FP+P+H +KY
Sbjct  292  LNNVLQHQY--QNGLLPSQQLLSQQQQRGHISFNPSLAHFSAMQSQIFNTFPSPSHFNKY  349

Query  373  GMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            G+ D R+ + KS +    SVRFS Q SDA+SQ+S+SN PQFRSKYMT EEIESILKMQHA
Sbjct  350  GLTDKREPKPKSAQKGRHSVRFSNQSSDASSQRSDSNLPQFRSKYMTAEEIESILKMQHA  409

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGR  26
            S+H NDPYVDDYYHQA LAK++ E+RS++RFCP+  KEQSSRSRNSTES PHLHVD+ GR
Sbjct  410  SNHGNDPYVDDYYHQASLAKKSAETRSRYRFCPSHQKEQSSRSRNSTESQPHLHVDSLGR  469

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  470  VCFSSIRR  477



>ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=817

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 154/188 (82%), Gaps = 7/188 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrL---HLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LN++ PHQFP Q GLLSPQLMSP+Q +    H SVQPSLAHFSALRSQ +NSFP+P+HL 
Sbjct  294  LNSISPHQFP-QIGLLSPQLMSPRQLQQQRFHPSVQPSLAHFSALRSQ-FNSFPSPSHLG  351

Query  379  KYG--MPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            KYG        S++ +   ++VRFSQQ S+A SQKSESN  +FRSKYMTG+EIESILKMQ
Sbjct  352  KYGSADSRDSRSKSSNKGRQNVRFSQQASEAGSQKSESNVSKFRSKYMTGDEIESILKMQ  411

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H + H NDPYVDDYYHQA LAK+A ESRSK+RFCPNKEQ SRSRNSTES PHLHVDA+G+
Sbjct  412  HPAIHGNDPYVDDYYHQARLAKKAAESRSKYRFCPNKEQPSRSRNSTESQPHLHVDAKGQ  471

Query  25   VSFSSIRR  2
            +SFSSIRR
Sbjct  472  ISFSSIRR  479



>ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana sylvestris]
Length=817

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 7/188 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlms---pqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LN++ PHQ P QNGLLSPQLMS    QQQRLH SVQPSLAHFSALRSQ +NSFP+P+H  
Sbjct  294  LNSISPHQIP-QNGLLSPQLMSPRQLQQQRLHPSVQPSLAHFSALRSQ-FNSFPSPSHPG  351

Query  379  KYG--MPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            KYG        S++ +   ++VRFSQQ S+A SQKSESN  +FRSKYMTG+EIESILKMQ
Sbjct  352  KYGSADSRDSRSKSSNKGRQNVRFSQQASEAGSQKSESNVSKFRSKYMTGDEIESILKMQ  411

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPHLHVDAEGR  26
            H ++H NDPYVDDYYHQA LAK+A ESRSK+RFCPNKEQ SRSRNSTES PHLHVDA+G+
Sbjct  412  HPATHGNDPYVDDYYHQARLAKKAAESRSKYRFCPNKEQPSRSRNSTESQPHLHVDAKGQ  471

Query  25   VSFSSIRR  2
            +SFSSIRR
Sbjct  472  ISFSSIRR  479



>emb|CDP16041.1| unnamed protein product [Coffea canephora]
Length=958

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 147/191 (77%), Gaps = 8/191 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGll----spqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            LN+ L  Q P QNGLL           QQ RLHLSVQPS+AHFSALRSQLYNSFP+PAHL
Sbjct  309  LNSFLYQQLPFQNGLLPPHLMSTQQQLQQARLHLSVQPSVAHFSALRSQLYNSFPSPAHL  368

Query  382  SKYGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKM  209
            SKYG+ + +DSR KS K    +VRFSQQGSDA SQ+S+SN PQFRSKYMT +EIESILKM
Sbjct  369  SKYGLANMKDSRPKSTKKGKHNVRFSQQGSDAGSQRSDSNWPQFRSKYMTADEIESILKM  428

Query  208  QHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESL--PHLHVDA  35
            QH+++H NDPYVDDYYHQA LAK+A E  S+HRFCP + + S SR+   +   PHLHVDA
Sbjct  429  QHSAAHSNDPYVDDYYHQARLAKKAAELGSEHRFCPAQTRESSSRSRNSTESQPHLHVDA  488

Query  34   EGRVSFSSIRR  2
             GRVSFSS+RR
Sbjct  489  LGRVSFSSVRR  499



>gb|EYU43158.1| hypothetical protein MIMGU_mgv1a023840mg, partial [Erythranthe 
guttata]
Length=674

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 152/187 (81%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            LN++L HQ  HQN LL PQL+  Q QR HLS QPS AHFS+L+SQ++NS P+P+H S+Y 
Sbjct  170  LNSILQHQ-SHQNVLLPPQLIPSQPQRRHLSFQPSSAHFSSLQSQMFNSVPSPSHFSQYR  228

Query  370  MPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D ++S+++S +   +SVRF  QGSDA+S +S+SN PQFRSKYM+ EEIESILK+QHA+
Sbjct  229  LADKKESKSRSSQKGKQSVRFCNQGSDASSNRSDSNLPQFRSKYMSAEEIESILKIQHAA  288

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQA LAK++ E+RS HRFCP+  KE SSRSRNSTES PHLHVDA GR+
Sbjct  289  THGNDPYVDDYYHQARLAKKSSETRSNHRFCPSNQKEPSSRSRNSTESQPHLHVDALGRI  348

Query  22   SFSSIRR  2
             FSS+RR
Sbjct  349  GFSSVRR  355



>ref|XP_007049006.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
 gb|EOX93163.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
Length=724

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 146/187 (78%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L ++L HQ PHQNGL+SPQL+SPQQQRLH SVQPSLAHF+AL+SQLYN+ P P+H    G
Sbjct  207  LQSMLQHQIPHQNGLISPQLISPQQQRLHHSVQPSLAHFAALQSQLYNAHP-PSHKMMLG  265

Query  370  MPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D RD R KS +    S+RFSQQ SD  SQKSES   QFRSKYMT EEIESILKMQHA+
Sbjct  266  LGDHRDQRTKSSQRNRLSMRFSQQSSDIGSQKSESGLVQFRSKYMTAEEIESILKMQHAA  325

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQACLAKR+  SR+KH FCP+  KE  SRSRNS E   HLHVDA G+V
Sbjct  326  THSNDPYVDDYYHQACLAKRSSGSRAKHHFCPSHLKELHSRSRNSGEQHLHLHVDALGKV  385

Query  22   SFSSIRR  2
              SSIRR
Sbjct  386  PLSSIRR  392



>ref|XP_007049005.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
 gb|EOX93162.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
Length=798

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 146/187 (78%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L ++L HQ PHQNGL+SPQL+SPQQQRLH SVQPSLAHF+AL+SQLYN+ P P+H    G
Sbjct  281  LQSMLQHQIPHQNGLISPQLISPQQQRLHHSVQPSLAHFAALQSQLYNAHP-PSHKMMLG  339

Query  370  MPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D RD R KS +    S+RFSQQ SD  SQKSES   QFRSKYMT EEIESILKMQHA+
Sbjct  340  LGDHRDQRTKSSQRNRLSMRFSQQSSDIGSQKSESGLVQFRSKYMTAEEIESILKMQHAA  399

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQACLAKR+  SR+KH FCP+  KE  SRSRNS E   HLHVDA G+V
Sbjct  400  THSNDPYVDDYYHQACLAKRSSGSRAKHHFCPSHLKELHSRSRNSGEQHLHLHVDALGKV  459

Query  22   SFSSIRR  2
              SSIRR
Sbjct  460  PLSSIRR  466



>ref|XP_011100381.1| PREDICTED: uncharacterized protein LOC105178578 [Sesamum indicum]
Length=815

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 6/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            LNN+L HQ+  QNGLL  QL+SPQQQR   S Q SLAH SAL+SQ++N+FP+PAHLSKYG
Sbjct  292  LNNILQHQY--QNGLLPLQLLSPQQQRGRPSFQQSLAHLSALQSQIFNTFPSPAHLSKYG  349

Query  370  MPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D R+S+ KS +    SVRFS QGSDA+S KS+SN PQFRSKYMT EEIESILKMQHA+
Sbjct  350  LADKRESKPKSAQKGRHSVRFSHQGSDASSHKSDSNLPQFRSKYMTAEEIESILKMQHAA  409

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPY+DDYYHQ  LAK++ E+RSK+RFCP+  +EQSSRSRNS++S PHLHVDA GRV
Sbjct  410  THGNDPYIDDYYHQGRLAKKSAETRSKYRFCPSHQREQSSRSRNSSDSQPHLHVDALGRV  469

Query  22   SFSSIRR  2
              SSIRR
Sbjct  470  CLSSIRR  476



>gb|KJB42927.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=797

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 141/187 (75%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L+N+L  Q PHQNGL+SPQLMSPQQQRLH SVQPSLAHF+AL+SQLYN+ P P+H    G
Sbjct  281  LHNMLQQQIPHQNGLISPQLMSPQQQRLHHSVQPSLAHFAALQSQLYNAHP-PSHKLMLG  339

Query  370  MPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D RD R KS   K +S R SQQ SD  SQKSES   QFRSKYM+ EEIESILKMQHA+
Sbjct  340  LADLRDQRTKSSQRKRQSSRISQQNSDTGSQKSESGLVQFRSKYMSAEEIESILKMQHAA  399

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQACL KR+  SR KH FCP+  K+  SRSRNS E   HLH DA G+ 
Sbjct  400  THSNDPYVDDYYHQACLVKRSFGSRGKHNFCPSHLKDLHSRSRNSGEQHLHLHADALGKA  459

Query  22   SFSSIRR  2
              SSIRR
Sbjct  460  PLSSIRR  466



>gb|KJB42926.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=776

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 141/187 (75%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L+N+L  Q PHQNGL+SPQLMSPQQQRLH SVQPSLAHF+AL+SQLYN+ P P+H    G
Sbjct  281  LHNMLQQQIPHQNGLISPQLMSPQQQRLHHSVQPSLAHFAALQSQLYNAHP-PSHKLMLG  339

Query  370  MPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D RD R KS   K +S R SQQ SD  SQKSES   QFRSKYM+ EEIESILKMQHA+
Sbjct  340  LADLRDQRTKSSQRKRQSSRISQQNSDTGSQKSESGLVQFRSKYMSAEEIESILKMQHAA  399

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQACL KR+  SR KH FCP+  K+  SRSRNS E   HLH DA G+ 
Sbjct  400  THSNDPYVDDYYHQACLVKRSFGSRGKHNFCPSHLKDLHSRSRNSGEQHLHLHADALGKA  459

Query  22   SFSSIRR  2
              SSIRR
Sbjct  460  PLSSIRR  466



>gb|KHG07107.1| Protein PAT1 [Gossypium arboreum]
Length=716

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 141/187 (75%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L+ +L  Q PHQNGL+SPQLMSPQQQRLH SVQPSLAHF+AL+SQLYN+ P P+H    G
Sbjct  200  LHYMLQQQIPHQNGLISPQLMSPQQQRLHHSVQPSLAHFAALQSQLYNAHP-PSHKLMLG  258

Query  370  MPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D RD R KS   K +S R SQQ SD  SQKSES   QFRSKYM+ EEIESILKMQHA+
Sbjct  259  LADIRDQRTKSSQRKRQSSRISQQNSDTGSQKSESGLVQFRSKYMSAEEIESILKMQHAA  318

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQACLAKR+  SR KH FCP+  K+  SRSRNS E   HLH DA G+ 
Sbjct  319  THSNDPYVDDYYHQACLAKRSFGSRGKHNFCPSHLKDLHSRSRNSGEQHLHLHADALGKA  378

Query  22   SFSSIRR  2
              SSIRR
Sbjct  379  PLSSIRR  385



>ref|XP_002264820.1| PREDICTED: protein PAT1 homolog 1-like [Vitis vinifera]
Length=812

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 140/190 (74%), Gaps = 7/190 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGll---spqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LNN+L  Q PHQNG++          QQQRLH SVQPS+AHFSALRSQLYN+ P+P H  
Sbjct  285  LNNILQQQLPHQNGIMPQQLMSQQQLQQQRLHHSVQPSMAHFSALRSQLYNTHPSPQHKG  344

Query  379  KYGMPDARDSRAKSHK--SKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
              G+ D RD R KS +   +++RFS Q SD++SQKS++   QFRSKYMT +EIESIL+MQ
Sbjct  345  MPGLSDMRDQRPKSTQRSKQNMRFSHQASDSSSQKSDNGLVQFRSKYMTADEIESILRMQ  404

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H NDPY+DDYYHQA LAK++ ESR KH F P+  K+  +R RN+TE   HL VDA 
Sbjct  405  HAATHSNDPYIDDYYHQARLAKKSAESRLKHHFYPSHLKDLPTRGRNNTEQHSHLPVDAL  464

Query  31   GRVSFSSIRR  2
            GR++FSSIRR
Sbjct  465  GRIAFSSIRR  474



>emb|CAN68728.1| hypothetical protein VITISV_033604 [Vitis vinifera]
Length=867

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 140/190 (74%), Gaps = 7/190 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGll---spqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LNN+L  Q PHQNG++          QQQRLH SVQPS+AHFSALRSQLYN+ P+P H  
Sbjct  340  LNNILQQQLPHQNGIMPQQLMSQQQLQQQRLHHSVQPSMAHFSALRSQLYNTHPSPQHKG  399

Query  379  KYGMPDARDSRAKSHK--SKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
              G+ D RD R KS +   +++RFS Q SD++SQKS++   QFRSKYMT +EIESIL+MQ
Sbjct  400  MPGLSDMRDQRPKSTQRSKQNMRFSHQASDSSSQKSDNGLVQFRSKYMTADEIESILRMQ  459

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H NDPY+DDYYHQA LAK++ ESR KH F P+  K+  +R RN+TE   HL VDA 
Sbjct  460  HAATHSNDPYIDDYYHQARLAKKSAESRLKHHFYPSHLKDLPTRGRNNTEQHSHLPVDAL  519

Query  31   GRVSFSSIRR  2
            GR++FSSIRR
Sbjct  520  GRIAFSSIRR  529



>gb|KJB10632.1| hypothetical protein B456_001G212600 [Gossypium raimondii]
Length=796

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L+ +L  Q PHQNGLL PQLMSPQQQR+H SVQPSLAHF+AL+SQ+Y S P+  H   +G
Sbjct  281  LHLMLQQQIPHQNGLLFPQLMSPQQQRIHHSVQPSLAHFAALQSQVYKSHPS--HKMVFG  338

Query  370  MPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D R+ R KS +   +S+R SQQ SDA SQKSES   QFRSKYMTGEEIESILKMQHA+
Sbjct  339  LADLREHRTKSSQRNRQSMRLSQQSSDAGSQKSESGLVQFRSKYMTGEEIESILKMQHAA  398

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQAC+AKR+  SR+KH F P+  KE  SR+RNS E   H HVDA G+V
Sbjct  399  THGNDPYVDDYYHQACVAKRSSGSRAKHHFYPSHPKESHSRTRNSGEQHLHHHVDALGKV  458

Query  22   SFSSIRR  2
              SSIRR
Sbjct  459  PLSSIRR  465



>ref|XP_010112872.1| hypothetical protein L484_017708 [Morus notabilis]
 gb|EXC35007.1| hypothetical protein L484_017708 [Morus notabilis]
Length=812

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            LNN+L  Q  HQNGLLS QL+S Q++  H SVQPSLAHF+AL+SQLYN+ P+ +H +  G
Sbjct  292  LNNILQQQLSHQNGLLSQQLLSQQKRL-HPSVQPSLAHFAALQSQLYNTHPSSSHRAMLG  350

Query  370  MPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSH  191
            + D R+ R K H+ K  RFSQ G D +SQKS+S   QFRSK+MT EEIESILKMQHA++H
Sbjct  351  LSDIREQRPK-HRGKQNRFSQAGFDTSSQKSDSGRLQFRSKHMTSEEIESILKMQHAATH  409

Query  190  CNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSF  17
             NDPY+DDYYHQA LAK+A  SR KH FCP+  +E  SR RNST+   HL VDA GR+  
Sbjct  410  SNDPYIDDYYHQASLAKKASGSRLKHPFCPSHLRELPSRGRNSTDQHSHLSVDALGRLPL  469

Query  16   SSIRR  2
            SSIRR
Sbjct  470  SSIRR  474



>ref|XP_004303935.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=806

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 140/189 (74%), Gaps = 8/189 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrL----HLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            LNN+L  Q PHQNGLLS QL+S QQQ      H  V PSLAHF+A++SQLYN+ P+P+H 
Sbjct  285  LNNILQQQLPHQNGLLSAQLLSAQQQLQQQRLHRPVPPSLAHFAAMQSQLYNTHPSPSHK  344

Query  382  SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
              +G+PD R+ R K H+ K  RFSQ GSD  SQKSES   QFRSK+MT EEIESILKMQH
Sbjct  345  PMHGLPDIREHRPK-HRGKHNRFSQ-GSDTGSQKSESGFIQFRSKHMTSEEIESILKMQH  402

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEG  29
            A++H NDPY+DDYYHQA L+K+A  SRSK+ FCP+  +E SSR RNS++   H  VD+ G
Sbjct  403  AATHSNDPYIDDYYHQASLSKKAAGSRSKNSFCPSHLREFSSRGRNSSDQHSHSSVDSLG  462

Query  28   RVSFSSIRR  2
            R+  SSIRR
Sbjct  463  RIPLSSIRR  471



>gb|KHG26425.1| Protein PAT1 [Gossypium arboreum]
Length=795

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L+ +L  Q PHQNGLL PQLMSPQQQR+H SVQPSLAHF+AL+SQ+Y S P+  H    G
Sbjct  281  LHLMLQQQIPHQNGLLFPQLMSPQQQRMHHSVQPSLAHFAALQSQVYKSHPS--HKMMLG  338

Query  370  MPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            + D R+ R KS +   +S+R S Q SDA SQKSES   QFRSKYMTGEEIESILKMQHA+
Sbjct  339  LADLREHRTKSSQRNRQSMRLSPQSSDAGSQKSESGLVQFRSKYMTGEEIESILKMQHAA  398

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPYVDDYYHQAC+AKR+  SR+KH+F P+  KE  SR+RNS E   H HVDA G+V
Sbjct  399  THSNDPYVDDYYHQACVAKRS-GSRAKHQFYPSHPKESHSRTRNSGEQHLHHHVDALGKV  457

Query  22   SFSSIRR  2
              SSIRR
Sbjct  458  PLSSIRR  464



>ref|XP_008342293.1| PREDICTED: protein PAT1 homolog 1-like [Malus domestica]
Length=803

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 135/189 (71%), Gaps = 10/189 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGlls----pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            +NN+L  Q PHQ+GL+S          QQQRLH SVQPSLAHF+A++SQ Y + P+ +H 
Sbjct  285  INNILQQQLPHQDGLISPQLLAAQQQLQQQRLHHSVQPSLAHFAAMQSQFYGTHPSSSHK  344

Query  382  SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
            S +G+ D RD R K  K    RFSQ GSDA SQKSE+   QFRSK+MT EEIESILKMQH
Sbjct  345  SMHGLSDVRDHRPKRGKQ---RFSQ-GSDAGSQKSETGWIQFRSKHMTSEEIESILKMQH  400

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEG  29
            A++H NDPY+DDYYHQA L+K+A  SRSKH FCP+  +E  SR RNST+   H  VDA G
Sbjct  401  AATHSNDPYIDDYYHQASLSKKAAGSRSKHPFCPSHLRESPSRGRNSTDQHTHSSVDALG  460

Query  28   RVSFSSIRR  2
            R+  +SIRR
Sbjct  461  RIPLASIRR  469



>ref|XP_007217055.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
 gb|EMJ18254.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
Length=886

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 138/189 (73%), Gaps = 9/189 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGlls----pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            +NN+L  Q PHQNGLLS          QQQRLH SVQPSLAHF+A++SQLY++ P+P+H 
Sbjct  366  INNILQQQHPHQNGLLSPQLLSAQQQLQQQRLHHSVQPSLAHFAAMQSQLYSTHPSPSHK  425

Query  382  SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
              +G+ D RD R K H+ K  R+SQ GSD  SQKSES   QFRSK+MT EEIESILKMQH
Sbjct  426  GMHGLSDTRDHRPK-HRGKQ-RYSQ-GSDTGSQKSESGWIQFRSKHMTSEEIESILKMQH  482

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEG  29
            A++H NDPY+DDYYHQA L+K++  SRSKH FCP+  +E  SR RNS++   H  VDA G
Sbjct  483  AATHSNDPYIDDYYHQASLSKKSAGSRSKHPFCPSHLREFPSRGRNSSDQHTHSSVDALG  542

Query  28   RVSFSSIRR  2
            R+  SSIRR
Sbjct  543  RIPLSSIRR  551



>ref|XP_009377953.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=817

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 134/190 (71%), Gaps = 11/190 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGlls-----pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAH  386
            +NN+L  Q PHQNGL+S      Q    QQQRLH SVQPS+AHF+A++SQ Y + P+ +H
Sbjct  297  INNILQQQLPHQNGLISPQLLSAQQQQLQQQRLHHSVQPSMAHFAAMQSQFYGTHPSSSH  356

Query  385  LSKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
             S +G+ D RD R K  K    RFSQ GSDA SQKSES   QFRSK+MT EEIESILKMQ
Sbjct  357  KSMHGLSDVRDHRPKRGKQ---RFSQ-GSDAGSQKSESGWIQFRSKHMTSEEIESILKMQ  412

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H NDPY+DDYYHQA L+K+A   R KH FCP+  +E  SR RNST+   H  VDA 
Sbjct  413  HAATHSNDPYIDDYYHQASLSKKAAGLRLKHPFCPSHLRESPSRGRNSTDQHTHSSVDAL  472

Query  31   GRVSFSSIRR  2
            GR+  +SIRR
Sbjct  473  GRIPLASIRR  482



>ref|XP_008229675.1| PREDICTED: protein PAT1 homolog 1-like [Prunus mume]
Length=808

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 137/189 (72%), Gaps = 9/189 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGlls----pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            +NN+L  Q PHQNGLLS          QQQRLH SVQPSLAHF+A++SQLY++ P+P+H 
Sbjct  288  INNILQQQHPHQNGLLSPQLLSAQQQLQQQRLHHSVQPSLAHFAAMQSQLYSTHPSPSHK  347

Query  382  SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
              +G+ D RD R K H+ K  R+SQ GSD  SQKSES   QFRSK+MT EEIESILKMQH
Sbjct  348  GMHGLSDTRDHRPK-HRGKQ-RYSQ-GSDTGSQKSESGWIQFRSKHMTSEEIESILKMQH  404

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEG  29
            A++H NDPY+DDYYHQA L+K++  SRSK  FCP+  +E  SR RNS++   H  VDA G
Sbjct  405  AATHSNDPYIDDYYHQASLSKKSAGSRSKQPFCPSHLREFPSRGRNSSDQHTHSSVDALG  464

Query  28   RVSFSSIRR  2
            R+  SSIRR
Sbjct  465  RIPLSSIRR  473



>ref|XP_008378353.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441447 
[Malus domestica]
Length=804

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 133/188 (71%), Gaps = 10/188 (5%)
 Frame = -2

Query  547  NNVLPHQFPHQNGlls----pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            NN+L  Q PHQNGLLS          QQQRLH SVQPSLAHF+A++SQ Y + P+ +H S
Sbjct  286  NNMLQQQLPHQNGLLSPQLLSAQQQLQQQRLHHSVQPSLAHFAAMQSQFYGTHPSSSHKS  345

Query  379  KYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
             +G+ D  + R K  K    RFSQ GSD  SQKSES   QFRSK+MT EEIESILKMQHA
Sbjct  346  MHGLSDTSNHRPKRGKH---RFSQ-GSDTGSQKSESGWIQFRSKHMTSEEIESILKMQHA  401

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGR  26
            ++H NDPY+DDYYHQA L+K+A  SRSKH FCP+  +E SSR RNST+   H  VDA GR
Sbjct  402  ATHSNDPYIDDYYHQASLSKKAAGSRSKHPFCPSHLREFSSRGRNSTDQHTHSSVDALGR  461

Query  25   VSFSSIRR  2
            +  +SIRR
Sbjct  462  IPLASIRR  469



>ref|XP_010243918.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Nelumbo nucifera]
Length=825

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 10/165 (6%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSF--PAPAHLSKY----GMPDARDSRAKSHKS--KSVRFS  311
            H  VQPSLAHFSAL+SQL+ S   P+P  +SKY    GM + RD R K+ +   +++R+S
Sbjct  322  HHPVQPSLAHFSALQSQLFGSHSSPSPHVISKYESMLGMAELRDQRTKATQRGRQNLRYS  381

Query  310  QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAV  131
            QQGSD +SQKS++  PQFRSKYMT EEIESIL+MQHA++H +DPYVDDYYHQACLAK++ 
Sbjct  382  QQGSDTSSQKSDNGWPQFRSKYMTAEEIESILRMQHAATHSSDPYVDDYYHQACLAKKSA  441

Query  130  ESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             SR KH FCP   ++  SR+R +TE    L VDA GR+ FSSIRR
Sbjct  442  GSRLKHHFCPTHLRDLPSRARANTEPHAFLQVDALGRLPFSSIRR  486



>ref|XP_010243919.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Nelumbo nucifera]
Length=824

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 10/165 (6%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSF--PAPAHLSKY----GMPDARDSRAKSHKS--KSVRFS  311
            H  VQPSLAHFSAL+SQL+ S   P+P  +SKY    GM + RD R K+ +   +++R+S
Sbjct  321  HHPVQPSLAHFSALQSQLFGSHSSPSPHVISKYESMLGMAELRDQRTKATQRGRQNLRYS  380

Query  310  QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAV  131
            QQGSD +SQKS++  PQFRSKYMT EEIESIL+MQHA++H +DPYVDDYYHQACLAK++ 
Sbjct  381  QQGSDTSSQKSDNGWPQFRSKYMTAEEIESILRMQHAATHSSDPYVDDYYHQACLAKKSA  440

Query  130  ESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             SR KH FCP   ++  SR+R +TE    L VDA GR+ FSSIRR
Sbjct  441  GSRLKHHFCPTHLRDLPSRARANTEPHAFLQVDALGRLPFSSIRR  485



>ref|XP_010645008.1| PREDICTED: protein PAT1 homolog 1 isoform X3 [Vitis vinifera]
Length=778

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 132/196 (67%), Gaps = 13/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            LNN+L  Q PHQNGL+ PQLM  QQ + H     VQPS  H S L+SQL+N    PAP  
Sbjct  244  LNNLLQQQLPHQNGLMPPQLMLQQQPQQHRLHHPVQPSFGHLSGLQSQLFNPHLSPAPPI  303

Query  385  LSKY----GMPDARDSRAKSHKSKSV--RFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            ++KY    G+ D RD R KS +      RFSQQG D +SQKS+   PQFRSKYMT +EIE
Sbjct  304  MNKYEAMLGIGDLRDQRPKSMQKGRPNHRFSQQGFDTSSQKSDVGWPQFRSKYMTADEIE  363

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQ A++H NDPYVDDYYHQACLAK++  +R KH FCP   +E   R+R ++E    
Sbjct  364  SILRMQLAATHSNDPYVDDYYHQACLAKKSAGARLKHHFCPTHLRELPPRARANSEPHAF  423

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV FSSIRR
Sbjct  424  LQVDALGRVPFSSIRR  439



>ref|XP_010645007.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Vitis vinifera]
Length=781

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 132/196 (67%), Gaps = 13/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            LNN+L  Q PHQNGL+ PQLM  QQ + H     VQPS  H S L+SQL+N    PAP  
Sbjct  247  LNNLLQQQLPHQNGLMPPQLMLQQQPQQHRLHHPVQPSFGHLSGLQSQLFNPHLSPAPPI  306

Query  385  LSKY----GMPDARDSRAKSHKSKSV--RFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            ++KY    G+ D RD R KS +      RFSQQG D +SQKS+   PQFRSKYMT +EIE
Sbjct  307  MNKYEAMLGIGDLRDQRPKSMQKGRPNHRFSQQGFDTSSQKSDVGWPQFRSKYMTADEIE  366

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQ A++H NDPYVDDYYHQACLAK++  +R KH FCP   +E   R+R ++E    
Sbjct  367  SILRMQLAATHSNDPYVDDYYHQACLAKKSAGARLKHHFCPTHLRELPPRARANSEPHAF  426

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV FSSIRR
Sbjct  427  LQVDALGRVPFSSIRR  442



>ref|XP_010645006.1| PREDICTED: uncharacterized protein LOC100267869 isoform X1 [Vitis 
vinifera]
Length=828

 Score =   182 bits (461),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 132/196 (67%), Gaps = 13/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            LNN+L  Q PHQNGL+ PQLM  QQ + H     VQPS  H S L+SQL+N    PAP  
Sbjct  294  LNNLLQQQLPHQNGLMPPQLMLQQQPQQHRLHHPVQPSFGHLSGLQSQLFNPHLSPAPPI  353

Query  385  LSKY----GMPDARDSRAKSHKSKSV--RFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            ++KY    G+ D RD R KS +      RFSQQG D +SQKS+   PQFRSKYMT +EIE
Sbjct  354  MNKYEAMLGIGDLRDQRPKSMQKGRPNHRFSQQGFDTSSQKSDVGWPQFRSKYMTADEIE  413

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQ A++H NDPYVDDYYHQACLAK++  +R KH FCP   +E   R+R ++E    
Sbjct  414  SILRMQLAATHSNDPYVDDYYHQACLAKKSAGARLKHHFCPTHLRELPPRARANSEPHAF  473

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV FSSIRR
Sbjct  474  LQVDALGRVPFSSIRR  489



>gb|KJB08598.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=810

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L+++L HQ PHQNGL+SPQLMSPQQ RLH S+QPSLAH +AL+SQLYN  P+ +H   +G
Sbjct  277  LHHMLQHQIPHQNGLISPQLMSPQQHRLHHSIQPSLAHLTALQSQLYNPHPS-SHKMMFG  335

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
              D R+ R KS +++ S+RFSQQ SD +SQK+ES   QFRSK+MT EEIESILKMQHA++
Sbjct  336  TADHREQRTKSSRNRQSMRFSQQSSDTSSQKNESGLVQFRSKHMTAEEIESILKMQHAAT  395

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNST-ESLPHLHVDAEGRV  23
            H NDPYVDDYYHQACLAKR+  SR+KH FCP+  KE  SRSRNS+ E   H+HVDA G+V
Sbjct  396  HSNDPYVDDYYHQACLAKRSSGSRAKHLFCPSHLKESHSRSRNSSGEQHLHVHVDALGKV  455

Query  22   SFSSIRR  2
               +IR+
Sbjct  456  PVPTIRK  462



>gb|KJB08599.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=792

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 5/187 (3%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            L+++L HQ PHQNGL+SPQLMSPQQ RLH S+QPSLAH +AL+SQLYN  P+ +H   +G
Sbjct  277  LHHMLQHQIPHQNGLISPQLMSPQQHRLHHSIQPSLAHLTALQSQLYNPHPS-SHKMMFG  335

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
              D R+ R KS +++ S+RFSQQ SD +SQK+ES   QFRSK+MT EEIESILKMQHA++
Sbjct  336  TADHREQRTKSSRNRQSMRFSQQSSDTSSQKNESGLVQFRSKHMTAEEIESILKMQHAAT  395

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNST-ESLPHLHVDAEGRV  23
            H NDPYVDDYYHQACLAKR+  SR+KH FCP+  KE  SRSRNS+ E   H+HVDA G+V
Sbjct  396  HSNDPYVDDYYHQACLAKRSSGSRAKHLFCPSHLKESHSRSRNSSGEQHLHVHVDALGKV  455

Query  22   SFSSIRR  2
               +IR+
Sbjct  456  PVPTIRK  462



>ref|XP_010243929.1| PREDICTED: protein PAT1 homolog 1-like [Nelumbo nucifera]
Length=826

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 121/165 (73%), Gaps = 10/165 (6%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSF--PAPAHLSKY----GMPDARDSRAKSHKSK--SVRFS  311
            H  VQPSLAHFS+L+SQL+ S   P P  +SKY    GM + RD R KS +    ++RFS
Sbjct  323  HHPVQPSLAHFSSLQSQLFGSHSSPPPHVISKYESMLGMAELRDQRTKSTQRGRHNLRFS  382

Query  310  QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAV  131
            QQGSD +SQKSE+   Q RSKYMT EEIE+IL+MQHA++H +DPY+DDYYHQACLAK++ 
Sbjct  383  QQGSDTSSQKSENGWLQIRSKYMTAEEIETILRMQHAATHSSDPYIDDYYHQACLAKKSA  442

Query  130  ESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             SR KH FCP   ++ SSR+R +TE   +L VDA GR+ FSSIRR
Sbjct  443  GSRLKHHFCPTHLRDLSSRARANTEPHAYLQVDALGRLPFSSIRR  487



>ref|XP_009375341.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=804

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 131/188 (70%), Gaps = 10/188 (5%)
 Frame = -2

Query  547  NNVLPHQFPHQNGlls----pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            NN+L  Q PHQNGLLS          QQQRLH SVQPSLAHF+A++SQ Y + P+ +H S
Sbjct  286  NNMLQQQLPHQNGLLSPQLLSAQQQLQQQRLHHSVQPSLAHFAAMQSQFYGTHPSSSHKS  345

Query  379  KYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
             +G+ D  + R K  K    RFSQ GSD  SQKSES   QFRSK+MT EEIESILKMQHA
Sbjct  346  MHGLSDISNHRPKRGKH---RFSQ-GSDTGSQKSESGWIQFRSKHMTSEEIESILKMQHA  401

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGR  26
            ++H NDPY+DDYYHQA L+K+A  SRSKH FCP+  +E  SR RNST+   H  V A GR
Sbjct  402  ATHSNDPYIDDYYHQASLSKKAAGSRSKHPFCPSHLREFPSRGRNSTDQHTHRSVAALGR  461

Query  25   VSFSSIRR  2
            +  +SIRR
Sbjct  462  IPLASIRR  469



>ref|XP_009375342.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=801

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 131/188 (70%), Gaps = 10/188 (5%)
 Frame = -2

Query  547  NNVLPHQFPHQNGlls----pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            NN+L  Q PHQNGLLS          QQQRLH SVQPSLAHF+A++SQ Y + P+ +H S
Sbjct  283  NNMLQQQLPHQNGLLSPQLLSAQQQLQQQRLHHSVQPSLAHFAAMQSQFYGTHPSSSHKS  342

Query  379  KYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
             +G+ D  + R K  K    RFSQ GSD  SQKSES   QFRSK+MT EEIESILKMQHA
Sbjct  343  MHGLSDISNHRPKRGKH---RFSQ-GSDTGSQKSESGWIQFRSKHMTSEEIESILKMQHA  398

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGR  26
            ++H NDPY+DDYYHQA L+K+A  SRSKH FCP+  +E  SR RNST+   H  V A GR
Sbjct  399  ATHSNDPYIDDYYHQASLSKKAAGSRSKHPFCPSHLREFPSRGRNSTDQHTHRSVAALGR  458

Query  25   VSFSSIRR  2
            +  +SIRR
Sbjct  459  IPLASIRR  466



>ref|XP_002520595.1| hypothetical protein RCOM_0673440 [Ricinus communis]
 gb|EEF41828.1| hypothetical protein RCOM_0673440 [Ricinus communis]
Length=739

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 4/158 (3%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSK-SVRFSQQGSDA  293
            H S QPSLAHF+A++S LYNS P+ AH    G+ D RD + KS HK + + R  +QGSD 
Sbjct  244  HSSGQPSLAHFAAMQSHLYNSHPSSAHKMMLGLSDIRDQKHKSSHKGRHNARLPKQGSDV  303

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSKYM  EEIESILKMQHA++H NDPY+DDYYHQA LAKR+  SR K 
Sbjct  304  SSQKSDSGWLQFRSKYMIAEEIESILKMQHAATHGNDPYIDDYYHQASLAKRSDGSRVKK  363

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIR  5
             FCP+  KE  SRSRNST+   HLHV+A G+   +SIR
Sbjct  364  PFCPSHMKEPPSRSRNSTDQQSHLHVNALGKTPLTSIR  401



>ref|XP_010036063.1| PREDICTED: protein PAT1 homolog 1-like [Eucalyptus grandis]
 gb|KCW47590.1| hypothetical protein EUGRSUZ_K01336 [Eucalyptus grandis]
Length=806

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSFPAPAHLSK  377
            N +L  Q  HQNG +S  LMSP QQ  H    S+Q SLAH++ALRS +Y++ P P+H   
Sbjct  279  NLMLQQQLSHQNGFISQHLMSPHQQLQHQRIHSLQSSLAHYAALRSPVYSTHPPPSHKVM  338

Query  376  YGMPDARDSRAKSHK--SKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
             G+ D RD R KS +   +SVRFSQQGS+ +SQKS++ + QFRSKYMT EEIESILKMQH
Sbjct  339  LGLSDGRDHRPKSSQRGKQSVRFSQQGSELSSQKSDTISIQFRSKYMTSEEIESILKMQH  398

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNST-ESLPHLHVDAE  32
            A++H NDPYVDDYYHQA LA ++   RSK RFCP+  +E  SRSRNS+ E   HL  DA 
Sbjct  399  AATHSNDPYVDDYYHQARLAHKSSGPRSKQRFCPSHIRELPSRSRNSSMEQHSHLAADAV  458

Query  31   GRVSFSSIRR  2
            GRV  SS+RR
Sbjct  459  GRVPLSSVRR  468



>ref|XP_002513418.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48821.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 132/196 (67%), Gaps = 13/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLS---VQPSLAHFSALRSQLYNSF--PAPAH  386
            LNN+L  Q PHQNGL+ PQLM+  Q + H     VQPSL H S ++SQL+N    P+PA 
Sbjct  292  LNNMLQQQLPHQNGLMPPQLMAQLQTQQHRLHHLVQPSLGHLSGMQSQLFNPHHSPSPAL  351

Query  385  LSKY----GMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            + K+    G+ D RD R +S +    ++R+SQQG D  SQK +   PQFRSK+MT +EIE
Sbjct  352  MGKFDPVLGLGDIRDQRPRSAQKARPNMRYSQQGFDLNSQKIDGIWPQFRSKHMTADEIE  411

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQ A+ H NDPYVDDYYHQACLAK++V ++ KH FCP   ++   R+R + E    
Sbjct  412  SILRMQLAAMHSNDPYVDDYYHQACLAKKSVGAKLKHHFCPTHLRDLPPRARANAEPHAF  471

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GR +FSSIRR
Sbjct  472  LQVDALGRAAFSSIRR  487



>gb|KDP44628.1| hypothetical protein JCGZ_22047 [Jatropha curcas]
Length=737

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKSHKSK-SVRFSQQGSDAA  290
            H  VQPSLAH +A++S LYN+ P+ AH   +G+ D +     SHK + + R SQQGSDA+
Sbjct  247  HNPVQPSLAHLAAMQSHLYNTHPSSAHKMMFGLSDQK--HKSSHKGRQNTRLSQQGSDAS  304

Query  289  SQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHR  110
            SQKS+S   QFRSKYMT EEIESILKMQHA++H +DPYVDDYYHQA LAKR+  SR+KH+
Sbjct  305  SQKSDSGLLQFRSKYMTSEEIESILKMQHAATHSSDPYVDDYYHQARLAKRSAGSRAKHQ  364

Query  109  FCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFS  14
            FCP+  KE  +R RNS++   HLH +A G++  S
Sbjct  365  FCPSHMKELPNRGRNSSDQQSHLHGNAAGKIPLS  398



>gb|KDO64328.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
Length=622

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKS-VRFSQQGSDA  293
            H  V PSLAHFSAL+ QLY++  + +H + +G  D RD + K SH+S+   R S Q SDA
Sbjct  200  HHPVPPSLAHFSALQPQLYSAHHSSSHKAMHGA-DIRDHKPKTSHRSRGGTRLSHQSSDA  258

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSKYMT EEIESILKMQHA++H NDPYVDDYYHQA LAK++  SR K 
Sbjct  259  SSQKSDSGWVQFRSKYMTAEEIESILKMQHAATHSNDPYVDDYYHQASLAKKSTGSRMKS  318

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SR+RNSTE   HL  DA GR+  SSIRR
Sbjct  319  HFCPSHLKELPSRARNSTE---HLQADALGRIPLSSIRR  354



>gb|KDO64329.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
Length=655

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKS-VRFSQQGSDA  293
            H  V PSLAHFSAL+ QLY++  + +H + +G  D RD + K SH+S+   R S Q SDA
Sbjct  200  HHPVPPSLAHFSALQPQLYSAHHSSSHKAMHGA-DIRDHKPKTSHRSRGGTRLSHQSSDA  258

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSKYMT EEIESILKMQHA++H NDPYVDDYYHQA LAK++  SR K 
Sbjct  259  SSQKSDSGWVQFRSKYMTAEEIESILKMQHAATHSNDPYVDDYYHQASLAKKSTGSRMKS  318

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SR+RNSTE   HL  DA GR+  SSIRR
Sbjct  319  HFCPSHLKELPSRARNSTE---HLQADALGRIPLSSIRR  354



>ref|XP_002308825.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
 gb|EEE92348.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
Length=789

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 131/189 (69%), Gaps = 15/189 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlms----pqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            L ++L  Q  HQNGL+S  LMS     QQQRLH S+QPSLAHF+A++SQL+NS P+  H+
Sbjct  274  LESILQQQLSHQNGLMSAHLMSPQQQLQQQRLHSSLQPSLAHFAAMQSQLFNSHPSSLHI  333

Query  382  SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
                    RD + KS   ++ RFSQ GSD  SQKS+S   QFRSK+MT +EIESILKMQH
Sbjct  334  --------RDQKHKSSSQRNRRFSQ-GSDTGSQKSDSGWVQFRSKHMTADEIESILKMQH  384

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEG  29
            A++H  DPY+DDYYHQA +AK++  SR KH FCP+  KE  SRSRNS +   HLH DA G
Sbjct  385  AATHSTDPYIDDYYHQASIAKKSTGSRIKHNFCPSHMKELPSRSRNSADQHSHLHFDALG  444

Query  28   RVSFSSIRR  2
            ++    IR+
Sbjct  445  KIPLPPIRK  453



>ref|XP_006429752.1| hypothetical protein CICLE_v10013436mg, partial [Citrus clementina]
 gb|ESR42992.1| hypothetical protein CICLE_v10013436mg, partial [Citrus clementina]
Length=695

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKS-VRFSQQGSDA  293
            H  V PSLAHFSAL+ QLY++  + +H + +G  D RD + K SH+S+   R S Q SDA
Sbjct  215  HHPVPPSLAHFSALQPQLYSAHHSSSHKAMHGA-DIRDHKPKTSHRSRGGTRLSHQSSDA  273

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSKYMT EEIESILKMQHA++H NDPYVDDYYHQA LAK++  SR K 
Sbjct  274  SSQKSDSGWVQFRSKYMTAEEIESILKMQHAATHSNDPYVDDYYHQASLAKKSTGSRMKS  333

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SR+RNSTE   HL  DA GR+  SSIRR
Sbjct  334  HFCPSHLKELPSRARNSTE---HLQADALGRIPLSSIRR  369



>gb|KDO64330.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
 gb|KDO64331.1| hypothetical protein CISIN_1g0038252mg, partial [Citrus sinensis]
Length=680

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKS-VRFSQQGSDA  293
            H  V PSLAHFSAL+ QLY++  + +H + +G  D RD + K SH+S+   R S Q SDA
Sbjct  200  HHPVPPSLAHFSALQPQLYSAHHSSSHKAMHGA-DIRDHKPKTSHRSRGGTRLSHQSSDA  258

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSKYMT EEIESILKMQHA++H NDPYVDDYYHQA LAK++  SR K 
Sbjct  259  SSQKSDSGWVQFRSKYMTAEEIESILKMQHAATHSNDPYVDDYYHQASLAKKSTGSRMKS  318

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SR+RNSTE   HL  DA GR+  SSIRR
Sbjct  319  HFCPSHLKELPSRARNSTE---HLQADALGRIPLSSIRR  354



>ref|XP_006481341.1| PREDICTED: uncharacterized protein LOC102618153 isoform X2 [Citrus 
sinensis]
Length=768

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKS-VRFSQQGSDA  293
            H  V PSLAHFSAL+ QLY++  + +H + +G  D RD + K SH+S+   R S Q SDA
Sbjct  313  HHPVPPSLAHFSALQPQLYSAHHSSSHKAMHGA-DIRDHKPKTSHRSRGGTRLSHQSSDA  371

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSKYMT EEIESILKMQHA++H NDPYVDDYYHQA LAK++  SR K 
Sbjct  372  SSQKSDSGWVQFRSKYMTAEEIESILKMQHAATHSNDPYVDDYYHQASLAKKSTGSRMKS  431

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SR+RNSTE   HL  DA GR+  SSIRR
Sbjct  432  HFCPSHLKELPSRARNSTE---HLQADALGRIPLSSIRR  467



>ref|XP_010926894.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Elaeis guineensis]
Length=822

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 127/190 (67%), Gaps = 9/190 (5%)
 Frame = -2

Query  544  NVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSK----  377
            N++  Q P  NGL+SPQL   Q Q     +Q SL+H S ++SQL+   P+P  +      
Sbjct  294  NLMQQQLPQSNGLMSPQLFPAQHQHRMPQIQSSLSHISQMQSQLFGPHPSPLQMMNNFEP  353

Query  376  -YGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
              GM + RD R KS +   + +RFSQ GSD +SQKS++  PQFRSKYM+ +EIE+IL+MQ
Sbjct  354  MLGMAELRDQRVKSMQRGRQMLRFSQHGSDTSSQKSDNGWPQFRSKYMSADEIENILRMQ  413

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H +DPYVDDYYHQACLAK++  SR KH FCP   ++  SR+R   E   +L VDA 
Sbjct  414  HAATHGSDPYVDDYYHQACLAKKSAGSRLKHHFCPTSIRDLPSRARAKDEPHAYLQVDAL  473

Query  31   GRVSFSSIRR  2
            GR+ FSSIRR
Sbjct  474  GRLPFSSIRR  483



>ref|XP_006481340.1| PREDICTED: uncharacterized protein LOC102618153 isoform X1 [Citrus 
sinensis]
Length=793

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKS-VRFSQQGSDA  293
            H  V PSLAHFSAL+ QLY++  + +H + +G  D RD + K SH+S+   R S Q SDA
Sbjct  313  HHPVPPSLAHFSALQPQLYSAHHSSSHKAMHGA-DIRDHKPKTSHRSRGGTRLSHQSSDA  371

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSKYMT EEIESILKMQHA++H NDPYVDDYYHQA LAK++  SR K 
Sbjct  372  SSQKSDSGWVQFRSKYMTAEEIESILKMQHAATHSNDPYVDDYYHQASLAKKSTGSRMKS  431

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SR+RNSTE   HL  DA GR+  SSIRR
Sbjct  432  HFCPSHLKELPSRARNSTE---HLQADALGRIPLSSIRR  467



>ref|XP_004147742.1| PREDICTED: uncharacterized protein LOC101213130 [Cucumis sativus]
 gb|KGN53503.1| hypothetical protein Csa_4G062390 [Cucumis sativus]
Length=808

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 7/190 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrL----HLSVQPSLAHFSALRSQLYNSFPAPAHL  383
             N++L  Q  HQNGLLSPQL+S  QQ      H  VQPSLAHF+AL+SQLYN+    +H 
Sbjct  280  FNSILQQQLSHQNGLLSPQLLSAHQQLQQHRLHHPVQPSLAHFAALQSQLYNAHSPSSHR  339

Query  382  SKYGMPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            +  G+ D R+ + KS + K ++R SQQGS+  SQKS+S + QFRSK+MT +EIESILKMQ
Sbjct  340  AMLGLSDVREQKPKSQRGKHNMRSSQQGSETGSQKSDSGSIQFRSKHMTADEIESILKMQ  399

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H NDPY+DDYYHQA +AK+A  SR K+ FCP+  +E  SRSR+ ++   H   D+ 
Sbjct  400  HAATHSNDPYIDDYYHQARVAKKATGSRLKNAFCPSRLRELPSRSRSGSDQHSHSTPDSL  459

Query  31   GRVSFSSIRR  2
            G++  +SIRR
Sbjct  460  GKIPLASIRR  469



>ref|XP_008451848.1| PREDICTED: uncharacterized protein LOC103493011 [Cucumis melo]
Length=808

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 7/190 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqr----LHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
             N++L  Q  HQNGLLSPQL+S  QQ     +H  VQPSLAHF+AL+SQLYN+    +H 
Sbjct  280  FNSILQQQLSHQNGLLSPQLLSAHQQLQQHRMHHPVQPSLAHFAALQSQLYNAHSPSSHR  339

Query  382  SKYGMPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
               G+ D R+ + KS + K ++R SQQGS+  SQKS+S + QFRSK+MT +EIESILKMQ
Sbjct  340  GMLGLSDVREQKPKSQRGKHNMRSSQQGSETGSQKSDSGSIQFRSKHMTADEIESILKMQ  399

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H NDPY+DDYYHQA +AK+A  SR K+ FCP+  +E  SRSR+ ++   H   D+ 
Sbjct  400  HAATHSNDPYIDDYYHQARVAKKAAGSRLKNAFCPSRLRELPSRSRSGSDQHSHSAPDSL  459

Query  31   GRVSFSSIRR  2
            G++  +SIRR
Sbjct  460  GKIPLASIRR  469



>ref|XP_004165263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228647, 
partial [Cucumis sativus]
Length=742

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 133/190 (70%), Gaps = 7/190 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrL----HLSVQPSLAHFSALRSQLYNSFPAPAHL  383
             N++L  Q  HQNGLLSPQL+S  QQ      H  VQPSLAHF+AL+SQLYN+    +H 
Sbjct  214  FNSILQQQLSHQNGLLSPQLLSAHQQLQQHRLHHPVQPSLAHFAALQSQLYNAHSPSSHR  273

Query  382  SKYGMPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            +  G+ D R+ + KS + K ++R SQQGS+  SQKS+S + QFRSK+MT +EIESILKMQ
Sbjct  274  AMLGLSDVREQKPKSQRGKHNMRSSQQGSETGSQKSDSGSIQFRSKHMTADEIESILKMQ  333

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H NDPY+DDYYHQA +AK+A  SR K+ FCP+  +E  SRSR+ ++     H    
Sbjct  334  HAATHSNDPYIDDYYHQARVAKKATGSRLKNAFCPSRLRELPSRSRSGSDQHXSFHTXFI  393

Query  31   GRVSFSSIRR  2
            G++  +SIRR
Sbjct  394  GKIPLASIRR  403



>ref|XP_010525174.1| PREDICTED: uncharacterized protein LOC104803017 [Tarenaya hassleriana]
Length=784

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 116/153 (76%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLYNS+P+P+H   +G  + R+ + + SH+S+  R  SQ  SD +SQKSE
Sbjct  308  SLAHLAALQSQLYNSYPSPSHKGLFGAGEVRERKHRPSHRSRKNRGISQTASDISSQKSE  367

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
                QFRSKYMT EEIESILKMQH++SH NDPYV+DYYHQA LAK++V SR+K +F P+ 
Sbjct  368  GGL-QFRSKYMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLAKKSVGSRAKPQFYPSH  426

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             KE  SRSRNSTE  P +H+DA G+++  S+R+
Sbjct  427  LKEHQSRSRNSTEQHPQVHIDALGKITLPSVRK  459



>gb|KFK23118.1| hypothetical protein AALP_AAs49591U000400 [Arabis alpina]
Length=788

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 116/153 (76%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKS-KSVRFSQQGSDAASQKSE  275
            SLAH +AL+SQLY+S+P+P+H   +G+ + R+ + KS H+S K+   SQQ SD ASQKSE
Sbjct  311  SLAHLAALQSQLYSSYPSPSHKVPFGVGEVREHKHKSSHRSRKNKGISQQTSDLASQKSE  370

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S   QFRSKYMT EEIESILKMQH++SH NDPYV+DYYHQA L K +  SR+K +FCP+ 
Sbjct  371  SGL-QFRSKYMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLVKNSTGSRAKLQFCPSH  429

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+Q SRSRNS++  P +HVDA G+++   I R
Sbjct  430  LKDQQSRSRNSSDQQPQVHVDALGKITLPFISR  462



>ref|XP_008775079.1| PREDICTED: protein PAT1 homolog 1-like [Phoenix dactylifera]
Length=808

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 126/190 (66%), Gaps = 9/190 (5%)
 Frame = -2

Query  544  NVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSK----  377
            N++  Q P  NGL+ PQL  PQ Q     +Q SL+H S ++SQL++  P P  +      
Sbjct  293  NLMQQQLPQSNGLMPPQLFPPQHQHRMPQIQSSLSHISQMQSQLFSPHPPPLQMMNNFEP  352

Query  376  -YGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
              GM + RD R K  +   + +RF+Q GSD +SQKS++  PQFRSKYMT EE+E+IL+MQ
Sbjct  353  MLGMAELRDQRLKPMQRGRQILRFAQHGSDTSSQKSDNGWPQFRSKYMTAEEVENILRMQ  412

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H +DPYVDDYYHQACLAK++  SR KH FCP   ++  SR+R   E   +L VDA 
Sbjct  413  HAATHGSDPYVDDYYHQACLAKKSAGSRLKHHFCPTSIRDLPSRARAKDEPHAYLQVDAL  472

Query  31   GRVSFSSIRR  2
            GR+ FSSIRR
Sbjct  473  GRLPFSSIRR  482



>ref|XP_006373646.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
 gb|ERP51443.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
Length=788

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 114/159 (72%), Gaps = 16/159 (10%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKSHKS--KSVRFSQQGSDA  293
            H SVQPSLAHF+A++SQL+N+ P+  H+           R + HKS  ++ RFSQ GSD 
Sbjct  306  HPSVQPSLAHFAAMQSQLFNAHPSSLHI-----------REQKHKSSQRNRRFSQ-GSDT  353

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+    QFRSK+MT +EIESILKMQHA++H NDPY+DDYYHQA LAKR+  SR+K+
Sbjct  354  SSQKSDGGWVQFRSKHMTADEIESILKMQHAATHSNDPYIDDYYHQASLAKRSTGSRTKN  413

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SRSRNS +   HLH DA G++   SIRR
Sbjct  414  NFCPSHLKELPSRSRNSADQHSHLHFDALGKMPLPSIRR  452



>ref|XP_010926895.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Elaeis guineensis]
Length=794

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 9/161 (6%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSK-----YGMPDARDSRAKSHKS--KSVRFSQQGS  299
            +Q SL+H S ++SQL+   P+P  +        GM + RD R KS +   + +RFSQ GS
Sbjct  295  IQSSLSHISQMQSQLFGPHPSPLQMMNNFEPMLGMAELRDQRVKSMQRGRQMLRFSQHGS  354

Query  298  DAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRS  119
            D +SQKS++  PQFRSKYM+ +EIE+IL+MQHA++H +DPYVDDYYHQACLAK++  SR 
Sbjct  355  DTSSQKSDNGWPQFRSKYMSADEIENILRMQHAATHGSDPYVDDYYHQACLAKKSAGSRL  414

Query  118  KHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            KH FCP   ++  SR+R   E   +L VDA GR+ FSSIRR
Sbjct  415  KHHFCPTSIRDLPSRARAKDEPHAYLQVDALGRLPFSSIRR  455



>ref|XP_011008549.1| PREDICTED: uncharacterized protein LOC105113895 [Populus euphratica]
Length=788

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 114/159 (72%), Gaps = 16/159 (10%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKSHKS--KSVRFSQQGSDA  293
            H SVQPSLAHF+A++SQL+N+ P+  H+           R + HKS  ++ RFSQ GSD 
Sbjct  306  HPSVQPSLAHFAAMQSQLFNAHPSSLHM-----------REQKHKSSQRNRRFSQ-GSDT  353

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQKS+S   QFRSK+MT +EIESILKMQHA++H NDPY+DDYYHQA LAKR+   R+K+
Sbjct  354  SSQKSDSGWVQFRSKHMTADEIESILKMQHAATHSNDPYIDDYYHQASLAKRSTGLRTKN  413

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP+  KE  SRSRNS +   HLH DA G++   SIRR
Sbjct  414  NFCPSHLKELPSRSRNSADQHSHLHFDALGKMPLPSIRR  452



>gb|KDP25122.1| hypothetical protein JCGZ_22657 [Jatropha curcas]
Length=805

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 131/196 (67%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLS---VQPSLAHFSALRSQLYNSFPA--PAH  386
            LNN+L  Q PHQNGL++PQLMS  Q + H     VQP L H S ++SQL+N  P+  P  
Sbjct  287  LNNML-QQLPHQNGLMAPQLMSQLQSQQHRMHHPVQPPLGHLSGMQSQLFNLHPSSSPHL  345

Query  385  LSKY----GMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            ++K+    GM D RD R K+ +   +++ +SQ G D+  QK ES  PQFRSKYMT +EIE
Sbjct  346  MNKFEAVLGMGDNRDQRPKTAQKGRQNLYYSQHGFDSNGQKIESFWPQFRSKYMTADEIE  405

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQ A++H NDPYVDDYYHQACL+K++  ++ KH FCP   ++   R+R + E    
Sbjct  406  SILRMQLAATHSNDPYVDDYYHQACLSKKSAGAKLKHHFCPTHLRDLPPRARANNEPHAF  465

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GR  FSSIRR
Sbjct  466  LQVDALGRAPFSSIRR  481



>ref|XP_011097653.1| PREDICTED: protein PAT1 homolog 1 [Sesamum indicum]
Length=817

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 12/194 (6%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlms---pqqqrLHLSVQPSLAHFSALRSQLYNSF--PAPAHL  383
            NN  P Q  HQNGLL  QLM     QQ R+    Q S +H S ++SQL+N    P+P  +
Sbjct  292  NNFSPQQLSHQNGLLPAQLMPPQHSQQTRMQNPYQSSFSHLSGVQSQLFNPHLPPSPPLM  351

Query  382  SKY---GMPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
            + +   G+PD RD RA S     + +R+  QGSD+ SQKS+S  P+F++KYMT +EIE+I
Sbjct  352  NNFDMLGLPDLRDQRAMSLLRSRQGMRYPHQGSDSGSQKSDSGWPRFKAKYMTEDEIENI  411

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLH  44
            L+MQ A++H NDPYV+DYYHQACLA+++  ++ +H FCP   ++ SS++R S E  P L 
Sbjct  412  LRMQLAATHSNDPYVEDYYHQACLARKSAGAKLRHHFCPTNLRDGSSKARASNEPHPFLQ  471

Query  43   VDAEGRVSFSSIRR  2
            VDA GRVSFSSIRR
Sbjct  472  VDALGRVSFSSIRR  485



>ref|XP_003545913.2| PREDICTED: uncharacterized protein LOC100787648 [Glycine max]
 gb|KHN27738.1| Protein PAT1 like 1 [Glycine soja]
Length=886

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 130/196 (66%), Gaps = 13/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQP---SLAHFSALRSQLYNSFPAPAH--  386
            LNN+L  Q    NG +SP LM+  QQ+ H    P   S  + S  +S L+N  P+     
Sbjct  354  LNNMLQQQLHLHNGSVSPHLMTQLQQQQHRLHHPGQRSAGYLSGFQSHLFNPHPSSGSSV  413

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D RD R+KS HK K S+RFS  GSDA SQKS+S + QFRSKYMT +EIE
Sbjct  414  ISKYEHMHGIADGRDHRSKSTHKGKHSLRFSLHGSDAGSQKSDSGSFQFRSKYMTSDEIE  473

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQHA +H NDPYVDDYYHQACLAK+   ++ KH FCP+  +E   RSR +TE    
Sbjct  474  SILRMQHAVTHSNDPYVDDYYHQACLAKKTSVAKLKHPFCPSQIREYPPRSRANTEPHSF  533

Query  49   LHVDAEGRVSFSSIRR  2
            + +DA GRVSFSSIRR
Sbjct  534  VQIDALGRVSFSSIRR  549



>ref|XP_010532520.1| PREDICTED: uncharacterized protein LOC104808528 [Tarenaya hassleriana]
Length=785

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 113/153 (74%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +A +SQLYNS+P+P+  + +G  + R+ + +S H+S+  R  SQQ SD +SQKSE
Sbjct  308  SLAHLAAFQSQLYNSYPSPSRKAPFGAGEGREHKHRSSHRSRKNRGISQQASDISSQKSE  367

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
                QF SKYMT EEIESILKMQH++SH NDPYV+DYYHQA LAK++V SR K  F P+ 
Sbjct  368  GGL-QFSSKYMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLAKKSVGSREKPHFYPSH  426

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             KE  SRSRNSTE  P +H+DA G+++  S+RR
Sbjct  427  LKEHQSRSRNSTEQHPQVHIDALGKITLPSVRR  459



>ref|XP_007022269.1| Topoisomerase II-associated protein PAT1, putative [Theobroma 
cacao]
 gb|EOY13794.1| Topoisomerase II-associated protein PAT1, putative [Theobroma 
cacao]
Length=841

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 125/196 (64%), Gaps = 13/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            LNN+L  Q  HQNGL+  QLM   Q         VQPS  H S ++SQL+N    P+P  
Sbjct  327  LNNMLQQQLSHQNGLIPSQLMPQLQSHQQRLQHPVQPSFGHLSGIQSQLFNPHLSPSPPL  386

Query  385  LSKY----GMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            ++K+    G+ D RD R KS +   ++ RFSQQG D +  KS+   PQFRSKYM+ +EIE
Sbjct  387  MNKFEAILGLGDLRDQRPKSAQRSRQNPRFSQQGFDNSGLKSDIGWPQFRSKYMSTDEIE  446

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
             IL+MQ A++H NDPYVDDYYHQACLA++   ++ +H FCP   ++   R+R +TE    
Sbjct  447  GILRMQLAATHSNDPYVDDYYHQACLARKYAGAKLRHHFCPTHLRDLPPRARANTEPHAF  506

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV FSSIRR
Sbjct  507  LQVDALGRVPFSSIRR  522



>ref|XP_010907163.1| PREDICTED: uncharacterized protein LOC105033889 [Elaeis guineensis]
Length=821

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 129/191 (68%), Gaps = 9/191 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKY-  374
            L N L    P  NG +  QL+  QQQ+    VQP L HFS L+S L +S P P  ++K  
Sbjct  293  LPNFLQQHLPQPNGSVPSQLLLQQQQQRVQQVQPCLPHFSRLQSPLVSSHP-PEIMNKLD  351

Query  373  ---GMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKM  209
               G+ D RD R+K S + K ++RF QQ SD +SQK ++  PQFRSKYM+ EEIESIL+M
Sbjct  352  AVLGISDLRDQRSKPSQRGKQNMRFPQQSSDTSSQKGDNGWPQFRSKYMSAEEIESILRM  411

Query  208  QHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDA  35
            Q+A++H NDPY+DDYYHQACLAK++  SR K+ FCP   ++  SR+R + E+   L VDA
Sbjct  412  QNAATHSNDPYIDDYYHQACLAKKSAGSRLKNHFCPTFIRDLPSRARANNETHAFLQVDA  471

Query  34   EGRVSFSSIRR  2
             GRV+FSSIRR
Sbjct  472  LGRVAFSSIRR  482



>ref|XP_007214538.1| hypothetical protein PRUPE_ppa002090mg [Prunus persica]
 gb|EMJ15737.1| hypothetical protein PRUPE_ppa002090mg [Prunus persica]
Length=718

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 110/165 (67%), Gaps = 10/165 (6%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSF--PAPAHLSKY----GMPDARDSRAKSHKSK--SVRFS  311
            H  VQPS    S ++SQL+N    P+P  +SK+    GM D RD R KS +    ++RFS
Sbjct  215  HHPVQPSFNQLSVMQSQLFNPHLSPSPPLMSKFEAMLGMGDPRDQRPKSAQKVRLNMRFS  274

Query  310  QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAV  131
            Q G D +S +S+   PQFRSKYMT +EIESIL+MQ A++H NDPYVDDYYHQ CLA+++ 
Sbjct  275  QYGFDTSSHRSDGGWPQFRSKYMTADEIESILRMQLAATHSNDPYVDDYYHQYCLARKSA  334

Query  130  ESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             S+ KH FCP   ++   R+R +TE    L VDA GRV FSSIRR
Sbjct  335  GSKLKHHFCPTNLRDLPPRARANTEPHAFLQVDALGRVPFSSIRR  379



>ref|XP_011004464.1| PREDICTED: uncharacterized protein LOC105110947 [Populus euphratica]
Length=789

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 126/189 (67%), Gaps = 15/189 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllsp----qlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            L ++L  Q  HQNGL+S          QQQRL  S+QPSL HF+A++SQ +NS P+  H+
Sbjct  274  LESILQQQLSHQNGLMSAHLMSPQQQLQQQRLQSSLQPSLPHFAAMQSQFFNSHPSSLHI  333

Query  382  SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
                    RD + KS   ++ RFSQ GSD +SQKS+S   QFRSK+MT +EIESILKMQH
Sbjct  334  --------RDQKHKSSSQRNRRFSQ-GSDTSSQKSDSGWVQFRSKHMTADEIESILKMQH  384

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEG  29
            A++H  DPY+DDYYHQA LAK++  SR KH FCP+  KE  SRSRNS +   HLH DA G
Sbjct  385  AATHSTDPYIDDYYHQASLAKKSTGSRIKHNFCPSHMKELPSRSRNSADQHSHLHFDALG  444

Query  28   RVSFSSIRR  2
            ++    IR+
Sbjct  445  KIPLPPIRK  453



>ref|XP_008344205.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103407022, 
partial [Malus domestica]
Length=650

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqr-----LHLSVQPSLAHFSALRSQLYNSF--PAP  392
            +NN+L  Q  HQNGL+ PQLM  QQ +     LH  VQPS A+ S ++SQL+N     +P
Sbjct  216  MNNLLQQQLAHQNGLVPPQLMHQQQSQPQDPRLHHPVQPSFANLSVMQSQLFNPHLSASP  275

Query  391  AHLSKY----GMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEE  230
              +SK+    GM D  D R KS +    ++RFSQ G D  S + E   PQFRSKYMT +E
Sbjct  276  PLVSKFEAMLGMGDLGDQRPKSAQKVRPNMRFSQYGFDTGSHRREGGWPQFRSKYMTADE  335

Query  229  IESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESL  56
            IE+IL+MQ A++H NDPYVDDYYHQ CL++++  ++ KH FCP   ++   R+R +TE  
Sbjct  336  IENILRMQLAATHSNDPYVDDYYHQFCLSRKSAGAKLKHHFCPTQLRDLPPRARANTEPH  395

Query  55   PHLHVDAEGRVSFSSIRR  2
              L VDA GRV FSSIRR
Sbjct  396  AFLQVDALGRVPFSSIRR  413



>ref|NP_567452.2| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AAK59544.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83534.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=787

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 117/154 (76%), Gaps = 6/154 (4%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR--FSQQGSDAASQKS  278
            SLAH +AL+SQLY+S+P+P+H + +G+ + R+ + KS H+S+  R   SQQ SD ASQKS
Sbjct  309  SLAHLAALQSQLYSSYPSPSHKALFGVGEVREHKHKSSHRSRKNRGGISQQTSDLASQKS  368

Query  277  ESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN  98
            ES   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA LAK++  SR+K +  P+
Sbjct  369  ESGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLAKKSSGSRTKPQLYPS  427

Query  97   --KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
              K+  SRSRNS++  P +HVDA G+++  SI R
Sbjct  428  HLKDHQSRSRNSSDQQPQVHVDALGKITLPSICR  461



>ref|XP_010109206.1| hypothetical protein L484_002129 [Morus notabilis]
 gb|EXC21328.1| hypothetical protein L484_002129 [Morus notabilis]
Length=816

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 127/193 (66%), Gaps = 11/193 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSF--PAPAHLSK  377
            LN+++  Q  HQNGL+ PQLM+ Q +  H +VQPS  H S ++SQL+N    P+P  +SK
Sbjct  286  LNSMMQPQLSHQNGLMPPQLMTQQHRI-HPTVQPSFNHLSGMQSQLFNPHLSPSPPLMSK  344

Query  376  Y----GMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESIL  215
            +    G+ D RD + KS +    ++R+SQ G D ++QK +   P FRSKYMT EEI+ IL
Sbjct  345  FDAMLGLGDLRDQKPKSFQKGRLNLRYSQLGFDTSNQKGDGGWPPFRSKYMTAEEIDGIL  404

Query  214  KMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHV  41
            +MQ A++H NDPYVDDYYHQA LAK +  ++ +H FCP   +E   R+R + E    L V
Sbjct  405  RMQLAATHSNDPYVDDYYHQASLAKNSAGAKLRHHFCPTHLRELPPRARANNEPHAFLQV  464

Query  40   DAEGRVSFSSIRR  2
            DA GR+ FSSIRR
Sbjct  465  DALGRIPFSSIRR  477



>ref|XP_002868239.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44498.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
Length=788

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLY+S+P+P+H   +G  + R+ + KS H+S+  R  SQQ SD ASQKSE
Sbjct  308  SLAHLAALQSQLYSSYPSPSHKVPFGAAEVREHKHKSSHRSRKNRGISQQTSDLASQKSE  367

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S   QFRSKYMT EEIESILKMQH+SSH +DPYV+DYYHQA LAK++  SR K +  P+ 
Sbjct  368  SGL-QFRSKYMTSEEIESILKMQHSSSHSSDPYVNDYYHQARLAKKSSGSRVKPQLYPSH  426

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+  SRSRNS++  P +HVDA G+++  SI R
Sbjct  427  LKDHQSRSRNSSDQQPQVHVDALGKITLPSICR  459



>ref|XP_004514400.1| PREDICTED: uncharacterized protein LOC101512706 [Cicer arietinum]
Length=880

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 127/194 (65%), Gaps = 12/194 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN------SFP  398
            LNN+L  Q  H  G +SP L++  QQ+ H     +Q S    S L+S L N      S P
Sbjct  349  LNNMLQQQLYHHGGSVSPHLLTQFQQQQHRLHHPLQQSAGFTSGLQSHLVNHHLSSGSSP  408

Query  397  APAHLSKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
               +  K G+ D R+ R KS + +S RFSQQGS+A+SQKS+  + QFRSKYMT +EIESI
Sbjct  409  GRKYEHKLGLGDVREHRQKSTRRQSHRFSQQGSNASSQKSDCGSLQFRSKYMTSDEIESI  468

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLH  44
            LKMQ A +HCNDPYVDDYYHQ+CLAK++  ++ KH FCP   KE SSR+R +TE    L 
Sbjct  469  LKMQLAVTHCNDPYVDDYYHQSCLAKKS-GAKLKHSFCPTKIKELSSRARANTEPHGFLQ  527

Query  43   VDAEGRVSFSSIRR  2
            VDA GRVS+  IR+
Sbjct  528  VDALGRVSYLPIRQ  541



>ref|XP_011036076.1| PREDICTED: protein PAT1 homolog 1-like [Populus euphratica]
Length=789

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 125/189 (66%), Gaps = 15/189 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllsp----qlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL  383
            L ++L  Q  HQNGL+S          QQQRL  S+QPSL HF+A++S  +NS P+  H+
Sbjct  274  LESILQQQLSHQNGLMSAHLMSPQQQLQQQRLQSSLQPSLPHFAAMQSHFFNSHPSSLHI  333

Query  382  SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
                    RD + KS   ++ RFSQ GSD +SQKS+S   QFRSK+MT +EIESILKMQH
Sbjct  334  --------RDQKHKSSSQRNRRFSQ-GSDTSSQKSDSGWVQFRSKHMTADEIESILKMQH  384

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEG  29
            A++H  DPY+DDYYHQA LAK++  SR KH FCP+  KE  SRSRNS +   HLH DA G
Sbjct  385  AATHSTDPYIDDYYHQASLAKKSTGSRIKHNFCPSHMKELPSRSRNSADQHSHLHFDALG  444

Query  28   RVSFSSIRR  2
            ++    IR+
Sbjct  445  KIPLPPIRK  453



>gb|KJB26984.1| hypothetical protein B456_004G270000 [Gossypium raimondii]
Length=764

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 124/194 (64%), Gaps = 13/194 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            L N+L  Q PHQNGL++ QL    Q         VQPS +H S ++SQL N    P+P  
Sbjct  253  LTNMLQQQLPHQNGLITSQLRPQLQAHQQRLQHPVQPSFSHLSGVQSQLVNPHRSPSPPL  312

Query  385  LSKY----GMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
            ++K+    G+ D RD R KS  ++  R+SQ G D++  KS+   P+FRSKYM+ +EIE I
Sbjct  313  MNKFEAILGIGDLRDQRPKS--AQKSRYSQLGFDSSGMKSDIGWPKFRSKYMSTDEIEGI  370

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLH  44
            L+MQ A++H NDPYVDDYYHQACLA+++  +  +H FCP   ++  SR+R + E    L 
Sbjct  371  LRMQLAATHSNDPYVDDYYHQACLARKSAGATLRHHFCPAHLRDLPSRARANAEPHAFLQ  430

Query  43   VDAEGRVSFSSIRR  2
            VDA GRV FSS+RR
Sbjct  431  VDALGRVPFSSVRR  444



>ref|XP_003532940.1| PREDICTED: uncharacterized protein LOC100812450 isoform X1 [Glycine 
max]
Length=886

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 129/195 (66%), Gaps = 13/195 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQP---SLAHFSALRSQLYNSFPAPAH--  386
            LNN+L  Q    NG ++P LM+  QQ+ H    P   S  + S  +S L+N  P+     
Sbjct  355  LNNMLQQQLHLHNGSVAPHLMTQLQQQQHRLHHPGQRSAGYLSGFQSHLFNPRPSSGSSV  414

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D RD + KS HK K S+RFS  GSDA+SQKS+S + QFRSKYMT +EIE
Sbjct  415  ISKYEHMHGITDGRDHKPKSTHKGKHSLRFSLHGSDASSQKSDSGSFQFRSKYMTSDEIE  474

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQHA +H NDPYVDDYYHQACLAK+   ++ KH FCP+  +E   RSR +TE    
Sbjct  475  SILRMQHAVTHSNDPYVDDYYHQACLAKKPNVAKLKHPFCPSQIREYPPRSRANTEPHSF  534

Query  49   LHVDAEGRVSFSSIR  5
            + +DA GRVSFSSIR
Sbjct  535  VQIDALGRVSFSSIR  549



>gb|KHN26819.1| Protein PAT1 like 1 [Glycine soja]
Length=981

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 129/195 (66%), Gaps = 13/195 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQP---SLAHFSALRSQLYNSFPAPAH--  386
            LNN+L  Q    NG ++P LM+  QQ+ H    P   S  + S  +S L+N  P+     
Sbjct  423  LNNMLQQQLHLHNGSVAPHLMTQLQQQQHRLHHPGQRSAGYLSGFQSHLFNPRPSSGSSV  482

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D RD + KS HK K S+RFS  GSDA+SQKS+S + QFRSKYMT +EIE
Sbjct  483  ISKYEHMHGITDGRDHKPKSTHKGKHSLRFSLHGSDASSQKSDSGSFQFRSKYMTSDEIE  542

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQHA +H NDPYVDDYYHQACLAK+   ++ KH FCP+  +E   RSR +TE    
Sbjct  543  SILRMQHAVTHSNDPYVDDYYHQACLAKKPNVAKLKHPFCPSQIREYPPRSRANTEPHSF  602

Query  49   LHVDAEGRVSFSSIR  5
            + +DA GRVSFSSIR
Sbjct  603  VQIDALGRVSFSSIR  617



>ref|XP_008383068.1| PREDICTED: uncharacterized protein LOC103445792 isoform X2 [Malus 
domestica]
Length=824

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 127/198 (64%), Gaps = 15/198 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqr-----LHLSVQPSLAHFSALRSQLYNSF--PAP  392
            +NN+L  Q  HQNGL+ PQLM  QQ +     LH  VQP   H  A++SQL+N     +P
Sbjct  289  MNNLLQQQLAHQNGLMPPQLMHQQQSQPQDPRLHHPVQPPFNHLPAMQSQLFNPHLSASP  348

Query  391  AHLSKY----GMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEE  230
              +SK+    GM D  D   K + K + ++RFSQ G D AS + E   PQFRSKYMT EE
Sbjct  349  PLMSKFEAMLGMGDLGDQGPKLAQKGRPNMRFSQHGFDTASHRREGGWPQFRSKYMTAEE  408

Query  229  IESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESL  56
            IE+IL+MQ A++H NDPYVDDYYHQ CLA+++  ++ KH FCP   ++   R+R +TE  
Sbjct  409  IENILRMQLAATHSNDPYVDDYYHQFCLARKSAGAKLKHHFCPTQLRDLPPRARANTEPH  468

Query  55   PHLHVDAEGRVSFSSIRR  2
              L VDA GRV FSSIRR
Sbjct  469  AFLQVDALGRVPFSSIRR  486



>ref|XP_006585424.1| PREDICTED: uncharacterized protein LOC100812450 isoform X2 [Glycine 
max]
Length=938

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 129/195 (66%), Gaps = 13/195 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQP---SLAHFSALRSQLYNSFPAPAH--  386
            LNN+L  Q    NG ++P LM+  QQ+ H    P   S  + S  +S L+N  P+     
Sbjct  407  LNNMLQQQLHLHNGSVAPHLMTQLQQQQHRLHHPGQRSAGYLSGFQSHLFNPRPSSGSSV  466

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D RD + KS HK K S+RFS  GSDA+SQKS+S + QFRSKYMT +EIE
Sbjct  467  ISKYEHMHGITDGRDHKPKSTHKGKHSLRFSLHGSDASSQKSDSGSFQFRSKYMTSDEIE  526

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SIL+MQHA +H NDPYVDDYYHQACLAK+   ++ KH FCP+  +E   RSR +TE    
Sbjct  527  SILRMQHAVTHSNDPYVDDYYHQACLAKKPNVAKLKHPFCPSQIREYPPRSRANTEPHSF  586

Query  49   LHVDAEGRVSFSSIR  5
            + +DA GRVSFSSIR
Sbjct  587  VQIDALGRVSFSSIR  601



>gb|KHG10037.1| Protein PAT1 [Gossypium arboreum]
Length=782

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 124/194 (64%), Gaps = 13/194 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            L N+L  Q PHQNGL++ QL    Q         VQPS +H S ++SQL N    P+P  
Sbjct  271  LTNMLQQQLPHQNGLITSQLRPQLQAHQQRLQHPVQPSFSHLSGVQSQLVNPHLSPSPPL  330

Query  385  LSKY----GMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
            ++K+    G+ D RD R KS  ++  R+SQ G D++  +S+   P+FRSKYM+ +EIE I
Sbjct  331  MNKFESILGIGDLRDQRPKS--AQKGRYSQPGFDSSGMRSDIGWPKFRSKYMSTDEIEGI  388

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLH  44
            L+MQ A++H NDPYVDDYYHQACLA+++  +  +H FCP   ++  SR+R + E    L 
Sbjct  389  LRMQLAATHSNDPYVDDYYHQACLARKSAGATLRHHFCPTHLRDLPSRARANAEPHAFLQ  448

Query  43   VDAEGRVSFSSIRR  2
            VDA GRV FSS+RR
Sbjct  449  VDALGRVPFSSVRR  462



>gb|KFK39518.1| hypothetical protein AALP_AA3G254500 [Arabis alpina]
Length=781

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 113/153 (74%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S+  R  SQQ SDAASQKSE
Sbjct  301  SYAQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNRGISQQVSDAASQKSE  360

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S   QFRS+YMT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  SR+   F P+ 
Sbjct  361  SGL-QFRSRYMTSEEIESILKMQHSNSHSNDPYVNDYYHQAQLAKKSAGSRTVTHFYPSQ  419

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+   RSRNS+E  P +HVDA G+++  SIRR
Sbjct  420  LKDHQPRSRNSSEQHPQVHVDALGKITLPSIRR  452



>ref|XP_009361780.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=821

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 127/198 (64%), Gaps = 15/198 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqr-----LHLSVQPSLAHFSALRSQLYNSF--PAP  392
            +NN+L  Q  HQNGL+ PQLM  QQ +     LH  VQPS  + S ++SQL+N     +P
Sbjct  286  MNNLLQQQLAHQNGLVPPQLMHQQQSQPQDPRLHHPVQPSFNNLSVMQSQLFNPHLSASP  345

Query  391  AHLSKY----GMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEE  230
              +SK+    GM D  D R KS +    ++RFSQ G D  S + E   PQFRSKYMT +E
Sbjct  346  PLVSKFEAMLGMGDLGDQRPKSAQKVRLNMRFSQHGFDTGSHRREGGWPQFRSKYMTADE  405

Query  229  IESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESL  56
            IE+IL+MQ A++H NDPYVDDYYHQ CL++++  ++ KH FCP   ++   R+R +TE  
Sbjct  406  IENILRMQLAATHSNDPYVDDYYHQFCLSRKSAGAKLKHHFCPTQLRDLPPRARANTEPH  465

Query  55   PHLHVDAEGRVSFSSIRR  2
              L VDA GRV FSSIRR
Sbjct  466  AFLQVDALGRVPFSSIRR  483



>ref|XP_009345081.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=734

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 117/192 (61%), Gaps = 16/192 (8%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSF--PAPAHLSKY  374
            N ++P Q  HQ          PQ  RLH  VQP   H  A++SQL+N     +P  +SK+
Sbjct  211  NGLMPPQLMHQQ------QSQPQDPRLHHPVQPPFNHLPAMQSQLFNPHLSASPPLMSKF  264

Query  373  ----GMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                GM D  D R KS +    ++RFSQ G D  S + E   PQFRSKYMT EEIE+IL+
Sbjct  265  EAMLGMGDLGDQRPKSAQKGRPNMRFSQHGFDTGSHRREGGWPQFRSKYMTAEEIENILR  324

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ A++H NDPYVDDYYHQ CLA+++  ++ KH FCP   ++   R+R +TE    L VD
Sbjct  325  MQLAATHSNDPYVDDYYHQFCLARKSAGAKLKHHFCPTQLRDLPPRARANTEPHAFLQVD  384

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  385  ALGRVPFSSIRR  396



>gb|EPS66560.1| hypothetical protein M569_08215, partial [Genlisea aurea]
Length=772

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 4/156 (3%)
 Frame = -2

Query  460  SVQPS-LAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQ  284
            S++PS L+ F   +S+LYN+FP+P+H SKYG  + + S++      S R   Q SD+ S 
Sbjct  287  SLEPSGLSQFPGFQSELYNTFPSPSHWSKYGKREQK-SKSGGKGKNSARIPYQLSDSLSD  345

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            KS+     F SKYMT +EI+SIL++QHAS+H NDPY DDYYHQA LAK+  E R K+RFC
Sbjct  346  KSDGALMGFSSKYMTADEIDSILRIQHASNHGNDPYKDDYYHQARLAKKYAEMRKKYRFC  405

Query  103  PN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            P+  KEQSSRSRN ++S P   VD+ GRV  SS RR
Sbjct  406  PSNQKEQSSRSRNGSDSQPRFQVDSFGRVCLSSSRR  441



>ref|XP_006406189.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
 gb|ESQ47642.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
Length=784

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            S A  +AL+SQ+Y+S+P+P+    +G+ + R+ + KS H+S+  R  SQQ SDAASQKSE
Sbjct  303  SYAQLAALQSQMYSSYPSPSRKVSFGVGEVREHKHKSSHRSRKNRGISQQASDAASQKSE  362

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S   QFRSKYMT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  S++  +F P+ 
Sbjct  363  SGL-QFRSKYMTSEEIESILKMQHSNSHSNDPYVNDYYHQAQLAKKSAGSKAVSQFYPSQ  421

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+   RSRNS+E  P +HVDA G+++  SIRR
Sbjct  422  LKDHQPRSRNSSEQHPLVHVDALGKITLPSIRR  454



>ref|XP_008226080.1| PREDICTED: protein PAT1 homolog 1 [Prunus mume]
Length=833

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 110/165 (67%), Gaps = 10/165 (6%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAH--LSKY----GMPDARDSRAKSHKSK--SVRFS  311
            H  VQPS    S ++SQL+N   +P+   +SK+    GM D+RD R KS +    ++RFS
Sbjct  330  HHPVQPSFNQLSVMQSQLFNPHLSPSLPVMSKFEAMLGMGDSRDQRPKSAQKVRLNMRFS  389

Query  310  QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAV  131
            Q G D +S +S+   PQFRSKYMT +EIE IL+MQ A++H NDPYVDDYYHQ CLA+++ 
Sbjct  390  QYGFDTSSHRSDGGWPQFRSKYMTADEIEGILRMQLAATHSNDPYVDDYYHQYCLARKSA  449

Query  130  ESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             ++ KH FCP   ++   R+R +TE    L VDA GRV FSSIRR
Sbjct  450  GAKLKHHFCPTNLRDLPPRARANTEPHAFLQVDALGRVPFSSIRR  494



>ref|XP_002317021.2| hypothetical protein POPTR_0011s14710g [Populus trichocarpa]
 gb|EEE97633.2| hypothetical protein POPTR_0011s14710g [Populus trichocarpa]
Length=736

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 127/195 (65%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            +NN+L     HQNGL+ PQLM   Q + H    S+QPSL H S ++SQ++N    P+P  
Sbjct  217  MNNMLQQPLSHQNGLMPPQLMPQLQSQQHRLHPSIQPSLGHLSGMQSQVFNPHISPSPPM  276

Query  385  LSKYGMPDA---RDSRAKS-HKSKSV-RFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
            ++ +    A   RD R K+  K +++ R+ QQG DA  QK +   PQFRSK+MT +EIE+
Sbjct  277  MNNFDTMLALADRDQRPKAAQKVRAIMRYPQQGFDANGQKIDIGWPQFRSKHMTTDEIET  336

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            IL+MQ A++H NDPYVDDYYHQACL+K+   ++ KH FCP   ++   R+R ++E    L
Sbjct  337  ILRMQLAATHSNDPYVDDYYHQACLSKKTAGAKLKHHFCPTHLRDLPPRARANSEPHAFL  396

Query  46   HVDAEGRVSFSSIRR  2
             VDA GR+ FSSIRR
Sbjct  397  QVDALGRIPFSSIRR  411



>ref|XP_009345080.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=823

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 117/192 (61%), Gaps = 16/192 (8%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSF--PAPAHLSKY  374
            N ++P Q  HQ          PQ  RLH  VQP   H  A++SQL+N     +P  +SK+
Sbjct  300  NGLMPPQLMHQQ------QSQPQDPRLHHPVQPPFNHLPAMQSQLFNPHLSASPPLMSKF  353

Query  373  ----GMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                GM D  D R KS +    ++RFSQ G D  S + E   PQFRSKYMT EEIE+IL+
Sbjct  354  EAMLGMGDLGDQRPKSAQKGRPNMRFSQHGFDTGSHRREGGWPQFRSKYMTAEEIENILR  413

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ A++H NDPYVDDYYHQ CLA+++  ++ KH FCP   ++   R+R +TE    L VD
Sbjct  414  MQLAATHSNDPYVDDYYHQFCLARKSAGAKLKHHFCPTQLRDLPPRARANTEPHAFLQVD  473

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  474  ALGRVPFSSIRR  485



>ref|XP_010062704.1| PREDICTED: protein PAT1 homolog 1 [Eucalyptus grandis]
 gb|KCW69830.1| hypothetical protein EUGRSUZ_F03181 [Eucalyptus grandis]
Length=841

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 125/200 (63%), Gaps = 17/200 (9%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqq-------rLHLSVQPSLAHFSALRSQLYNS--FP  398
            LN+ L  QFPHQNGL+  +L+   Q         LH  +QP   H S ++SQL+N     
Sbjct  301  LNSGLQQQFPHQNGLIPQKLLPQPQPQPQSQQHWLHRPMQPPFGHLSGMQSQLFNPHLGS  360

Query  397  APAHLSKYG----MPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTG  236
            +P  + K+     + D  + R K +HK +   RFSQ G D    KS S  P+FRSKYM+ 
Sbjct  361  SPPLMGKFDAMFDLADLSEQRLKLAHKGRQDPRFSQPGFDFNGPKSGSGWPRFRSKYMSA  420

Query  235  EEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTE  62
            +EIE+IL+MQ A++H NDPYVDDYYHQACLAK+++ ++ KH FCP   +E   R+R +TE
Sbjct  421  DEIENILRMQLAATHSNDPYVDDYYHQACLAKKSMGAKLKHHFCPTNLRELPPRARANTE  480

Query  61   SLPHLHVDAEGRVSFSSIRR  2
                L VDA GR+SFSSIRR
Sbjct  481  QHAFLQVDALGRISFSSIRR  500



>ref|XP_010923783.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923784.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923785.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
Length=814

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 128/191 (67%), Gaps = 8/191 (4%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKY-  374
            L N L    P  NGL+  QL+S QQQ+    VQPSL   S L+S L+NS P P   +K  
Sbjct  285  LPNFLQQHLPQPNGLMPSQLLSQQQQQRLQQVQPSLPQLSRLQSPLFNSHPPPQIRNKLD  344

Query  373  ---GMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKM  209
                M D RD RAK S + K ++RFSQQ SD +SQK ++  PQFRSKYM+ EEIESIL+M
Sbjct  345  AVLSMSDLRDQRAKPSQRGKQNMRFSQQSSDTSSQKGDNGWPQFRSKYMSAEEIESILRM  404

Query  208  QHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDA  35
            QHA++H NDPY+DDYYHQACLAK++  SR KH FCP   ++  SR+R + E    L VDA
Sbjct  405  QHAATHSNDPYIDDYYHQACLAKKSAGSRLKHHFCPTFVRDLPSRARANNEPHAFLQVDA  464

Query  34   EGRVSFSSIRR  2
             GRV FSSIRR
Sbjct  465  LGRVPFSSIRR  475



>ref|XP_011030730.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Populus euphratica]
Length=793

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 126/195 (65%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            +NN+L     HQNGL+ PQLM   Q + H    S+QPSL H S + SQ++N    P+P  
Sbjct  275  MNNMLQQPLSHQNGLMPPQLMPQLQSQQHRLHPSIQPSLGHLSGMHSQVFNPHISPSPPM  334

Query  385  LSKYGMPDA---RDSRAKS-HKSKSV-RFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
            ++ +    A   RD R K+  K +++ R+ QQG DA  QK +   PQFRSK+MT +EIE+
Sbjct  335  MNNFDTMLALADRDQRPKAAQKVRAIMRYPQQGFDANGQKIDIGWPQFRSKHMTTDEIET  394

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            IL+MQ A++H NDPYVDDYYHQACL+K+   ++ KH FCP   ++   R+R ++E    L
Sbjct  395  ILRMQLAATHSNDPYVDDYYHQACLSKKTAGAKLKHHFCPTHLRDLPPRARANSEPHAFL  454

Query  46   HVDAEGRVSFSSIRR  2
             VDA GRV FSSIRR
Sbjct  455  QVDALGRVPFSSIRR  469



>ref|XP_011030729.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Populus euphratica]
Length=794

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 126/195 (65%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            +NN+L     HQNGL+ PQLM   Q + H    S+QPSL H S + SQ++N    P+P  
Sbjct  276  MNNMLQQPLSHQNGLMPPQLMPQLQSQQHRLHPSIQPSLGHLSGMHSQVFNPHISPSPPM  335

Query  385  LSKYGMPDA---RDSRAKS-HKSKSV-RFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
            ++ +    A   RD R K+  K +++ R+ QQG DA  QK +   PQFRSK+MT +EIE+
Sbjct  336  MNNFDTMLALADRDQRPKAAQKVRAIMRYPQQGFDANGQKIDIGWPQFRSKHMTTDEIET  395

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            IL+MQ A++H NDPYVDDYYHQACL+K+   ++ KH FCP   ++   R+R ++E    L
Sbjct  396  ILRMQLAATHSNDPYVDDYYHQACLSKKTAGAKLKHHFCPTHLRDLPPRARANSEPHAFL  455

Query  46   HVDAEGRVSFSSIRR  2
             VDA GRV FSSIRR
Sbjct  456  QVDALGRVPFSSIRR  470



>ref|XP_011030731.1| PREDICTED: protein PAT1 homolog 1 isoform X3 [Populus euphratica]
Length=791

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 126/195 (65%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            +NN+L     HQNGL+ PQLM   Q + H    S+QPSL H S + SQ++N    P+P  
Sbjct  273  MNNMLQQPLSHQNGLMPPQLMPQLQSQQHRLHPSIQPSLGHLSGMHSQVFNPHISPSPPM  332

Query  385  LSKYGMPDA---RDSRAKS-HKSKSV-RFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
            ++ +    A   RD R K+  K +++ R+ QQG DA  QK +   PQFRSK+MT +EIE+
Sbjct  333  MNNFDTMLALADRDQRPKAAQKVRAIMRYPQQGFDANGQKIDIGWPQFRSKHMTTDEIET  392

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            IL+MQ A++H NDPYVDDYYHQACL+K+   ++ KH FCP   ++   R+R ++E    L
Sbjct  393  ILRMQLAATHSNDPYVDDYYHQACLSKKTAGAKLKHHFCPTHLRDLPPRARANSEPHAFL  452

Query  46   HVDAEGRVSFSSIRR  2
             VDA GRV FSSIRR
Sbjct  453  QVDALGRVPFSSIRR  467



>ref|XP_010692206.1| PREDICTED: protein PAT1 homolog 1 [Beta vulgaris subsp. vulgaris]
Length=784

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 125/199 (63%), Gaps = 16/199 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqr------LHLSVQPSLAHFSALRSQLYNSF--PA  395
            +NN+L H  PHQNGLL   +   QQQ+      LH  V P   + + + SQL      P+
Sbjct  261  MNNMLQHPLPHQNGLLPQMISQQQQQQQQQQHRLHHPVPPPYGNLTGVHSQLIGPHMSPS  320

Query  394  PAHLSKY----GMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
            P  L+K+    G+PD RD R KS +   +++R+SQQG D   Q+++   P +RS+YMT +
Sbjct  321  PPMLNKFDAMMGLPDFRDQRPKSSQRNRQNIRYSQQGFDTNGQRTDGGWPVYRSRYMTAD  380

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            E+E+IL+MQ A++H NDPYVDDYYHQACL K++  +R KH F P   ++   R+R + E 
Sbjct  381  ELENILRMQLAATHSNDPYVDDYYHQACLFKKSASARLKHHFFPTQLRDLPPRARPTDEP  440

Query  58   LPHLHVDAEGRVSFSSIRR  2
             P L V+A GR+ FSSIRR
Sbjct  441  HPFLQVEALGRIPFSSIRR  459



>ref|XP_009405382.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=756

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK--SHKSKSVRFSQQGSDAASQ  284
            + P ++HF  ++ Q ++   +P+ +      + RD R +  S   +S  FSQQ SD  SQ
Sbjct  270  LLPPISHFPHMQPQQFHPGHSPSQMMNRFEAEFRDPRLRPMSRGRQSFGFSQQSSDIGSQ  329

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            K ++  P+FRSKYMT EE+E+IL+MQHA++HCNDPY+DDYYHQACLAK++  S  KH FC
Sbjct  330  KLDNGWPKFRSKYMTTEELENILRMQHAATHCNDPYIDDYYHQACLAKKSAGSSMKHHFC  389

Query  103  PN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            PN  K+ S R+R+  E   +L VDA GR+SFSSIRR
Sbjct  390  PNVTKDLSFRARSKDEPHAYLRVDALGRLSFSSIRR  425



>gb|KHG11535.1| Protein PAT1 [Gossypium arboreum]
Length=579

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 123/194 (63%), Gaps = 13/194 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSF--PAPAH  386
            LNN+L  Q  HQNGL+  QLM   Q         VQPS +HFS ++SQ +N    P+P  
Sbjct  67   LNNMLQQQLTHQNGLIPSQLMPQLQSHQQRLQHPVQPSFSHFSGIQSQQFNPHLSPSPPV  126

Query  385  LSK----YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
            ++K     G+ D RD RAKS  ++  R S +G D+ + KS+   PQF SKYM+ +EIE I
Sbjct  127  MNKVEAILGIGDLRDQRAKS--AQKGRQSLRGFDSGALKSDFGWPQFTSKYMSTDEIEGI  184

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLH  44
            L+MQ  ++H NDPYVDDYYHQACLA+++  ++ +H FCP   ++   R+R +TE    L 
Sbjct  185  LRMQLVATHSNDPYVDDYYHQACLARKSAGAKLRHHFCPTHLRDLPPRARANTEPHAFLQ  244

Query  43   VDAEGRVSFSSIRR  2
            VDA GR+ FSSIRR
Sbjct  245  VDALGRLPFSSIRR  258



>ref|XP_009405381.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=801

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK--SHKSKSVRFSQQGSDAASQ  284
            + P ++HF  ++ Q ++   +P+ +      + RD R +  S   +S  FSQQ SD  SQ
Sbjct  315  LLPPISHFPHMQPQQFHPGHSPSQMMNRFEAEFRDPRLRPMSRGRQSFGFSQQSSDIGSQ  374

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            K ++  P+FRSKYMT EE+E+IL+MQHA++HCNDPY+DDYYHQACLAK++  S  KH FC
Sbjct  375  KLDNGWPKFRSKYMTTEELENILRMQHAATHCNDPYIDDYYHQACLAKKSAGSSMKHHFC  434

Query  103  PN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            PN  K+ S R+R+  E   +L VDA GR+SFSSIRR
Sbjct  435  PNVTKDLSFRARSKDEPHAYLRVDALGRLSFSSIRR  470



>dbj|BAB01945.1| unnamed protein product [Arabidopsis thaliana]
Length=703

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S+  R  SQQ SDAASQKSE
Sbjct  224  SYAQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNRGLSQQTSDAASQKSE  283

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            +   QFRSK+MT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  S++   F P  
Sbjct  284  TGL-QFRSKHMTSEEIESILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSKAISHFYPAQ  342

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+   RSRNS+E  P +HVDA G+++  S+RR
Sbjct  343  LKDHQPRSRNSSEQHPQVHVDALGKITLPSVRR  375



>ref|XP_007022271.1| Uncharacterized protein TCM_032442 [Theobroma cacao]
 gb|EOY13796.1| Uncharacterized protein TCM_032442 [Theobroma cacao]
Length=512

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 10/162 (6%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAH--LSKY----GMPDARDSRAKSHKS--KSVRFSQQG  302
            VQPS    S +RSQL+N   +P+   ++K+    G+ D RD R  S +   ++ RFSQQG
Sbjct  32   VQPSFGLLSGIRSQLFNPHLSPSSPLMNKFEAMLGLRDLRDQRPNSAQRSRQNPRFSQQG  91

Query  301  SDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESR  122
             D+   KS+   PQFRSKYM+ +EIE IL+MQ A++H NDPYVDDYYHQACLA+    ++
Sbjct  92   FDSGGLKSDIGWPQFRSKYMSTDEIEGILRMQLAATHSNDPYVDDYYHQACLARNYAGAK  151

Query  121  SKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             +H FCP   ++   R+R +TE    L VDA GRV FSSIRR
Sbjct  152  LRHHFCPTHLRDLPPRARANTEPHAFLQVDALGRVPFSSIRR  193



>ref|XP_007163851.1| hypothetical protein PHAVU_L011200g, partial [Phaseolus vulgaris]
 gb|ESW35845.1| hypothetical protein PHAVU_L011200g, partial [Phaseolus vulgaris]
Length=396

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 110/164 (67%), Gaps = 11/164 (7%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAH--LSKY----GMPDARDSRAKS-HKSK-SVRFS  311
            H  VQ S  + S  +S L+N   +     +SKY    G+ D RD R KS HK K S+R+S
Sbjct  4    HHPVQRSAGYLSGYQSHLFNPHLSSGSSVISKYEHVLGLADGRDHRPKSTHKGKHSLRYS  63

Query  310  QQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAV  131
            Q GSDA SQKS+S + QFRSKYMT +EIESIL+MQHA +H NDPYVDDYYHQACLAK+  
Sbjct  64   QHGSDA-SQKSDSASFQFRSKYMTSDEIESILRMQHAVTHSNDPYVDDYYHQACLAKKPS  122

Query  130  ESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIR  5
             ++ KH FCP   +E   R+R + E    + VDA GRVSFSSIR
Sbjct  123  VAKLKHPFCPTQIREIPPRTRANAEPHAFVQVDALGRVSFSSIR  166



>ref|XP_008793553.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Phoenix dactylifera]
Length=688

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 9/158 (6%)
 Frame = -2

Query  451  PSLAHFSALRSQLYNSFPAPAHLSKY----GMPDARDSRAKSHK--SKSVRFSQQGSDAA  290
            PSL  FS L+S L +S P P  ++K     G+   RD R+KS +   +++R+ QQ SD +
Sbjct  193  PSLPPFSRLQSPLLSSHP-PEIMNKLDAILGISGLRDQRSKSSQRGKQNMRYPQQSSDTS  251

Query  289  SQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHR  110
            SQK ++  PQFRSKYM+ EEIESIL+MQ+A++H NDPY+DDYYHQAC+AK++  SR KH 
Sbjct  252  SQKGDNGWPQFRSKYMSAEEIESILRMQNAATHSNDPYIDDYYHQACVAKKSAGSRLKHH  311

Query  109  FCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            F P   ++  SRSR + E    L VDA GRV+FSSIRR
Sbjct  312  FFPTFIRDLPSRSRGNNEPHAFLQVDALGRVAFSSIRR  349



>ref|XP_008383066.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Malus domestica]
Length=844

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 118/192 (61%), Gaps = 16/192 (8%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSF--PAPAHLSKY  374
            N ++P Q  HQ          PQ  RLH  VQP   H  A++SQL+N     +P  +SK+
Sbjct  321  NGLMPPQLMHQQ------QSQPQDPRLHHPVQPPFNHLPAMQSQLFNPHLSASPPLMSKF  374

Query  373  ----GMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                GM D  D   K + K + ++RFSQ G D AS + E   PQFRSKYMT EEIE+IL+
Sbjct  375  EAMLGMGDLGDQGPKLAQKGRPNMRFSQHGFDTASHRREGGWPQFRSKYMTAEEIENILR  434

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ A++H NDPYVDDYYHQ CLA+++  ++ KH FCP   ++   R+R +TE    L VD
Sbjct  435  MQLAATHSNDPYVDDYYHQFCLARKSAGAKLKHHFCPTQLRDLPPRARANTEPHAFLQVD  494

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  495  ALGRVPFSSIRR  506



>emb|CBI34052.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 112/173 (65%), Gaps = 25/173 (14%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGll---spqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLS  380
            LNN+L  Q PHQNG++          QQQRLH SVQPS+AHFSALRSQL    P     S
Sbjct  285  LNNILQQQLPHQNGIMPQQLMSQQQLQQQRLHHSVQPSMAHFSALRSQL----PKSTQRS  340

Query  379  KYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            K  M                RFS Q SD++SQKS++   QFRSKYMT +EIESIL+MQHA
Sbjct  341  KQNM----------------RFSHQASDSSSQKSDNGLVQFRSKYMTADEIESILRMQHA  384

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            ++H NDPY+DDYYHQA LAK++ ESR KH F P+  K+  +R RN+TE   HL
Sbjct  385  ATHSNDPYIDDYYHQARLAKKSAESRLKHHFYPSHLKDLPTRGRNNTEQHSHL  437



>ref|XP_002883351.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59610.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
Length=782

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S+  R  SQQ SDAASQKSE
Sbjct  303  SYAQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNRGLSQQASDAASQKSE  362

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S   QFRSK+MT EEIE ILKMQH++SH NDPYV+DYYHQA LAK++  S++   F P  
Sbjct  363  SGL-QFRSKHMTSEEIEGILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSKAISHFYPAQ  421

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+   RSRNS+E  P +HVDA G+++  S+RR
Sbjct  422  LKDHQPRSRNSSEQHPQVHVDALGKITLPSVRR  454



>dbj|BAF00849.1| hypothetical protein [Arabidopsis thaliana]
Length=782

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S+  R  SQQ SDAASQKSE
Sbjct  303  SYAQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNRGLSQQTSDAASQKSE  362

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            +   QFRSK+MT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  S++   F P  
Sbjct  363  TGL-QFRSKHMTSEEIESILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSKAISHFYPAQ  421

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+   RSRNS+E  P +HVDA G+++  S+RR
Sbjct  422  LKDHQPRSRNSSEQHPQVHVDALGKITLPSVRR  454



>ref|XP_006414611.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 ref|XP_006414612.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56064.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56065.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
Length=784

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 114/156 (73%), Gaps = 8/156 (5%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLY+S+P+P+H + +G  + R+ + KS H+S+  R  SQQ SD +SQKSE
Sbjct  310  SLAHLAALQSQLYSSYPSPSHKAPFGAGEVREHKHKSSHRSRKNRGISQQASDLSSQKSE  369

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCP--  101
            +   QFRSK MT EEIESILKMQH++SH NDPYV+DYYHQA LAK+   SR+K +F P  
Sbjct  370  TGL-QFRSKCMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLAKKLAGSRAKTQFYPSH  428

Query  100  --NKEQSSRSRN-STESLPHLHVDAEGRVSFSSIRR  2
              + + SSRSRN S +  P +HVDA G+++  SI R
Sbjct  429  LKDHQSSSRSRNGSDQQQPQVHVDALGKITLPSICR  464



>ref|NP_188866.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AEE76616.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=782

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S+  R  SQQ SDAASQKSE
Sbjct  303  SYAQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNRGLSQQTSDAASQKSE  362

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            +   QFRSK+MT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  S++   F P  
Sbjct  363  TGL-QFRSKHMTSEEIESILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSKAISHFYPAQ  421

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+   RSRNS+E  P +HVDA G+++  S+RR
Sbjct  422  LKDHQPRSRNSSEQHPQVHVDALGKITLPSVRR  454



>ref|XP_008793552.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Phoenix dactylifera]
Length=815

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 9/158 (6%)
 Frame = -2

Query  451  PSLAHFSALRSQLYNSFPAPAHLSKY----GMPDARDSRAKSHK--SKSVRFSQQGSDAA  290
            PSL  FS L+S L +S P P  ++K     G+   RD R+KS +   +++R+ QQ SD +
Sbjct  320  PSLPPFSRLQSPLLSSHP-PEIMNKLDAILGISGLRDQRSKSSQRGKQNMRYPQQSSDTS  378

Query  289  SQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHR  110
            SQK ++  PQFRSKYM+ EEIESIL+MQ+A++H NDPY+DDYYHQAC+AK++  SR KH 
Sbjct  379  SQKGDNGWPQFRSKYMSAEEIESILRMQNAATHSNDPYIDDYYHQACVAKKSAGSRLKHH  438

Query  109  FCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            F P   ++  SRSR + E    L VDA GRV+FSSIRR
Sbjct  439  FFPTFIRDLPSRSRGNNEPHAFLQVDALGRVAFSSIRR  476



>ref|XP_004294192.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=820

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 122/195 (63%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqq--rLHLSVQPSLAHFSALRSQLYNSF--PAPAHL  383
            LNN+L  Q  HQNGL    +  PQQ   R+H  VQ   +H SA++SQL+N    P+P  +
Sbjct  290  LNNLLQQQLSHQNGLPPQLMHQPQQPHPRMHHPVQQPFSHISAMQSQLFNPHLPPSPPLM  349

Query  382  SKY----GMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
            +K+    G+ D RD R++  +   +++RFSQ G D    +S      FRSKYMT +EIE 
Sbjct  350  NKFEAMFGLSDIRDERSRLAQKGRQNMRFSQHGFDTGGYRSGGGWAPFRSKYMTADEIEG  409

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            IL+MQ A++H NDPYVDDYYHQ CLA+++  ++  H FCP   ++   R+R +TE    L
Sbjct  410  ILRMQLAATHSNDPYVDDYYHQYCLARKSAGAKMTHHFCPTQLRDLPPRARANTEPHAFL  469

Query  46   HVDAEGRVSFSSIRR  2
             VDA GRV FSSIRR
Sbjct  470  QVDALGRVPFSSIRR  484



>ref|XP_010684289.1| PREDICTED: uncharacterized protein LOC104898860 [Beta vulgaris 
subsp. vulgaris]
Length=844

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 128/195 (66%), Gaps = 15/195 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQ---PSLAHFSALRSQLYNSFPA-PAHL  383
            LNNVL   F HQNGLL    +   +++L   ++   PSLAHFS L+SQL  S P+ P HL
Sbjct  319  LNNVLQQHFTHQNGLLHSSPLVSPRRQLQQGLRQSLPSLAHFSLLQSQLIGSHPSLPTHL  378

Query  382  SK-----YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
             K     Y + + RD R KS + K  R+SQQGS++ASQK++    QFRSKYMT EEI+SI
Sbjct  379  LKKYDTAYAIGETRDQRPKSMRGKHHRYSQQGSESASQKND--CIQFRSKYMTAEEIDSI  436

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCP--NKEQSSRSRNS-TESLPHL  47
            LKMQH +SH NDPY+DDYYHQA  AKR+  +R KH F P   ++  SR+RNS ++   H 
Sbjct  437  LKMQH-TSHSNDPYIDDYYHQASAAKRSSGTRLKHHFAPLHMRDLPSRARNSGSDQHGHQ  495

Query  46   HVDAEGRVSFSSIRR  2
              D+  R++ SSIRR
Sbjct  496  SFDSLRRLALSSIRR  510



>ref|XP_010497250.1| PREDICTED: protein PAT1 homolog 1-like, partial [Camelina sativa]
Length=331

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKS-KSVRFSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S K+   SQQ SDAASQKSE
Sbjct  51   SYAQLAALQSQLYSSYPSPSRKVPFGVSEVREHKHKSSHRSRKNKGLSQQASDAASQKSE  110

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVES-RSKHRFCPN  98
                QFRSK+MT EEIE+ILKMQH++SH NDPYV+DYYHQA LAK++  S ++   F P 
Sbjct  111  RGL-QFRSKHMTSEEIETILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSIKAVSHFYPA  169

Query  97   --KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
              K+   +SRNS+E  P +HVDA G+++  S+RR
Sbjct  170  QLKDHQPKSRNSSEQHPQVHVDALGKITLPSVRR  203



>ref|XP_010440363.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 115/155 (74%), Gaps = 7/155 (5%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLYNS+P+P+  + +G+ + R+ + KS H+S+  R  SQQ SD ASQKSE
Sbjct  309  SLAHLAALQSQLYNSYPSPSQKAPFGVGEVREHKHKSSHRSRKNRGISQQNSDLASQKSE  368

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSK-HRFCPN  98
            S   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA LAK++  SR+K  +  P+
Sbjct  369  SGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLAKKSAGSRTKPPQLYPS  427

Query  97   --KEQSSRSRN-STESLPHLHVDAEGRVSFSSIRR  2
              K+  SRSRN S++  P +HVDA G+++   I R
Sbjct  428  HLKDHQSRSRNSSSDQQPQVHVDALGKITLPFISR  462



>ref|XP_010429781.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=800

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 118/192 (61%), Gaps = 10/192 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H    + QL+NS  + +     +
Sbjct  288  MNNAMLQQPPHQNGLMPPQMQGSQNRLPH-PMQPPLGHMPGGQPQLFNSHLSRSSSSGNY  346

Query  385  LSKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G  D R++R  S     +++RF QQG D   Q+  S  P FRSKYM+ +EIE+IL+
Sbjct  347  DGALGFVDPREARPGSGHGNRQNMRFHQQGYDGGVQRRYSGWPPFRSKYMSADEIENILR  406

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ  ++H NDPYVDDYYHQACLAK+   ++ KH FCPN  ++   R+R++ E    L VD
Sbjct  407  MQLVATHSNDPYVDDYYHQACLAKKTAGAKLKHHFCPNHLRDLQQRARSNNEPHAFLQVD  466

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  467  ALGRVPFSSIRR  478



>ref|XP_004162291.1| PREDICTED: uncharacterized protein LOC101226533 [Cucumis sativus]
Length=808

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 119/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL-SVQPSLAH-FSALRSQLYNSFP--APAHL  383
            LNN+LP Q P+QNG        PQQ++     VQP         +S L+NS P   P HL
Sbjct  273  LNNLLPQQLPNQNGFPQLPPQQPQQRQKLQHPVQPPFGGSLPGFQSHLFNSHPSSGPPHL  332

Query  382  -----SKYGMPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
                 +  G+PD RD R +S K + + R   QG +  S ++E   P +RSKYMT +E+E+
Sbjct  333  MNKLEAMLGLPDMRDQRPRSQKGRQNTRLIHQGYETHSFRNEFGWPFYRSKYMTADELEN  392

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            I++MQ A++H NDPYVDDYYHQACL++++  ++ +H FCPN  ++   R+R + E    L
Sbjct  393  IVRMQLAATHSNDPYVDDYYHQACLSRKSAGAKLRHHFCPNQLRDLPPRARANNEPHAFL  452

Query  46   HVDAEGRVSFSSIRR  2
             V+A GRV FSSIRR
Sbjct  453  QVEALGRVPFSSIRR  467



>gb|KFK42288.1| hypothetical protein AALP_AA2G236100 [Arabis alpina]
Length=798

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 116/201 (58%), Gaps = 18/201 (9%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---------SVQPSLAHFSALRSQLYN---  407
            +NN +  Q PHQNGL  PQ+   Q +  H           +QP L H   ++ QL+    
Sbjct  282  MNNAMLQQLPHQNGLRPPQMQGSQNRLPHPMQPPLGPMPGMQPPLGHMPGMQPQLFTPNL  341

Query  406  --SFPAPAHLSKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMT  239
              S  +  +    G  D R+ R  S +   +++RF QQ  D   Q+  S  P FRSKYM+
Sbjct  342  SRSSSSGTYDGMLGFVDPREGRPGSAQGNRQNMRFHQQSFDGGVQRRHSGWPPFRSKYMS  401

Query  238  GEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTES  59
             +EIE+IL+MQ A++H NDPYVDD+YHQACLAK++  ++ KH FCPN  +   SR  T +
Sbjct  402  SDEIENILRMQLAATHSNDPYVDDFYHQACLAKKSAGAKLKHHFCPNHLRDIHSRARTNN  461

Query  58   LPH--LHVDAEGRVSFSSIRR  2
             PH  L VDA GRV FSSIRR
Sbjct  462  EPHAFLQVDALGRVPFSSIRR  482



>ref|XP_006300753.1| hypothetical protein CARUB_v10019819mg [Capsella rubella]
 gb|EOA33651.1| hypothetical protein CARUB_v10019819mg [Capsella rubella]
Length=799

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 117/192 (61%), Gaps = 10/192 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            +NN +  Q PH NGL+  Q+   Q +  H  +QP L H +  + QL NS  + +     +
Sbjct  288  MNNTMLQQPPHPNGLMPSQMQGSQNRLPH-PMQPPLGHMTGGQPQLINSHLSRSSSSGNY  346

Query  385  LSKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G+ D R++R  S     +++RF QQG D   Q+  S  P FRSKYM+ +EIE+IL+
Sbjct  347  DGMLGLGDPREARPGSGHGNRQNMRFHQQGFDGGVQRRYSGWPPFRSKYMSADEIENILR  406

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVD  38
            MQ  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  +  + R  T + PH  L VD
Sbjct  407  MQLVATHSNDPYVDDYYHQACLAKKSAGAQLKHHFCPNHLRDLQQRARTNNEPHAFLQVD  466

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  467  ALGRVPFSSIRR  478



>ref|XP_010435003.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 115/155 (74%), Gaps = 7/155 (5%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLY+S+P+P+  + +G+ + R+ + KS H+S+  R  SQQ SD ASQKSE
Sbjct  309  SLAHLAALQSQLYSSYPSPSQKAPFGVGEVREHKHKSSHRSRKNRGISQQNSDLASQKSE  368

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSK-HRFCPN  98
            S   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA LAK++  SR+K  +  P+
Sbjct  369  SGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLAKKSAGSRTKPPQLYPS  427

Query  97   --KEQSSRSRN-STESLPHLHVDAEGRVSFSSIRR  2
              K+  SRSRN S++  P +HVDA G+++   I R
Sbjct  428  HLKDHQSRSRNSSSDQQPQVHVDALGKITLPFISR  462



>ref|XP_010496132.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=796

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 115/155 (74%), Gaps = 7/155 (5%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLY+S+P+P+  + +G+ + R+ + KS H+S+  R  SQQ SD ASQKSE
Sbjct  310  SLAHLAALQSQLYSSYPSPSQKAPFGVGEVREHKHKSSHRSRKNRGISQQNSDLASQKSE  369

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSK-HRFCPN  98
            S   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA LAK++  SR+K  +  P+
Sbjct  370  SGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLAKKSAGSRTKPPQLYPS  428

Query  97   --KEQSSRSRN-STESLPHLHVDAEGRVSFSSIRR  2
              K+  SRSRN S++  P +HVDA G+++   I R
Sbjct  429  HLKDHQSRSRNSSSDQQPQVHVDALGKITLPFISR  463



>ref|XP_009406732.1| PREDICTED: uncharacterized protein LOC103989576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=811

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 109/159 (69%), Gaps = 10/159 (6%)
 Frame = -2

Query  451  PSLAHFSALRSQLYNSF-PAPAHLSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDA  293
            PSL HF  L+  +++   P P  + K+    GM ++RD R+KS H+ + ++  SQQ S+ 
Sbjct  318  PSLTHFLHLQPNIFSLHNPPPRKMKKFDAVIGMSNSRDHRSKSSHRGRQNIWLSQQSSET  377

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
             S K++S+  QFRSKYM+ EEI SIL+MQH+++H  DPYVDDYY+QACLAK++  SR KH
Sbjct  378  GSLKTDSSC-QFRSKYMSAEEIGSILRMQHSATHVTDPYVDDYYYQACLAKKSAGSRLKH  436

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP   K+  SRSR S ES  +  VDA GRV FSSIRR
Sbjct  437  NFCPTAIKDPPSRSRGSNESHAYFQVDALGRVQFSSIRR  475



>ref|XP_009406733.1| PREDICTED: uncharacterized protein LOC103989576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=793

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 109/159 (69%), Gaps = 10/159 (6%)
 Frame = -2

Query  451  PSLAHFSALRSQLYNSF-PAPAHLSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDA  293
            PSL HF  L+  +++   P P  + K+    GM ++RD R+KS H+ + ++  SQQ S+ 
Sbjct  318  PSLTHFLHLQPNIFSLHNPPPRKMKKFDAVIGMSNSRDHRSKSSHRGRQNIWLSQQSSET  377

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
             S K++S+  QFRSKYM+ EEI SIL+MQH+++H  DPYVDDYY+QACLAK++  SR KH
Sbjct  378  GSLKTDSSC-QFRSKYMSAEEIGSILRMQHSATHVTDPYVDDYYYQACLAKKSAGSRLKH  436

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP   K+  SRSR S ES  +  VDA GRV FSSIRR
Sbjct  437  NFCPTAIKDPPSRSRGSNESHAYFQVDALGRVQFSSIRR  475



>ref|XP_009604527.1| PREDICTED: uncharacterized protein LOC104099288 [Nicotiana tomentosiformis]
Length=800

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 9/156 (6%)
 Frame = -2

Query  442  AHFSALRSQLYNSFPAPA-----HLSKYGMPDARDSRAKS--HKSKSVRFSQQGSDAASQ  284
             H   L+SQL+N   +P      +    G+ D RD +AK      + + +SQQG D  SQ
Sbjct  317  GHMPGLQSQLFNHHMSPPSQVLNNFDMLGLADLRDQKAKLMLRGRQGLHYSQQGFDVGSQ  376

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            ++ S  P+F+SKYMT +E+E+IL+ Q A++H NDPYVDDYYHQACLAK++  ++ KH FC
Sbjct  377  RNNSAWPRFKSKYMTADELENILRTQLAATHSNDPYVDDYYHQACLAKKSAGAKLKHHFC  436

Query  103  PN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            PN  ++ S+R+  ++E  P L VDA GRV+FSSIRR
Sbjct  437  PNNLRDGSARTHANSEPHPFLQVDALGRVAFSSIRR  472



>emb|CDP13609.1| unnamed protein product [Coffea canephora]
Length=817

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 121/194 (62%), Gaps = 13/194 (7%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlmspqqqrLHLS---VQPSLAHFSALRSQLYN-----SFPAP  392
            N++L    PHQNGLL PQLMS QQ + H      QP+  H   L SQ+ N     S    
Sbjct  299  NSMLQQHLPHQNGLLPPQLMSQQQLQQHRLQNPFQPAFGHLPGLPSQVLNHHLSSSPQVT  358

Query  391  AHLSKYGMPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
             +    G+ D RD R KS     + +R+S  G D  SQKS++  P F+SKYMT +EIE+I
Sbjct  359  NNFDMLGLADLRDPRIKSMVRGRQGMRYSP-GFDINSQKSDNGWPVFKSKYMTADEIENI  417

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLH  44
            L+MQ A++H NDPYVDDYYHQACLAK+   ++ KH FCPN  ++  +R+R + E    L 
Sbjct  418  LRMQLAATHSNDPYVDDYYHQACLAKKTASAKLKHHFCPNNLRDGPARARANNEPHAFLQ  477

Query  43   VDAEGRVSFSSIRR  2
            VDA GRVSFSSIRR
Sbjct  478  VDALGRVSFSSIRR  491



>ref|XP_010419368.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=833

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 118/192 (61%), Gaps = 10/192 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            +NN +  Q PHQNGL+ PQ+   Q +  H  +Q  L H S  + QL+NS  + +     +
Sbjct  288  MNNAMLQQPPHQNGLMPPQMQGSQNRLPH-PMQHPLGHMSGGQPQLFNSHLSRSSSSGNY  346

Query  385  LSKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G  D R++R  S     +++RF QQG D   Q+  S  P FRSKYM+ +EIE+IL+
Sbjct  347  DGTLGFVDPREARPGSGHGNRQNMRFHQQGYDGGVQRRYSGWPPFRSKYMSADEIENILR  406

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVD  38
            MQ  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  +  + R  T + PH  L VD
Sbjct  407  MQLVATHSNDPYVDDYYHQACLAKKSAGAKLKHHFCPNHLRDLQQRARTNNEPHAFLQVD  466

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  467  ALGRVPFSSIRR  478



>ref|XP_007133386.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
 gb|ESW05380.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
Length=882

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 109/162 (67%), Gaps = 11/162 (7%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNS--FPAPAHLSKY----GMPDARDSRAKS-HKSK-SVRFSQQG  302
            +Q S  + S  +S L+N       + +SKY    G+ D R+ R KS +K K S RF QQG
Sbjct  384  IQKSGRYMSGFQSHLFNPQLCSGSSMVSKYDHMLGLADTREHRPKSTNKGKQSHRFLQQG  443

Query  301  SDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESR  122
            SDA+SQK+ES + QFRSKYMT +EIESIL+MQ A +HCNDPY+DDYYHQACLAK+A  ++
Sbjct  444  SDASSQKNESGSVQFRSKYMTSDEIESILRMQQAVTHCNDPYLDDYYHQACLAKKA-GAK  502

Query  121  SKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             KH F P   KE   R+R + +S   L VD  GRVSF SIRR
Sbjct  503  LKHSFSPTQIKELPPRARANLDSHGFLQVDTLGRVSFLSIRR  544



>ref|XP_010466506.1| PREDICTED: uncharacterized protein LOC104746679 [Camelina sativa]
Length=782

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 111/152 (73%), Gaps = 6/152 (4%)
 Frame = -2

Query  442  AHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKS-KSVRFSQQGSDAASQKSESN  269
            A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S K+   SQQ SDAASQKSES 
Sbjct  305  AQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNKGLSQQASDAASQKSESG  364

Query  268  APQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVES-RSKHRFCPN--  98
              QFRSK+MT EEIE+ILKMQH++SH NDPYV+DYYHQA LAK++  S ++   F P   
Sbjct  365  L-QFRSKHMTSEEIETILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSIKAASHFYPAQL  423

Query  97   KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            K+   +SRNS+E  P +HVDA G+++  S+RR
Sbjct  424  KDHQPKSRNSSEQQPQVHVDALGKITLPSVRR  455



>ref|XP_008444289.1| PREDICTED: protein PAT1 homolog 1 [Cucumis melo]
Length=808

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 116/194 (60%), Gaps = 13/194 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAH-FSALRSQLYNSFP--APAHL-  383
            LNN+LP Q  +QNG          + +    VQP         +S L+NS P   P HL 
Sbjct  276  LNNLLPQQLSNQNGFPQLPPQQRHKLQH--PVQPPFGGSLPGFQSHLFNSHPSSGPPHLM  333

Query  382  ----SKYGMPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESI  218
                +  G+PD RD R +S K + + RF  QG +  S ++E   P +RSKYMT +E+E+I
Sbjct  334  NKLEAMLGLPDMRDQRPRSQKGRQNTRFIHQGYETNSFRNEFGWPFYRSKYMTADELENI  393

Query  217  LKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLH  44
            ++MQ A++H NDPYVDDYYHQACL++++  ++ +H FCPN  ++   R+R + E    L 
Sbjct  394  VRMQLAATHSNDPYVDDYYHQACLSRKSAGAKLRHHFCPNQLRDLPPRARANNEPHAFLQ  453

Query  43   VDAEGRVSFSSIRR  2
            V+A GRV FSSIRR
Sbjct  454  VEALGRVPFSSIRR  467



>ref|XP_010539588.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Tarenaya hassleriana]
Length=822

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 102/166 (61%), Gaps = 19/166 (11%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSK----------YGMPDARDSRAKS--HKSKSVRF  314
            +QP L H   ++ QL+NS     HLS+           G+ D RD R  S     +++RF
Sbjct  333  MQPPLGHLQGMQPQLFNS-----HLSRSPSLGQYDTFLGIGDLRDGRTGSAHGNRQNIRF  387

Query  313  SQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRA  134
             QQG D   Q+ E   P FRSKYMT +EIE+IL+MQ A++H NDPYVDDYYHQA LAK++
Sbjct  388  HQQGFDNMVQRREFGWPHFRSKYMTSDEIENILRMQLAATHSNDPYVDDYYHQARLAKKS  447

Query  133  VESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
              ++ KH FCPN  ++   R+R + E    L VDA GRV FSSIRR
Sbjct  448  AGAKLKHHFCPNHLRDLPPRARANNEPHAFLQVDALGRVPFSSIRR  493



>ref|XP_010539589.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Tarenaya hassleriana]
Length=820

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 102/166 (61%), Gaps = 19/166 (11%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSK----------YGMPDARDSRAKS--HKSKSVRF  314
            +QP L H   ++ QL+NS     HLS+           G+ D RD R  S     +++RF
Sbjct  331  MQPPLGHLQGMQPQLFNS-----HLSRSPSLGQYDTFLGIGDLRDGRTGSAHGNRQNIRF  385

Query  313  SQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRA  134
             QQG D   Q+ E   P FRSKYMT +EIE+IL+MQ A++H NDPYVDDYYHQA LAK++
Sbjct  386  HQQGFDNMVQRREFGWPHFRSKYMTSDEIENILRMQLAATHSNDPYVDDYYHQARLAKKS  445

Query  133  VESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
              ++ KH FCPN  ++   R+R + E    L VDA GRV FSSIRR
Sbjct  446  AGAKLKHHFCPNHLRDLPPRARANNEPHAFLQVDALGRVPFSSIRR  491



>gb|KHN16432.1| hypothetical protein glysoja_046875 [Glycine soja]
Length=823

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 128/196 (65%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSL---AHFSALRSQLYNS--FPAPAH  386
            L+N+L  Q  H++G LSP L++  QQ+ H    P L   ++ S  +S L N       + 
Sbjct  294  LSNMLQQQLHHRSGSLSPHLLTQLQQQQHRLHHPILQSGSYMSGFQSHLINPQLSSGSSM  353

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D R+ R KS HK K S R  QQGSDA+SQK+ES +  FRSKYMT +EIE
Sbjct  354  VSKYEHMLGLADVREPRPKSTHKGKQSHRVFQQGSDASSQKNESGSLHFRSKYMTSDEIE  413

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SILKMQ A +HCNDPYVDDYYH ACL+K+   ++ K  FCP   KE  SR+R++T+S   
Sbjct  414  SILKMQLAVTHCNDPYVDDYYHLACLSKK-TGAKLKKSFCPTQIKELPSRARSNTDSHGF  472

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRVSF +IRR
Sbjct  473  LQVDALGRVSFLAIRR  488



>ref|XP_006597997.1| PREDICTED: uncharacterized protein LOC100779096 isoform X1 [Glycine 
max]
Length=881

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 128/196 (65%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSL---AHFSALRSQLYNS--FPAPAH  386
            L+N+L  Q  H++G LSP L++  QQ+ H    P L   ++ S  +S L N       + 
Sbjct  352  LSNMLQQQLHHRSGSLSPHLLTQLQQQQHRLHHPILQSGSYMSGFQSHLINPQLSSGSSM  411

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D R+ R KS HK K S R  QQGSDA+SQK+ES +  FRSKYMT +EIE
Sbjct  412  VSKYEHMLGLADVREPRPKSTHKGKQSHRVFQQGSDASSQKNESGSLHFRSKYMTSDEIE  471

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SILKMQ A +HCNDPYVDDYYH ACL+K+   ++ K  FCP   KE  SR+R++T+S   
Sbjct  472  SILKMQLAVTHCNDPYVDDYYHLACLSKK-TGAKLKKSFCPTQIKELPSRARSNTDSHGF  530

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRVSF +IRR
Sbjct  531  LQVDALGRVSFLAIRR  546



>ref|XP_006597998.1| PREDICTED: uncharacterized protein LOC100779096 isoform X2 [Glycine 
max]
Length=878

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 128/196 (65%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSL---AHFSALRSQLYNS--FPAPAH  386
            L+N+L  Q  H++G LSP L++  QQ+ H    P L   ++ S  +S L N       + 
Sbjct  349  LSNMLQQQLHHRSGSLSPHLLTQLQQQQHRLHHPILQSGSYMSGFQSHLINPQLSSGSSM  408

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D R+ R KS HK K S R  QQGSDA+SQK+ES +  FRSKYMT +EIE
Sbjct  409  VSKYEHMLGLADVREPRPKSTHKGKQSHRVFQQGSDASSQKNESGSLHFRSKYMTSDEIE  468

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SILKMQ A +HCNDPYVDDYYH ACL+K+   ++ K  FCP   KE  SR+R++T+S   
Sbjct  469  SILKMQLAVTHCNDPYVDDYYHLACLSKK-TGAKLKKSFCPTQIKELPSRARSNTDSHGF  527

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRVSF +IRR
Sbjct  528  LQVDALGRVSFLAIRR  543



>ref|XP_006597999.1| PREDICTED: uncharacterized protein LOC100779096 isoform X3 [Glycine 
max]
Length=826

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 128/196 (65%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSL---AHFSALRSQLYNS--FPAPAH  386
            L+N+L  Q  H++G LSP L++  QQ+ H    P L   ++ S  +S L N       + 
Sbjct  297  LSNMLQQQLHHRSGSLSPHLLTQLQQQQHRLHHPILQSGSYMSGFQSHLINPQLSSGSSM  356

Query  385  LSKY----GMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
            +SKY    G+ D R+ R KS HK K S R  QQGSDA+SQK+ES +  FRSKYMT +EIE
Sbjct  357  VSKYEHMLGLADVREPRPKSTHKGKQSHRVFQQGSDASSQKNESGSLHFRSKYMTSDEIE  416

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            SILKMQ A +HCNDPYVDDYYH ACL+K+   ++ K  FCP   KE  SR+R++T+S   
Sbjct  417  SILKMQLAVTHCNDPYVDDYYHLACLSKK-TGAKLKKSFCPTQIKELPSRARSNTDSHGF  475

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRVSF +IRR
Sbjct  476  LQVDALGRVSFLAIRR  491



>ref|XP_009397355.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=844

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 110/161 (68%), Gaps = 11/161 (7%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSK-----YGMPDARDSRAKSHK--SKSVRFSQQGS  299
            VQPSL HFS L+++ +N   +P  L       + M D RD R+K+ +   +++RFS+Q S
Sbjct  347  VQPSLPHFSHLQTK-FNPHGSPPQLRNKFDLAFPMSDMRDHRSKASQRGKQNMRFSRQSS  405

Query  298  DAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRS  119
            D  + ++++  PQ RS+YM+ EEIE+IL+MQ+ASSH +DPY+DDYYHQACLAK++  +R 
Sbjct  406  DTGNVRTDNKWPQIRSRYMSPEEIENILRMQNASSHTSDPYIDDYYHQACLAKKS-SARL  464

Query  118  KHRFCP--NKEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            KH FCP   K+  SRSR    S  H+ +DA GRV  SSIRR
Sbjct  465  KHNFCPTGTKDPPSRSRGGNISHTHVQIDALGRVILSSIRR  505



>ref|XP_006478033.1| PREDICTED: uncharacterized protein LOC102611484 isoform X1 [Citrus 
sinensis]
Length=792

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 115/199 (58%), Gaps = 37/199 (19%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSFPAPAHLS  380
            +NN+L  Q  HQNGL+ PQ+M   Q + H     VQPS  H   ++S+L+NS     HLS
Sbjct  299  VNNMLQQQLSHQNGLMPPQVMQQLQAQQHRLQHPVQPSFGHLPVMQSELFNS-----HLS  353

Query  379  K-----------YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
                        +G+ D+RD R KS                +Q+     PQFRSKYMT +
Sbjct  354  SSPSMMNNFEAVFGLVDSRDLRLKS----------------AQRRNGGWPQFRSKYMTVD  397

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            EIE IL+MQ A++H NDPY+DDYYHQACLAK+   ++ KH FCP   ++   R+R +TE 
Sbjct  398  EIEGILRMQLAATHSNDPYIDDYYHQACLAKKYAGAKLKHHFCPTHLRDLPPRARANTEP  457

Query  58   LPHLHVDAEGRVSFSSIRR  2
               L VDA GRV FSSIRR
Sbjct  458  HAFLQVDALGRVPFSSIRR  476



>ref|XP_006478034.1| PREDICTED: uncharacterized protein LOC102611484 isoform X2 [Citrus 
sinensis]
Length=791

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 115/199 (58%), Gaps = 37/199 (19%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSFPAPAHLS  380
            +NN+L  Q  HQNGL+ PQ+M   Q + H     VQPS  H   ++S+L+NS     HLS
Sbjct  298  VNNMLQQQLSHQNGLMPPQVMQQLQAQQHRLQHPVQPSFGHLPVMQSELFNS-----HLS  352

Query  379  K-----------YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
                        +G+ D+RD R KS                +Q+     PQFRSKYMT +
Sbjct  353  SSPSMMNNFEAVFGLVDSRDLRLKS----------------AQRRNGGWPQFRSKYMTVD  396

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            EIE IL+MQ A++H NDPY+DDYYHQACLAK+   ++ KH FCP   ++   R+R +TE 
Sbjct  397  EIEGILRMQLAATHSNDPYIDDYYHQACLAKKYAGAKLKHHFCPTHLRDLPPRARANTEP  456

Query  58   LPHLHVDAEGRVSFSSIRR  2
               L VDA GRV FSSIRR
Sbjct  457  HAFLQVDALGRVPFSSIRR  475



>ref|XP_006416798.1| hypothetical protein EUTSA_v10006845mg [Eutrema salsugineum]
 gb|ESQ35151.1| hypothetical protein EUTSA_v10006845mg [Eutrema salsugineum]
Length=788

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 123/197 (62%), Gaps = 15/197 (8%)
 Frame = -2

Query  550  LNNVLPHQ-FPHQNGllspqlmspqqqrLHLSV----QPSLAHFSALRSQLYNSFPAPA-  389
            +NN+LP Q  PHQNGL+  Q   PQ Q  H  +    QP   H   ++ QL+NS  + + 
Sbjct  272  MNNMLPQQQLPHQNGLMPQQQRMPQMQVPHNRLLHPMQPH-GHLPGMQPQLFNSLLSRSG  330

Query  388  ----HLSKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
                + +  G  D R++   S +   +++RF QQG D   Q+ ++  P FRSKYMTG+EI
Sbjct  331  SSGSYDAMLGFGDLREAIPGSGQGNRQNMRFHQQGFDGGFQRRDNAWPPFRSKYMTGDEI  390

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLP  53
            E+IL+MQ A++H NDPYVDDYYHQA LAK++  ++ KH FCPN  ++  SR+R + E   
Sbjct  391  ENILRMQLAATHSNDPYVDDYYHQARLAKKSAGAKLKHHFCPNHLRDLPSRARTNNEPHA  450

Query  52   HLHVDAEGRVSFSSIRR  2
             L VDA GRV FSSIRR
Sbjct  451  FLQVDALGRVPFSSIRR  467



>ref|XP_010511200.1| PREDICTED: uncharacterized protein LOC104787331 [Camelina sativa]
Length=782

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 112/154 (73%), Gaps = 6/154 (4%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKS-KSVRFSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S K+   SQQ SDAASQKSE
Sbjct  303  SYAQLAALQSQLYSSYPSPSRKVPFGVGEVREHKHKSSHRSRKNKGLSQQASDAASQKSE  362

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVES-RSKHRFCPN  98
            S   QFRSK+MT EEIE+ILKMQH++SH NDPYV+D+YHQA LAK++  S ++   F P 
Sbjct  363  SGL-QFRSKHMTSEEIETILKMQHSNSHSNDPYVNDFYHQAKLAKKSAGSIKAVSHFYPA  421

Query  97   --KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
              K+   +SRNS+E  P +HVDA G+++  S+RR
Sbjct  422  QLKDHQPKSRNSSEQHPQVHVDALGKITLPSVRR  455



>ref|XP_004144681.1| PREDICTED: uncharacterized protein LOC101207256 [Cucumis sativus]
 gb|KGN54923.1| hypothetical protein Csa_4G604530 [Cucumis sativus]
Length=808

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 118/195 (61%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL-SVQPSLAH-FSALRSQLYNSFP--APAHL  383
            LNN+LP Q  +QNG        PQQ++     VQP         +S L+NS P   P HL
Sbjct  273  LNNLLPQQLSNQNGFPQLPPQQPQQRQKLQHPVQPPFGGSLPGFQSHLFNSHPSSGPPHL  332

Query  382  -----SKYGMPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
                 +  G+PD RD R +S K + + R   QG +  S ++E   P +RSKYMT +E+E+
Sbjct  333  MNKLEAMLGLPDMRDQRPRSQKGRQNTRLIHQGYETHSFRNEFGWPFYRSKYMTADELEN  392

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            I++MQ A++H NDPYVDDYYHQACL++++  ++ +H FCPN  ++   R+R + E    L
Sbjct  393  IVRMQLAATHSNDPYVDDYYHQACLSRKSAGAKLRHHFCPNQLRDLPPRARANNEPHAFL  452

Query  46   HVDAEGRVSFSSIRR  2
             V+A GRV FSSIRR
Sbjct  453  QVEALGRVPFSSIRR  467



>ref|XP_006297023.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 ref|XP_006297024.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29921.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29922.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
Length=784

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 112/154 (73%), Gaps = 6/154 (4%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S+  R  SQQ SDAASQKSE
Sbjct  304  SYAQLAALQSQLYSSYPSPSRKVPFGVSEVREHKHKSSHRSRKNRGLSQQASDAASQKSE  363

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S   QFRSK+MT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  S++   F P+ 
Sbjct  364  SGL-QFRSKHMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLAKKSPGSKAVSHFYPSQ  422

Query  97   -KEQSSRSRN-STESLPHLHVDAEGRVSFSSIRR  2
             K+   +SRN S+E  P +HVDA G+++   +RR
Sbjct  423  LKDHQPKSRNSSSEQHPQVHVDALGKITLPFVRR  456



>gb|KDP25124.1| hypothetical protein JCGZ_22659 [Jatropha curcas]
Length=779

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 121/193 (63%), Gaps = 11/193 (6%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlmspqqqrLHLS--VQPSLAHFSALRSQLYNSFPAPAHL-SK  377
            NN+L  Q PHQ+GL+ P L+  +Q + H    VQPSLAH S ++SQL N  P+  H  SK
Sbjct  277  NNMLQQQLPHQHGLIPPHLIPQRQPQQHRLHHVQPSLAHLSGMQSQLINLHPSSPHWTSK  336

Query  376  Y----GMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESIL  215
            +    G  D RD R KS +   +++ +SQQG     +       QFRSKYMT +EIE+I+
Sbjct  337  FEAVLGPGDIRDQRPKSAQKDRQNLHYSQQGFVNYGRSINGVWSQFRSKYMTADEIENII  396

Query  214  KMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHV  41
            +M  A++H NDPYVDDYYHQA L+K+   ++ +H FCP   ++   R+R S+E    L V
Sbjct  397  RMHLAATHSNDPYVDDYYHQAFLSKKTAGAKLRHHFCPTHLRDLPPRARTSSEPHAFLQV  456

Query  40   DAEGRVSFSSIRR  2
            DA GRV FSSIRR
Sbjct  457  DALGRVPFSSIRR  469



>ref|XP_010488248.1| PREDICTED: uncharacterized protein LOC104766124 [Camelina sativa]
Length=784

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKS-KSVRFSQQGSDAASQKSE  275
            S A  +AL+SQLY+S+P+P+    +G+ + R+ + KS H+S K+   SQQ SDAASQKSE
Sbjct  303  SYAQLAALQSQLYSSYPSPSRKVPFGVSEVREHKHKSSHRSRKNKGLSQQASDAASQKSE  362

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVES-RSKHRFCPN  98
                QFRSK+MT EEIE+ILKMQH++SH NDPYV+DYYHQA LAK++  S ++   F P 
Sbjct  363  RGL-QFRSKHMTSEEIETILKMQHSNSHSNDPYVNDYYHQAKLAKKSAGSIKAVSHFYPA  421

Query  97   --KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
              K+   +SRNS+E  P +HVDA G+++  S+RR
Sbjct  422  QLKDHQPKSRNSSEQHPQVHVDALGKITLPSVRR  455



>gb|KJB82134.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=562

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 117/196 (60%), Gaps = 20/196 (10%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN------SFP  398
            LNN+L  Q  HQNGL+ PQLM   Q         VQPS+     ++SQL+N      S P
Sbjct  68   LNNMLQQQLSHQNGLIPPQLMPQLQVHQQRLQHPVQPSVNRLPGIQSQLFNPHLSLSSPP  127

Query  397  APAHLSKYGMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
                 +  G+ D RD R KS HK + + R SQQG D          PQFRSKYM+ +EIE
Sbjct  128  MNQFEAVLGIGDLRDHRPKSAHKGRQNPRLSQQGFDIG-------WPQFRSKYMSPDEIE  180

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
             IL+MQ A++H NDPYVDDYYHQACLA+++  ++ +H FCP   ++   R+R + E    
Sbjct  181  GILRMQLAATHSNDPYVDDYYHQACLARKSAGAKLRHHFCPTHLRDLPPRARANAEPHAF  240

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV FSSIRR
Sbjct  241  LQVDALGRVPFSSIRR  256



>ref|XP_009104546.1| PREDICTED: protein PAT1 homolog 1-like [Brassica rapa]
Length=781

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 114/200 (57%), Gaps = 23/200 (12%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL----  383
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H   ++ QL++      HL    
Sbjct  267  MNNAMLQQLPHQNGLMPPQMQGSQNRLQH-PMQPPLGHMPGMQPQLFS-----PHLSRSS  320

Query  382  ------SKYGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
                     G  D R+SR  S +    ++RF QQG D   Q+  S  P +RSKYMT  EI
Sbjct  321  SSASYDGMLGFVDPRESRPGSAQGNRPNMRFHQQGFDGGVQRKYSGLPPYRSKYMTAGEI  380

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQS---SRSRNSTESL  56
            E+IL+ Q  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  +     R+R + E  
Sbjct  381  ENILRTQLVATHSNDPYVDDYYHQACLAKKSAGAKLKHHFCPNHLRDLLHPRARTNNEPH  440

Query  55   PHLHVDAE--GRVSFSSIRR  2
              L VDA   GRV FSSIRR
Sbjct  441  AFLQVDAHSLGRVPFSSIRR  460



>ref|XP_002441360.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
 gb|EES19790.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
Length=802

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P  RD R++S + K ++RFSQQ SDA SQ SES+  +FRSKYM+ EEIESILKMQH+ +
Sbjct  342  VPSPRDKRSRSGRGKHNIRFSQQPSDAGSQNSESSGIKFRSKYMSSEEIESILKMQHSGN  401

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H NDPY+DDYYHQAC AKR+V S+ K  FCP   K+  S+SR+  +   +L VDA G VS
Sbjct  402  HSNDPYIDDYYHQACKAKRSVTSQ-KSNFCPMSIKDFPSKSRSGVDQHSYLQVDANGGVS  460

Query  19   FSSIRR  2
            FS+IRR
Sbjct  461  FSAIRR  466



>ref|XP_006283146.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16044.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=781

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 116/153 (76%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLY+S+P+P+H + + + + R+ + KS H+S+  R  SQQ SD ASQKSE
Sbjct  297  SLAHLAALQSQLYSSYPSPSHKAPFAVGEVREHKHKSSHRSRKNRGISQQNSDLASQKSE  356

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S A QFRSKYMT EEIE+ILKMQH++SH +DPYV+DYYHQA LAK++  SR+K +  P+ 
Sbjct  357  S-ALQFRSKYMTSEEIETILKMQHSNSHSSDPYVNDYYHQARLAKKSGGSRTKPQLYPSH  415

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+  SRSR+S++  P +HVDA G+++   I R
Sbjct  416  LKDHQSRSRSSSDQQPQVHVDALGKITLPYICR  448



>ref|XP_006344918.1| PREDICTED: uncharacterized protein LOC102604826 isoform X2 [Solanum 
tuberosum]
Length=815

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 104/159 (65%), Gaps = 9/159 (6%)
 Frame = -2

Query  451  PSLAHFSALRSQLYNSFPAPA-----HLSKYGMPDARDSRAKS--HKSKSVRFSQQGSDA  293
            P       L+SQL+N   +P      +    G+ D RD +AK      + + + Q G D 
Sbjct  326  PPYGRLPGLQSQLFNHHMSPPSQMMNNFDMLGLADLRDQKAKLMLRGRQGMHYPQLGFDV  385

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQ++ S  P+FRSKYM+ +E+E+IL+ Q A++H NDPYVDDYYHQACLAK++  ++ KH
Sbjct  386  SSQRNVSAWPRFRSKYMSTDELENILRAQLAATHSNDPYVDDYYHQACLAKKSAGAKLKH  445

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCPN  ++ S+R+R +T+  P L VDA GRV+FSSIRR
Sbjct  446  HFCPNNLRDGSARARANTDPHPFLQVDALGRVAFSSIRR  484



>ref|XP_006344917.1| PREDICTED: uncharacterized protein LOC102604826 isoform X1 [Solanum 
tuberosum]
Length=816

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 104/159 (65%), Gaps = 9/159 (6%)
 Frame = -2

Query  451  PSLAHFSALRSQLYNSFPAPA-----HLSKYGMPDARDSRAKS--HKSKSVRFSQQGSDA  293
            P       L+SQL+N   +P      +    G+ D RD +AK      + + + Q G D 
Sbjct  327  PPYGRLPGLQSQLFNHHMSPPSQMMNNFDMLGLADLRDQKAKLMLRGRQGMHYPQLGFDV  386

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQ++ S  P+FRSKYM+ +E+E+IL+ Q A++H NDPYVDDYYHQACLAK++  ++ KH
Sbjct  387  SSQRNVSAWPRFRSKYMSTDELENILRAQLAATHSNDPYVDDYYHQACLAKKSAGAKLKH  446

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCPN  ++ S+R+R +T+  P L VDA GRV+FSSIRR
Sbjct  447  HFCPNNLRDGSARARANTDPHPFLQVDALGRVAFSSIRR  485



>ref|XP_006283147.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16045.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=792

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 116/153 (76%), Gaps = 5/153 (3%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR-FSQQGSDAASQKSE  275
            SLAH +AL+SQLY+S+P+P+H + + + + R+ + KS H+S+  R  SQQ SD ASQKSE
Sbjct  308  SLAHLAALQSQLYSSYPSPSHKAPFAVGEVREHKHKSSHRSRKNRGISQQNSDLASQKSE  367

Query  274  SNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN-  98
            S A QFRSKYMT EEIE+ILKMQH++SH +DPYV+DYYHQA LAK++  SR+K +  P+ 
Sbjct  368  S-ALQFRSKYMTSEEIETILKMQHSNSHSSDPYVNDYYHQARLAKKSGGSRTKPQLYPSH  426

Query  97   -KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K+  SRSR+S++  P +HVDA G+++   I R
Sbjct  427  LKDHQSRSRSSSDQQPQVHVDALGKITLPYICR  459



>emb|CDX79293.1| BnaC06g20100D [Brassica napus]
Length=787

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 114/200 (57%), Gaps = 23/200 (12%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL----  383
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H   ++ QL++      HL    
Sbjct  273  MNNAMLQQLPHQNGLIPPQMQGSQNRLQH-PMQPPLGHMPGMQPQLFS-----PHLSRSS  326

Query  382  ------SKYGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
                     G  D R+SR  S +    ++RF QQG D   Q+  S  P +RSKYMT  EI
Sbjct  327  SSASYDGMLGFVDPRESRPGSAQGNRPNMRFHQQGFDGGVQRRYSGWPPYRSKYMTAGEI  386

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQS---SRSRNSTESL  56
            E+IL+ Q  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  +     R+R + E  
Sbjct  387  ENILRTQLVATHSNDPYVDDYYHQACLAKKSTGAKLKHHFCPNHLRDLLHPRARTNNEPH  446

Query  55   PHLHVDAE--GRVSFSSIRR  2
              L VDA   GRV FSSIRR
Sbjct  447  AFLQVDAHSLGRVPFSSIRR  466



>emb|CDX68009.1| BnaA07g20490D [Brassica napus]
Length=781

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 114/200 (57%), Gaps = 23/200 (12%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHL----  383
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H   ++ QL++      HL    
Sbjct  267  MNNAMLQQLPHQNGLMPPQMQGSQNRLQH-PMQPPLGHMPGMQPQLFS-----PHLSRSS  320

Query  382  ------SKYGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
                     G  D R+SR  S +    ++RF QQG D   Q+  S  P +RSKYMT  EI
Sbjct  321  SSASYDGMLGFVDPRESRPGSAQGNRPNMRFHQQGFDGGVQRRYSGWPPYRSKYMTAGEI  380

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQS---SRSRNSTESL  56
            E+IL+ Q  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  +     R+R + E  
Sbjct  381  ENILRTQLVATHSNDPYVDDYYHQACLAKKSAGAKLKHHFCPNHLRDLLHPRARTNNEPH  440

Query  55   PHLHVDAE--GRVSFSSIRR  2
              L VDA   GRV FSSIRR
Sbjct  441  AFLQVDAHSLGRVPFSSIRR  460



>gb|KDO40141.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=606

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 37/199 (19%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSFPAPAHLS  380
            +NN+L  Q  HQNGL+ PQ+M   Q + H     VQPS  H  A++S+++NS     HLS
Sbjct  169  VNNMLQQQLSHQNGLMPPQVMQQLQAQQHRLQHPVQPSFGHLPAMQSEVFNS-----HLS  223

Query  379  K-----------YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
                        +G+ D+RD R KS                +Q+     PQFRSKYM  +
Sbjct  224  SSPSMMNNFEAVFGLVDSRDLRPKS----------------AQRRNGGWPQFRSKYMMVD  267

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            EIE IL++Q A++H NDPY+DDYYHQACLAK+   ++ KH FCP   ++   R+R +TE 
Sbjct  268  EIEGILRIQLAATHSNDPYIDDYYHQACLAKKYASAKLKHHFCPTHLRDLPPRARANTEP  327

Query  58   LPHLHVDAEGRVSFSSIRR  2
               L VDA GRV FSSIRR
Sbjct  328  HAFLQVDALGRVPFSSIRR  346



>ref|XP_006388794.1| hypothetical protein POPTR_0098s00230g [Populus trichocarpa]
 gb|ERP47708.1| hypothetical protein POPTR_0098s00230g [Populus trichocarpa]
Length=655

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 24/156 (15%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKSHKSKSVRFSQQGSDAAS  287
            H SVQPSLAHF+A++SQL+N+ P+  H+        R+ + KS + ++ RFSQ GSD +S
Sbjct  185  HPSVQPSLAHFAAMQSQLFNAHPSSLHI--------REQKRKSSQ-RNRRFSQ-GSDTSS  234

Query  286  QKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRF  107
            QKS++            +EIESILKMQHA++H NDPY+DDYYHQA LAKR+  SR+K+ F
Sbjct  235  QKSDA------------DEIESILKMQHAATHSNDPYIDDYYHQASLAKRSTGSRNKNNF  282

Query  106  CPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIR  5
            CP+  KE  SRSRNS +   HLH DA G++   SIR
Sbjct  283  CPSHLKELPSRSRNSADQHSHLHFDALGKMPLLSIR  318



>gb|KDO40142.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
 gb|KDO40143.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=662

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 37/199 (19%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSFPAPAHLS  380
            +NN+L  Q  HQNGL+ PQ+M   Q + H     VQPS  H  A++S+++NS     HLS
Sbjct  169  VNNMLQQQLSHQNGLMPPQVMQQLQAQQHRLQHPVQPSFGHLPAMQSEVFNS-----HLS  223

Query  379  K-----------YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
                        +G+ D+RD R KS                +Q+     PQFRSKYM  +
Sbjct  224  SSPSMMNNFEAVFGLVDSRDLRPKS----------------AQRRNGGWPQFRSKYMMVD  267

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            EIE IL++Q A++H NDPY+DDYYHQACLAK+   ++ KH FCP   ++   R+R +TE 
Sbjct  268  EIEGILRIQLAATHSNDPYIDDYYHQACLAKKYASAKLKHHFCPTHLRDLPPRARANTEP  327

Query  58   LPHLHVDAEGRVSFSSIRR  2
               L VDA GRV FSSIRR
Sbjct  328  HAFLQVDALGRVPFSSIRR  346



>ref|NP_565199.1| uncharacterized protein  [Arabidopsis thaliana]
 ref|NP_849904.1| uncharacterized protein  [Arabidopsis thaliana]
 dbj|BAF00945.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH56808.1| AT1G79090 [Arabidopsis thaliana]
 gb|AEE36202.1| uncharacterized protein AT1G79090 [Arabidopsis thaliana]
 gb|AEE36203.1| uncharacterized protein AT1G79090 [Arabidopsis thaliana]
Length=793

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 117/192 (61%), Gaps = 14/192 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H   ++ QL+NS  + +     +
Sbjct  288  MNNAMLQQPPHQNGLMPPQMQGSQNRLPH-PMQPPLGHMPGMQPQLFNSHLSRSSSSGNY  346

Query  385  LSKYGMPDARDSRAKSH--KSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G  D R+ R  S     ++VRF QQG DA  Q+       FRSKYM+  EIE+IL+
Sbjct  347  DGMLGFGDLREVRPGSGHGNRQNVRFPQQGFDAGVQRRYP----FRSKYMSAGEIENILR  402

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  ++   R+R++ E    L V+
Sbjct  403  MQLVATHSNDPYVDDYYHQACLAKKSAGAKLKHHFCPNHLRDLQQRARSNNEPHAFLQVE  462

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  463  ALGRVPFSSIRR  474



>ref|XP_010497980.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=573

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 118/202 (58%), Gaps = 25/202 (12%)
 Frame = -2

Query  550  LNNVLP-HQFPHQNGllspqlmspqqqrLHLSV----QPSLAHFSALRSQLYNSFPAPAH  386
            +NN+LP HQ  HQNGL+  Q   P+ Q     +    QP   H   ++ Q +NS     H
Sbjct  58   MNNMLPQHQLSHQNGLMPQQQRIPKMQVPQSRLLHPMQPH-GHLPGMQPQTFNS-----H  111

Query  385  LSK----------YGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYM  242
            LS+           G  D R++R  S +    ++RF QQG D   Q+  +  P FRSKYM
Sbjct  112  LSRSASSGSYDAMLGFGDQREARPGSGQRNRHNMRFPQQGFDGGLQRRNNAWPPFRSKYM  171

Query  241  TGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNS  68
            T +EIE+IL+MQ  ++H NDPYVDDYYHQ  LAK++  ++ KH FCPN  ++  SR+R +
Sbjct  172  TADEIENILRMQLVATHSNDPYVDDYYHQGRLAKKSAGAKLKHHFCPNHLRDLPSRARTN  231

Query  67   TESLPHLHVDAEGRVSFSSIRR  2
             E   +L VDA GRV FSSIRR
Sbjct  232  NEPHAYLQVDALGRVPFSSIRR  253



>gb|AAC17049.1| Similar to hypothetical protein product gb|Z97337 from A. thaliana. 
EST gb|H76597 comes from this gene [Arabidopsis thaliana]
Length=841

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 117/192 (61%), Gaps = 14/192 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H   ++ QL+NS  + +     +
Sbjct  336  MNNAMLQQPPHQNGLMPPQMQGSQNRLPH-PMQPPLGHMPGMQPQLFNSHLSRSSSSGNY  394

Query  385  LSKYGMPDARDSRAKSH--KSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G  D R+ R  S     ++VRF QQG DA  Q+       FRSKYM+  EIE+IL+
Sbjct  395  DGMLGFGDLREVRPGSGHGNRQNVRFPQQGFDAGVQRRYP----FRSKYMSAGEIENILR  450

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  ++   R+R++ E    L V+
Sbjct  451  MQLVATHSNDPYVDDYYHQACLAKKSAGAKLKHHFCPNHLRDLQQRARSNNEPHAFLQVE  510

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  511  ALGRVPFSSIRR  522



>ref|XP_006441043.1| hypothetical protein CICLE_v10018922mg [Citrus clementina]
 gb|ESR54283.1| hypothetical protein CICLE_v10018922mg [Citrus clementina]
 gb|KDO40139.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=792

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 37/199 (19%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSFPAPAHLS  380
            +NN+L  Q  HQNGL+ PQ+M   Q + H     VQPS  H  A++S+++NS     HLS
Sbjct  299  VNNMLQQQLSHQNGLMPPQVMQQLQAQQHRLQHPVQPSFGHLPAMQSEVFNS-----HLS  353

Query  379  K-----------YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
                        +G+ D+RD R KS                +Q+     PQFRSKYM  +
Sbjct  354  SSPSMMNNFEAVFGLVDSRDLRPKS----------------AQRRNGGWPQFRSKYMMVD  397

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            EIE IL++Q A++H NDPY+DDYYHQACLAK+   ++ KH FCP   ++   R+R +TE 
Sbjct  398  EIEGILRIQLAATHSNDPYIDDYYHQACLAKKYASAKLKHHFCPTHLRDLPPRARANTEP  457

Query  58   LPHLHVDAEGRVSFSSIRR  2
               L VDA GRV FSSIRR
Sbjct  458  HAFLQVDALGRVPFSSIRR  476



>gb|KDO40140.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=791

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 37/199 (19%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYNSFPAPAHLS  380
            +NN+L  Q  HQNGL+ PQ+M   Q + H     VQPS  H  A++S+++NS     HLS
Sbjct  298  VNNMLQQQLSHQNGLMPPQVMQQLQAQQHRLQHPVQPSFGHLPAMQSEVFNS-----HLS  352

Query  379  K-----------YGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
                        +G+ D+RD R KS                +Q+     PQFRSKYM  +
Sbjct  353  SSPSMMNNFEAVFGLVDSRDLRPKS----------------AQRRNGGWPQFRSKYMMVD  396

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            EIE IL++Q A++H NDPY+DDYYHQACLAK+   ++ KH FCP   ++   R+R +TE 
Sbjct  397  EIEGILRIQLAATHSNDPYIDDYYHQACLAKKYASAKLKHHFCPTHLRDLPPRARANTEP  456

Query  58   LPHLHVDAEGRVSFSSIRR  2
               L VDA GRV FSSIRR
Sbjct  457  HAFLQVDALGRVPFSSIRR  475



>gb|KJB82133.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=785

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 117/196 (60%), Gaps = 20/196 (10%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN------SFP  398
            LNN+L  Q  HQNGL+ PQLM   Q         VQPS+     ++SQL+N      S P
Sbjct  276  LNNMLQQQLSHQNGLIPPQLMPQLQVHQQRLQHPVQPSVNRLPGIQSQLFNPHLSLSSPP  335

Query  397  APAHLSKYGMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
                 +  G+ D RD R KS HK + + R SQQG D          PQFRSKYM+ +EIE
Sbjct  336  MNQFEAVLGIGDLRDHRPKSAHKGRQNPRLSQQGFDIG-------WPQFRSKYMSPDEIE  388

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
             IL+MQ A++H NDPYVDDYYHQACLA+++  ++ +H FCP   ++   R+R + E    
Sbjct  389  GILRMQLAATHSNDPYVDDYYHQACLARKSAGAKLRHHFCPTHLRDLPPRARANAEPHAF  448

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV FSSIRR
Sbjct  449  LQVDALGRVPFSSIRR  464



>gb|KHG07822.1| Protein PAT1 [Gossypium arboreum]
Length=785

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 117/196 (60%), Gaps = 20/196 (10%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN------SFP  398
            LNN+L  Q  HQNGL+ PQLM   Q         VQPS      ++SQL+N      S P
Sbjct  276  LNNMLQQQLSHQNGLIPPQLMPQLQVHQQRLQHPVQPSFNRLPGIQSQLFNPHLSLSSPP  335

Query  397  APAHLSKYGMPDARDSRAKS-HKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
                 +  G+ D RD R KS HK + + R SQQG D          PQFRSKYM+ +EIE
Sbjct  336  MNQFEAVLGIGDLRDHRPKSAHKGRQNPRLSQQGFDIG-------WPQFRSKYMSPDEIE  388

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
             IL+MQ A++H NDPYVDDYYHQACLA+++  ++ +H FCP   ++   R+R ++E    
Sbjct  389  GILRMQLAATHSNDPYVDDYYHQACLARKSAGAKLRHHFCPTHLRDLPPRARANSEPHAF  448

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV FSSIRR
Sbjct  449  LQVDALGRVPFSSIRR  464



>ref|XP_002513421.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48824.1| conserved hypothetical protein [Ricinus communis]
Length=777

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 129/195 (66%), Gaps = 15/195 (8%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNS--FPAPAHLSK  377
            LN++L  Q PHQNGL+ P+LMS Q +R H+ VQPS ++ S+++SQL+N     +P  +SK
Sbjct  267  LNDMLQPQLPHQNGLVPPKLMSQQNRRQHM-VQPSSSNLSSMQSQLFNPQLSASPPVISK  325

Query  376  Y------GMPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
            Y      G+ D RD R K      +++ +SQQG D  + K +   P F+SKYMT +EIE 
Sbjct  326  YEYGPVLGLGDIRDQRTKPSPRVGQNLHYSQQGYD--TNKIDFVWPWFKSKYMTTDEIEG  383

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            I++MQ A++H +DPYVDDYY+Q CLAK++  ++ KH FCP   ++  SR+R + E    L
Sbjct  384  IIRMQLAATHSDDPYVDDYYNQGCLAKKSAGAKLKHHFCPTHLRDLPSRARANIEPHAFL  443

Query  46   HVDAEGRVSFSSIRR  2
             VDA GRV FSSIRR
Sbjct  444  QVDALGRVPFSSIRR  458



>ref|XP_003568135.1| PREDICTED: protein PAT1 homolog 1-like [Brachypodium distachyon]
Length=806

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 8/159 (5%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSKY----GMPDARDSRAKSHKSK-SVRFSQQGSDA  293
            V PS  ++  L+ Q Y+   +P  + K+     +P  RD R++S + K S+RFSQQ SD 
Sbjct  316  VPPSHHNYLNLQPQFYHHH-SPEMIGKFDHVPNLPSPRDKRSRSGRGKHSIRFSQQPSDT  374

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            A Q  ++   +FRSKYM+ EEIESIL+MQH++SH +DPY+DDYYHQAC+AKR+  S+ K 
Sbjct  375  AGQNVDNGGIKFRSKYMSSEEIESILRMQHSTSHSSDPYIDDYYHQACIAKRSASSQQKI  434

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             F P   K+  S+SR+  +   +L VDA GRVSFSSIRR
Sbjct  435  NFSPMSIKDFPSKSRSGGDQHSYLQVDAVGRVSFSSIRR  473



>emb|CDY23806.1| BnaA01g21570D [Brassica napus]
Length=1112

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 115/195 (59%), Gaps = 13/195 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H   ++ QL++   + +     +
Sbjct  267  MNNAMLQQLPHQNGLIPPQMQGSQNRLQH-PMQPPLGHMPGMQPQLFSPRLSRSSSSASY  325

Query  385  LSKYGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G  D R+SR  S +    ++RF QQG D   Q+  S  P +RSKYMT  EIE+IL+
Sbjct  326  DGMLGFVDPRESRPGSAQGNRPNMRFHQQGFDGGVQRRYSGWPPYRSKYMTAGEIENILR  385

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQS---SRSRNSTESLPHLHV  41
             Q  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  +     R+R + E    L V
Sbjct  386  TQLVATHSNDPYVDDYYHQACLAKKSAGAKLKHHFCPNHLRDLLHPRARTNNEPHAFLQV  445

Query  40   DAE--GRVSFSSIRR  2
            DA   GRV FSSIRR
Sbjct  446  DAHSLGRVPFSSIRR  460



>ref|XP_004961544.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Setaria italica]
Length=731

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 106/159 (67%), Gaps = 8/159 (5%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSKY----GMPDARDSRAKSHKSK-SVRFSQQGSDA  293
            VQPS  ++  L   L+    +P  +  +     +P  RD R++S + K S+R  QQ SDA
Sbjct  238  VQPSFQNYLNLHPHLFYHHQSPEIMGNFDHIPNVPSPRDKRSRSGRGKRSIRLPQQPSDA  297

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQ SES   +FRSKYM+ EEIE+ILKMQH++SH NDPY+DDYYHQAC AKR+V ++ K 
Sbjct  298  SSQHSESVGIKFRSKYMSSEEIENILKMQHSASHSNDPYIDDYYHQACKAKRSVNTQ-KS  356

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP   K+  S++R+  +   +L VDA G VSFS+IRR
Sbjct  357  NFCPMSIKDFPSKARSGGDQHSYLQVDANGGVSFSAIRR  395



>ref|XP_002889231.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65490.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=788

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 14/192 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            +NN +  Q PHQNGL+ PQ+   Q +  H  +QP L H   ++ QL+NS  + +     +
Sbjct  283  MNNAMLQQPPHQNGLMPPQMQGSQNRLPH-PMQPPLGHMPGMQPQLFNSHLSRSSSSGNY  341

Query  385  LSKYGMPDARDSRAKSH--KSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G  D R++R  S     +++RF QQG D   Q+       FRSKYM+  EIE+IL+
Sbjct  342  DGMLGFGDLREARPGSGHGNRQNMRFQQQGFDTGIQRRYP----FRSKYMSAGEIENILR  397

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVD  38
            MQ  ++H NDPYVDDYYHQACLAK++  ++ KH FCPN  +  + R  T + PH  L V+
Sbjct  398  MQLVATHSNDPYVDDYYHQACLAKKSAGAKLKHHFCPNHLRDLQQRARTNNEPHAFLQVE  457

Query  37   AEGRVSFSSIRR  2
            A GRV FSSIRR
Sbjct  458  ALGRVPFSSIRR  469



>ref|XP_004961543.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Setaria italica]
Length=813

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 106/159 (67%), Gaps = 8/159 (5%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSKY----GMPDARDSRAKSHKSK-SVRFSQQGSDA  293
            VQPS  ++  L   L+    +P  +  +     +P  RD R++S + K S+R  QQ SDA
Sbjct  320  VQPSFQNYLNLHPHLFYHHQSPEIMGNFDHIPNVPSPRDKRSRSGRGKRSIRLPQQPSDA  379

Query  292  ASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKH  113
            +SQ SES   +FRSKYM+ EEIE+ILKMQH++SH NDPY+DDYYHQAC AKR+V ++ K 
Sbjct  380  SSQHSESVGIKFRSKYMSSEEIENILKMQHSASHSNDPYIDDYYHQACKAKRSVNTQ-KS  438

Query  112  RFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP   K+  S++R+  +   +L VDA G VSFS+IRR
Sbjct  439  NFCPMSIKDFPSKARSGGDQHSYLQVDANGGVSFSAIRR  477



>ref|XP_006648671.1| PREDICTED: uncharacterized protein LOC102700029 [Oryza brachyantha]
Length=782

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P +RD R++S + K ++RFSQ  SD  SQ  +    +FRSKYM+ EEIESIL+MQH++S
Sbjct  320  VPSSRDKRSRSGRGKHNIRFSQPLSDTTSQNGDGGGLKFRSKYMSSEEIESILRMQHSAS  379

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AKR V SR K  F P   K+  S+SR+S +   +L VDA GRVS
Sbjct  380  HSSDPYVVDYYHQACIAKRGVNSRPKANFSPTSMKDLPSKSRSSGDHHAYLQVDALGRVS  439

Query  19   FSSIRR  2
            FSSIRR
Sbjct  440  FSSIRR  445



>ref|XP_009767161.1| PREDICTED: uncharacterized protein LOC104218381 [Nicotiana sylvestris]
Length=800

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 119/192 (62%), Gaps = 11/192 (6%)
 Frame = -2

Query  544  NVLPHQFPHQNGlls--pqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPA-----H  386
            N++P Q   QNG          PQ+   H  +  S  H   L+SQL+N   +P      +
Sbjct  281  NMIPQQLHRQNGFALPHGGSQQPQRPGQHHPLHSSYGHMPGLQSQLFNHHMSPPSQVLNN  340

Query  385  LSKYGMPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
                G+ D RD +AK      + +++SQQG D  SQ++ +  P+FRSKYMT +E+E+IL+
Sbjct  341  FDMLGLADLRDQKAKLMLRGRQGLQYSQQGFDVGSQRNNNAWPRFRSKYMTADELENILR  400

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
             Q A++H NDPYVDDYYHQACLAK+A  ++ KH FCPN  ++ S+R+  ++E  P L VD
Sbjct  401  AQLAATHSNDPYVDDYYHQACLAKKAAGAKLKHHFCPNNLRDGSARTHANSEPHPFLQVD  460

Query  37   AEGRVSFSSIRR  2
            A GRV+FSSIRR
Sbjct  461  ALGRVAFSSIRR  472



>ref|XP_010228365.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010228366.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
Length=860

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 93/132 (70%), Gaps = 5/132 (4%)
 Frame = -2

Query  382  SKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
            + +GMPD  D RA+S   H  ++ R+  QG +  + + ++  P+FRSKYM+ EEIE+I +
Sbjct  401  ANFGMPDLSDPRARSMLHHGWQAQRYPPQGFEPGNMRMDNGWPRFRSKYMSTEEIENIAR  460

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ A++H NDPY+DDYYHQACLA+++  +R KH FCP   ++ SSR+R+  E   +L VD
Sbjct  461  MQQAATHSNDPYIDDYYHQACLARKSAGARLKHHFCPTLIRDPSSRARSKDEPHAYLQVD  520

Query  37   AEGRVSFSSIRR  2
            A GR+ FSSIRR
Sbjct  521  ALGRLPFSSIRR  532



>ref|XP_010228364.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Brachypodium 
distachyon]
Length=919

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 93/132 (70%), Gaps = 5/132 (4%)
 Frame = -2

Query  382  SKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
            + +GMPD  D RA+S   H  ++ R+  QG +  + + ++  P+FRSKYM+ EEIE+I +
Sbjct  460  ANFGMPDLSDPRARSMLHHGWQAQRYPPQGFEPGNMRMDNGWPRFRSKYMSTEEIENIAR  519

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ A++H NDPY+DDYYHQACLA+++  +R KH FCP   ++ SSR+R+  E   +L VD
Sbjct  520  MQQAATHSNDPYIDDYYHQACLARKSAGARLKHHFCPTLIRDPSSRARSKDEPHAYLQVD  579

Query  37   AEGRVSFSSIRR  2
            A GR+ FSSIRR
Sbjct  580  ALGRLPFSSIRR  591



>gb|EMT17005.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=1181

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P  RD R++S + K S+RFSQQ SD ASQ  ++   +FRSKYM+ EEI++IL+MQH+ S
Sbjct  354  VPSPRDKRSRSGRGKHSIRFSQQQSDTASQNVDTGGTKFRSKYMSSEEIDTILRMQHSGS  413

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYVDDYYHQAC+AKR+V S+ K  F P   K+  S+SR+  +   +L VD+ GRVS
Sbjct  414  HSSDPYVDDYYHQACIAKRSVNSQKKVNFSPASIKDSHSKSRSGGDQHSYLKVDSLGRVS  473

Query  19   FSSIRR  2
            FSSIRR
Sbjct  474  FSSIRR  479



>ref|XP_006646364.1| PREDICTED: uncharacterized protein LOC102701783 [Oryza brachyantha]
Length=808

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 102/162 (63%), Gaps = 7/162 (4%)
 Frame = -2

Query  466  HLSVQPSLAHFSALRSQLYNSFPAPAHLSKY----GMPDARDSRAKSHKSK-SVRFSQQG  302
             L VQP   ++  L  QL+    +P    ++      P  RD R++S + K S RFSQ  
Sbjct  310  QLQVQPPHQNYLNLPPQLFYQHHSPELTGRFDSVSSAPSLRDKRSRSGRGKHSTRFSQPM  369

Query  301  SDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESR  122
            SD  SQ  +S   +FRSKYM+ EEIESIL+MQH++SH +DPY+ DYYHQAC+AKR   SR
Sbjct  370  SDTGSQNGDSGGLKFRSKYMSSEEIESILRMQHSASHSSDPYLVDYYHQACIAKRGANSR  429

Query  121  SKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             K  F P   K+  S+SR+S +   +L VDA GRVSFSSIRR
Sbjct  430  QKATFSPTSMKDLPSKSRSSGDHHAYLQVDALGRVSFSSIRR  471



>ref|XP_004251956.1| PREDICTED: protein PAT1 homolog 1 [Solanum lycopersicum]
Length=817

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 9/160 (6%)
 Frame = -2

Query  454  QPSLAHFSALRSQLYNSFPAPA-----HLSKYGMPDARDSRAKS--HKSKSVRFSQQGSD  296
            +P       L+SQL N   +P      +    G+ D RD +AK      + + + Q G D
Sbjct  327  RPPYGRLPGLQSQLINHHMSPPSQMMNNFDMLGLADLRDQKAKLMLRGRQGMHYPQLGFD  386

Query  295  AASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSK  116
             +SQ++ S   +FRSKYM+ +E+E+IL+ Q A++H NDPYVDDYYHQACLAK++  ++ K
Sbjct  387  ISSQRNVSAWTRFRSKYMSTDELENILRAQLAATHSNDPYVDDYYHQACLAKKSAGAKLK  446

Query  115  HRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            H FCPN  ++ S+RSR +T+  P L VDA GRV+FSSIRR
Sbjct  447  HHFCPNNLRDGSARSRANTDPHPFLQVDALGRVAFSSIRR  486



>ref|XP_003569904.1| PREDICTED: uncharacterized protein LOC100838182 [Brachypodium 
distachyon]
Length=805

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P +RD R++S + K S+RFSQ  SD  SQ  ++   +FRSKYM+ EEIESIL+MQH++S
Sbjct  343  LPSSRDKRSRSGRGKHSLRFSQPPSDIGSQNGDTGGLKFRSKYMSSEEIESILRMQHSAS  402

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AK+   SR K  F P   K+  S+SR+S++   +L VDA GRVS
Sbjct  403  HSSDPYVVDYYHQACMAKKGSNSRQKANFSPTSMKDLPSKSRSSSDQHAYLQVDALGRVS  462

Query  19   FSSIRR  2
            FSSIRR
Sbjct  463  FSSIRR  468



>ref|XP_002890176.1| hypothetical protein ARALYDRAFT_889054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66435.1| hypothetical protein ARALYDRAFT_889054 [Arabidopsis lyrata subsp. 
lyrata]
Length=770

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 118/197 (60%), Gaps = 15/197 (8%)
 Frame = -2

Query  550  LNNVLPHQ-FPHQNGllspqlmspqqqrLHLSV----QPSLAHFSALRSQLYNS-----F  401
            +NN+LP Q  PHQNGL+  Q   PQ Q     +    QP   H S ++ QL+NS      
Sbjct  255  MNNMLPQQQLPHQNGLMPQQQRMPQMQGPQNRLVHPMQPH-GHLSGMQPQLFNSNLSRSA  313

Query  400  PAPAHLSKYGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
             + ++ +  G  D R++R  S +    ++RF Q G D   Q+  +  P FRSKYMT  EI
Sbjct  314  SSGSYDAMLGFGDLREARPGSSQGNRLNMRFLQHGFDGGLQRRNNAWPPFRSKYMTAVEI  373

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLP  53
            E+IL+MQ  ++H NDPYVDDYYHQA LAK++  ++ KH FCPN  ++  SR+R + E   
Sbjct  374  ENILRMQLVATHSNDPYVDDYYHQARLAKKSAGAKLKHHFCPNHLRDLPSRARPNNEPHA  433

Query  52   HLHVDAEGRVSFSSIRR  2
             L VDA GRV FSSIRR
Sbjct  434  FLQVDALGRVPFSSIRR  450



>gb|EMS48493.1| hypothetical protein TRIUR3_07139 [Triticum urartu]
Length=813

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P  RD R++S + K S+RFSQQ SD A Q  ++   +FRSKYM+ EEI++IL+MQH+ S
Sbjct  353  VPSPRDKRSRSGRGKHSMRFSQQQSDTAGQNVDTGGTKFRSKYMSSEEIDTILRMQHSGS  412

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYVDDYYHQAC+AKR+V S+ K  F P   K+  S+SR+  +   +L VD+ GRVS
Sbjct  413  HSSDPYVDDYYHQACIAKRSVNSQQKVNFSPASIKDSHSKSRSGGDQHSYLKVDSLGRVS  472

Query  19   FSSIRR  2
            FSSIRR
Sbjct  473  FSSIRR  478



>ref|NP_001140581.1| uncharacterized protein LOC100272651 [Zea mays]
 gb|ACN25795.1| unknown [Zea mays]
 gb|ACN33341.1| unknown [Zea mays]
 tpg|DAA57454.1| TPA: hypothetical protein ZEAMMB73_966891 [Zea mays]
Length=807

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -2

Query  361  ARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCN  185
            +RD R++S K K ++RFSQ  SD  SQ  +S   +FRSKYM+ EEIESIL+MQH++SH +
Sbjct  348  SRDKRSRSGKGKHNIRFSQLPSDTGSQNGDSGGIKFRSKYMSSEEIESILRMQHSASHSS  407

Query  184  DPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSS  11
            DPY+ DYYHQAC+AKR   S+ K  F P   K+  S+SR+S++   +L VDA GRVSFSS
Sbjct  408  DPYIVDYYHQACMAKRGATSKQKTNFSPTSMKDVPSKSRSSSDQHTYLQVDALGRVSFSS  467

Query  10   IRR  2
            IRR
Sbjct  468  IRR  470



>ref|NP_001169926.1| uncharacterized protein LOC100383823 [Zea mays]
 gb|ACN35277.1| unknown [Zea mays]
Length=574

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 94/144 (65%), Gaps = 11/144 (8%)
 Frame = -2

Query  418  QLYNSFPAPAHLSKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRSK  248
            Q+ N F        +GMP+  D RA+S   H  +   F   GS+    K  +   +FRSK
Sbjct  125  QMMNRF------DNFGMPEFSDPRARSSMHHGRQGQHFPLHGSEFGIMKMGNGRSRFRSK  178

Query  247  YMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSR  74
            YM+ EE+E+IL++QHA++H NDPY+DDYYHQACLA R V++RSKHRFCP   ++ SS +R
Sbjct  179  YMSTEELENILRIQHAATHINDPYIDDYYHQACLASRYVDARSKHRFCPTLIRDPSSCTR  238

Query  73   NSTESLPHLHVDAEGRVSFSSIRR  2
            +  E   +L VDA GR+ FSS+RR
Sbjct  239  SKDEPHAYLKVDALGRLPFSSVRR  262



>ref|XP_002300546.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
 gb|EEE85351.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
Length=801

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN-----SFPA  395
            L N+L     HQNG++ PQL+   Q + H     VQ S  H   ++SQ++N     S P 
Sbjct  282  LTNMLQPPLSHQNGIMPPQLIPQLQSQQHRLHPPVQSSSGHLLGMQSQVFNPHLSLSPPM  341

Query  394  PAHL-SKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
              +  +  G+ D RD R KS +     VR+ QQG D   QK +   PQFRSK+MT +EIE
Sbjct  342  TNNFDTMLGLTD-RDQRPKSVQKVRPMVRYPQQGFDVNGQKFDIGWPQFRSKHMTTDEIE  400

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            +IL+MQ A++H NDPYVDDYYHQACL+K+   ++ +H FCP   ++   R+R + E    
Sbjct  401  TILRMQLAATHSNDPYVDDYYHQACLSKKTARAKLRHHFCPIHLRDLPPRARANAEPHAF  460

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GR+ FSSIRR
Sbjct  461  LQVDALGRIPFSSIRR  476



>ref|NP_001044369.2| Os01g0769000 [Oryza sativa Japonica Group]
 dbj|BAD52714.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD53338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94608.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06283.2| Os01g0769000 [Oryza sativa Japonica Group]
Length=809

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P  RD R++S + K S RFSQ  +D  SQ  +S   +FRSKYM+ EEIESIL+MQH++S
Sbjct  347  VPSLRDKRSRSGRGKHSTRFSQPLTDTGSQNGDSGGLKFRSKYMSSEEIESILRMQHSAS  406

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AK+   SR K  F P   K+  S+SR+S++   +L VDA GRVS
Sbjct  407  HSSDPYVVDYYHQACIAKKGASSRQKANFAPTSMKDLPSKSRSSSDHHAYLQVDALGRVS  466

Query  19   FSSIRR  2
            FSSIRR
Sbjct  467  FSSIRR  472



>gb|EAZ13676.1| hypothetical protein OsJ_03596 [Oryza sativa Japonica Group]
Length=827

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P  RD R++S + K S RFSQ  +D  SQ  +S   +FRSKYM+ EEIESIL+MQH++S
Sbjct  365  VPSLRDKRSRSGRGKHSTRFSQPLTDTGSQNGDSGGLKFRSKYMSSEEIESILRMQHSAS  424

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AK+   SR K  F P   K+  S+SR+S++   +L VDA GRVS
Sbjct  425  HSSDPYVVDYYHQACIAKKGASSRQKANFAPTSMKDLPSKSRSSSDHHAYLQVDALGRVS  484

Query  19   FSSIRR  2
            FSSIRR
Sbjct  485  FSSIRR  490



>ref|XP_002456407.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
 gb|EES01527.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
Length=810

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -2

Query  361  ARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCN  185
            +RD R++S + K S+RFSQ  SD  SQ  +S   +FRSKYM+ EEIESIL+MQH++SH +
Sbjct  351  SRDKRSRSGRGKHSLRFSQPPSDTGSQNGDSGGIKFRSKYMSSEEIESILRMQHSASHSS  410

Query  184  DPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSS  11
            DPYV DYYHQAC+AKR   S+ K  F P   K+  S+SR+S++   +L VDA GRVSFSS
Sbjct  411  DPYVVDYYHQACMAKRGATSKQKTNFSPTSMKDIPSKSRSSSDQHTYLQVDALGRVSFSS  470

Query  10   IRR  2
            IRR
Sbjct  471  IRR  473



>gb|EAY75968.1| hypothetical protein OsI_03887 [Oryza sativa Indica Group]
Length=827

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P  RD R++S + K S RFSQ  +D  SQ  +S   +FRSKYM+ EEIESIL+MQH++S
Sbjct  365  VPSLRDKRSRSGRGKHSTRFSQPLTDTGSQNGDSGGLKFRSKYMSSEEIESILRMQHSAS  424

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AK+   SR K  F P   K+  S+SR+S++   +L VDA GRVS
Sbjct  425  HSSDPYVVDYYHQACIAKKGASSRQKANFAPTSMKDLPSKSRSSSDHHAYLQVDALGRVS  484

Query  19   FSSIRR  2
            FSSIRR
Sbjct  485  FSSIRR  490



>emb|CDY10630.1| BnaA05g17320D [Brassica napus]
Length=765

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 14/160 (9%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARD-----SRAKSHKSKSVRFSQQGSDAASQ  284
            S A  +AL+SQLY S+P+P+    +G  + R+     S  +S K+K +  SQQ SDAASQ
Sbjct  304  SYAQLAALQSQLYRSYPSPSRKVSFGGGEVREQHKHKSSHRSRKNKGI--SQQASDAASQ  361

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            KSES   QFRSKYMT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  SR+   F 
Sbjct  362  KSESGL-QFRSKYMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLAKKSSGSRAITHFY  420

Query  103  PNK------EQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            P++      +  SR+ +S +    +HVDA G+++   IRR
Sbjct  421  PSQLKDHHHQPKSRNNSSEQHQQQVHVDALGKITLPYIRR  460



>ref|XP_010459204.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=768

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 117/202 (58%), Gaps = 25/202 (12%)
 Frame = -2

Query  550  LNNVLPHQ-FPHQNGllspqlmspqqqrLHLSV----QPSLAHFSALRSQLYNSFPAPAH  386
            +NN+LP Q   HQNGL+  Q   P+ Q     +    QP   H   ++ Q +NS     H
Sbjct  257  MNNMLPQQQLSHQNGLMPQQQRIPKMQVPQSRLLHPMQPH-GHLPGMQPQPFNS-----H  310

Query  385  LSK----------YGMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYM  242
            LS+           G  D R++R  S +    ++RF QQG D   Q+  +  P FRSKYM
Sbjct  311  LSRSASSGSYDAMLGFGDQREARPGSGQGNRHNMRFPQQGFDGGLQRRNNAWPPFRSKYM  370

Query  241  TGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNS  68
            T +EIE+IL+MQ  ++H NDPYVDDYYHQ  LAK++  ++ KH FCPN  ++  SR+R +
Sbjct  371  TADEIENILRMQLVATHSNDPYVDDYYHQGRLAKKSAGAKLKHHFCPNHLRDLPSRARTN  430

Query  67   TESLPHLHVDAEGRVSFSSIRR  2
             E   +L VDA GRV FSSIRR
Sbjct  431  NEPHAYLQVDALGRVPFSSIRR  452



>ref|XP_009145394.1| PREDICTED: uncharacterized protein LOC103869095 [Brassica rapa]
Length=791

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 107/160 (67%), Gaps = 14/160 (9%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARD-----SRAKSHKSKSVRFSQQGSDAASQ  284
            S A  +AL+SQLY S+P+P+    +G  + R+     S  +S K+K +  SQQ SDAASQ
Sbjct  304  SYAQLAALQSQLYRSYPSPSRKVSFGGGEVREQHKHKSSHRSRKNKGI--SQQASDAASQ  361

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            KSES   QFRSKYMT EEIESILKMQH++SH NDPYV+DYYHQA LAK++  SR+   F 
Sbjct  362  KSESGL-QFRSKYMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLAKKSSGSRAITHFY  420

Query  103  PNK------EQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            P++      +  SR+ +S +    +HVDA G+++   IRR
Sbjct  421  PSQLKDHHHQPKSRNNSSEQHQQQVHVDALGKITLPYIRR  460



>ref|XP_004952292.1| PREDICTED: uncharacterized protein LOC101759904 [Setaria italica]
Length=820

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 120/206 (58%), Gaps = 23/206 (11%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAH-LSKY  374
            +  ++ HQ    NGL+ PQ+  P+QQ   L +Q S  HFS L +Q+     +P   +  +
Sbjct  289  MPGLMQHQLQRPNGLMPPQMQPPRQQHGMLPIQQSPPHFSQLHAQMLGPHHSPPQSMQMF  348

Query  373  G-----------------MPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFR  254
            G                 MPD  D RA+S   H     R+  QG +  + + ++  P+FR
Sbjct  349  GPQHPPSQVMGRFDGNFTMPDLSDPRARSMLQHGRLGQRYPHQGYEVNNMRMDNGWPRFR  408

Query  253  SKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSR  80
            SKYM+ EEIE+I +MQ A++H NDPY+DDYYHQACLAK++  ++ KH FCP   ++ SSR
Sbjct  409  SKYMSTEEIENIARMQQAATHINDPYIDDYYHQACLAKKSAGAQLKHHFCPTLIRDPSSR  468

Query  79   SRNSTESLPHLHVDAEGRVSFSSIRR  2
            +R+  E   +L VDA GR+ FSSIRR
Sbjct  469  ARSKDEPHAYLQVDALGRLPFSSIRR  494



>ref|NP_001046960.1| Os02g0517300 [Oryza sativa Japonica Group]
 dbj|BAD46717.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46150.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08874.1| Os02g0517300 [Oryza sativa Japonica Group]
Length=815

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P +RD R++S + K ++RFSQ   D  +Q  +S   +FRSKYM+ EEIESIL+MQH++S
Sbjct  353  VPSSRDKRSRSGRGKHNIRFSQPLPDTGNQNGDSGGIKFRSKYMSSEEIESILRMQHSAS  412

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AKR   SR K  F P   K+  S+SR+S +   +L VDA GRVS
Sbjct  413  HSSDPYVVDYYHQACIAKRGANSRPKANFAPTSMKDLPSKSRSSGDHHAYLQVDAVGRVS  472

Query  19   FSSIRR  2
            FSSIRR
Sbjct  473  FSSIRR  478



>dbj|BAJ94686.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86063.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P  RD R++S + K S+RFSQQ SD+  Q  ++   +FRSKYM+ EEI +IL+MQH+ S
Sbjct  351  VPSPRDKRSRSGRGKHSLRFSQQQSDSVGQNVDTGGTKFRSKYMSSEEINTILRMQHSGS  410

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H NDPYVDDYYHQAC+AKR+  S+ K  F P   K+  S+SR+  +   +L VD+ GRVS
Sbjct  411  HSNDPYVDDYYHQACIAKRSANSQQKMNFSPASIKDSHSKSRSGGDQHSYLKVDSLGRVS  470

Query  19   FSSIRR  2
            FSSIRR
Sbjct  471  FSSIRR  476



>gb|EAY86044.1| hypothetical protein OsI_07409 [Oryza sativa Indica Group]
Length=825

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P +RD R++S + K ++RFSQ   D  +Q  +S   +FRSKYM+ EEIESIL+MQH++S
Sbjct  363  VPSSRDKRSRSGRGKHNIRFSQPLPDTGNQNGDSGGIKFRSKYMSSEEIESILRMQHSAS  422

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AKR   SR K  F P   K+  S+SR+S +   +L VDA GRVS
Sbjct  423  HSSDPYVVDYYHQACIAKRGANSRPKANFAPTSMKDLPSKSRSSGDHHAYLQVDAVGRVS  482

Query  19   FSSIRR  2
            FSSIRR
Sbjct  483  FSSIRR  488



>gb|EAZ23222.1| hypothetical protein OsJ_06910 [Oryza sativa Japonica Group]
Length=825

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASS  194
            +P +RD R++S + K ++RFSQ   D  +Q  +S   +FRSKYM+ EEIESIL+MQH++S
Sbjct  363  VPSSRDKRSRSGRGKHNIRFSQPLPDTGNQNGDSGGIKFRSKYMSSEEIESILRMQHSAS  422

Query  193  HCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVS  20
            H +DPYV DYYHQAC+AKR   SR K  F P   K+  S+SR+S +   +L VDA GRVS
Sbjct  423  HSSDPYVVDYYHQACIAKRGANSRPKANFAPTSMKDLPSKSRSSGDHHAYLQVDAVGRVS  482

Query  19   FSSIRR  2
            FSSIRR
Sbjct  483  FSSIRR  488



>ref|XP_004970101.1| PREDICTED: uncharacterized protein LOC101761506 [Setaria italica]
Length=810

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -2

Query  361  ARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCN  185
            +RD R++S + K ++RFSQ  SD   Q  +S   +FRSKYM+ EEIESIL+MQH++SH +
Sbjct  351  SRDKRSRSGRGKHNIRFSQPTSDTGGQNGDSGGIKFRSKYMSSEEIESILRMQHSASHSS  410

Query  184  DPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSS  11
            DPYV DYYHQAC+AKR   S+ K+ F P   K+  S+SR+S++   +L VDA GRVSFSS
Sbjct  411  DPYVVDYYHQACMAKRGATSKQKNNFSPASMKDLPSKSRSSSDQHTYLQVDALGRVSFSS  470

Query  10   IRR  2
            IRR
Sbjct  471  IRR  473



>ref|XP_004967457.1| PREDICTED: protein PAT1 homolog 1-like [Setaria italica]
Length=829

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 102/162 (63%), Gaps = 8/162 (5%)
 Frame = -2

Query  463  LSVQPSLAHFSALRSQLYNSFPAPAHLSKY---GMPDARDSRAKS---HKSKSVRFSQQG  302
            L +Q S  H S  ++ ++     P  ++++   GMP+  D RA S   H  +   F  QG
Sbjct  348  LPIQQSPQHLSRTQAHMFGPQHPPQLMNRFDNFGMPEFSDPRAISYMHHGRQGPHFPLQG  407

Query  301  SDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESR  122
             +    +  +  P+FRSKYM+ EE+E+I ++QHA++H NDPY+DDYYHQACLA+R+V++R
Sbjct  408  PEFGIMRMGNGRPRFRSKYMSTEELENISRIQHAATHINDPYIDDYYHQACLARRSVDAR  467

Query  121  SKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             KH FCP    + SSR+R   E   +L VDA GR+ FSSIRR
Sbjct  468  LKHHFCPTLILDPSSRARGKDEPHAYLKVDALGRLPFSSIRR  509



>gb|EYU33763.1| hypothetical protein MIMGU_mgv1a002553mg [Erythranthe guttata]
Length=660

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 123/196 (63%), Gaps = 19/196 (10%)
 Frame = -2

Query  547  NNVLPHQFPHQNGllspqlmspqqqrLHLSVQ---PSLAHFSALRSQLYNSFPAPAHLSK  377
            NN+ P Q  H NGL+ PQ+M PQQ R+    Q   P     + L+SQL+N      HLS+
Sbjct  148  NNLSPQQLSHLNGLVPPQMMPPQQTRMQHPFQGPPPPFNQLTGLQSQLFN-----PHLSQ  202

Query  376  ----YGMPDARDSRAKS----HKSKSVRFSQQ-GSDAASQKSESNAPQFRSKYMTGEEIE  224
                + + D RD RA S    ++   +R+    GSD+   +S +  P+F+SKYM+ +EIE
Sbjct  203  SPPNFDLQDLRDQRAMSMLRGNRQGIMRYPPNFGSDSGGHRSHNGWPRFKSKYMSADEIE  262

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            +IL+MQ  ++H NDPYV+DYYHQACLA+++  S+ +H FCP   K+ SSR+R + E    
Sbjct  263  NILRMQLQATHSNDPYVEDYYHQACLARKSNGSKMRHHFCPTNIKDGSSRARANNEPHAF  322

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GRV+FSSIRR
Sbjct  323  LQVDALGRVNFSSIRR  338



>ref|XP_008649853.1| PREDICTED: uncharacterized protein LOC103630586 [Zea mays]
 gb|AFW78649.1| hypothetical protein ZEAMMB73_732523 [Zea mays]
Length=797

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 5/127 (4%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            +P  RD R++S +    ++RFSQQ SDA SQ SES+  +FRSKYM+ EEIESILKMQH++
Sbjct  336  VPSPRDKRSRSGRGGKHNIRFSQQPSDAGSQHSESSGIKFRSKYMSSEEIESILKMQHSA  395

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            +H NDPY DDYYHQAC AKR+V +  K  FCP   K+  S+SR+  +   +L VDA G V
Sbjct  396  NHSNDPYFDDYYHQACKAKRSV-TFQKSNFCPMSIKDFPSKSRSGVDQHSYLQVDANGGV  454

Query  22   SFSSIRR  2
            SFS+IRR
Sbjct  455  SFSAIRR  461



>ref|XP_008655297.1| PREDICTED: uncharacterized protein LOC100383823 isoform X1 [Zea 
mays]
 gb|AFW80455.1| hypothetical protein ZEAMMB73_854795 [Zea mays]
Length=812

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 94/144 (65%), Gaps = 11/144 (8%)
 Frame = -2

Query  418  QLYNSFPAPAHLSKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRSK  248
            Q+ N F        +GMP+  D RA+S   H  +   F   GS+    K  +   +FRSK
Sbjct  363  QMMNRF------DNFGMPEFSDPRARSSMHHGRQGQHFPLHGSEFGIMKMGNGRSRFRSK  416

Query  247  YMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSR  74
            YM+ EE+E+IL++QHA++H NDPY+DDYYHQACLA R V++RSKHRFCP   ++ SS +R
Sbjct  417  YMSTEELENILRIQHAATHINDPYIDDYYHQACLASRYVDARSKHRFCPTLIRDPSSCTR  476

Query  73   NSTESLPHLHVDAEGRVSFSSIRR  2
            +  E   +L VDA GR+ FSS+RR
Sbjct  477  SKDEPHAYLKVDALGRLPFSSVRR  500



>ref|XP_006389922.1| hypothetical protein EUTSA_v10018148mg [Eutrema salsugineum]
 gb|ESQ27208.1| hypothetical protein EUTSA_v10018148mg [Eutrema salsugineum]
Length=782

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 110/187 (59%), Gaps = 9/187 (5%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            +NN +  Q PHQNGL+ PQ+   Q +     +QP L      RS    ++         G
Sbjct  282  MNNAMLQQPPHQNGLMPPQMQGSQNRLQQHPMQPQLFSPHLSRSSSTGNYDG-----MLG  336

Query  370  MPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
              D R++R  S +   +++RF QQG D   Q+  S  P FRSK M+ EEIE+IL+MQ  +
Sbjct  337  FVDPREARPGSAQGNRQNLRFHQQGFDGGVQRRYSGRPPFRSKCMSAEEIENILRMQLVA  396

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVDAEGRV  23
            +H NDPYVDDYYHQACLAK++  ++ +H FCPN  +    R  T + PH  L V+A GRV
Sbjct  397  THSNDPYVDDYYHQACLAKKSAGAKLRHHFCPNHLRDLHPRARTNNEPHAFLQVEALGRV  456

Query  22   SFSSIRR  2
             FSSIRR
Sbjct  457  PFSSIRR  463



>gb|EMT11670.1| Protein PAT1-1-like protein [Aegilops tauschii]
Length=809

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDA-ASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            +P +RD R++S + K S+RFSQ  SD   SQ  ES   +FRSKYM+ EEIESIL+MQH++
Sbjct  346  LPSSRDKRSRSGRGKHSLRFSQPPSDTTGSQNGESGGLKFRSKYMSSEEIESILRMQHSA  405

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            SH +DPYV DYYHQAC+AK+   S+ K  F P   K+  S+SR+S +   +L VDA GRV
Sbjct  406  SHSSDPYVVDYYHQACMAKKGSSSKQKTNFSPTSVKDLPSKSRSSGDQHAYLQVDALGRV  465

Query  22   SFSSIRR  2
            SFSSIRR
Sbjct  466  SFSSIRR  472



>gb|EMS52590.1| hypothetical protein TRIUR3_20541 [Triticum urartu]
Length=809

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDA-ASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            +P +RD R++S + K S+RFSQ  SD   SQ  ES   +FRSKYM+ EEIESIL+MQH++
Sbjct  346  LPSSRDKRSRSGRGKHSLRFSQPPSDTTGSQNGESGGLKFRSKYMSSEEIESILRMQHSA  405

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            SH +DPYV DYYHQAC+AK+   S+ K  F P   K+  S+SR+S +   +L VDA GRV
Sbjct  406  SHSSDPYVVDYYHQACMAKKGSSSKQKTNFSPTSVKDLPSKSRSSGDQHAYLQVDALGRV  465

Query  22   SFSSIRR  2
            SFSSIRR
Sbjct  466  SFSSIRR  472



>emb|CDY39512.1| BnaA01g24760D [Brassica napus]
Length=774

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 110/156 (71%), Gaps = 10/156 (6%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDS---RAKSHKS-KSVRFSQQGS-DAASQ  284
            S A  +A++SQ+Y+S+P+P+    +G+ + R+    ++ SH+S K+   SQQ S DAASQ
Sbjct  290  SYAQLAAIQSQMYSSYPSPSRKVPFGVGEVREQHKHKSSSHRSRKNKGISQQASSDAASQ  349

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            KSES   QFRSKYMT EEIESILKM+H++SH NDPYV+DYYHQA LAK++  + S   F 
Sbjct  350  KSESGL-QFRSKYMTSEEIESILKMKHSNSHSNDPYVNDYYHQARLAKKSRATIS--HFY  406

Query  103  PN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            P+  K+   RSRNS+E    +HVDA G+++   IRR
Sbjct  407  PSQLKDHQPRSRNSSEQHQQVHVDALGKITLPYIRR  442



>ref|XP_003568134.1| PREDICTED: uncharacterized protein LOC100841028 [Brachypodium 
distachyon]
Length=805

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 97/139 (70%), Gaps = 8/139 (6%)
 Frame = -2

Query  397  APAHLSKY----GMPDARDSRAKSHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGE  233
            +P  + K+     +P  RD R++S + K S+RFSQQ SDAA Q  ++   +FRSKYM+ E
Sbjct  335  SPEMIGKFDHVPNLPSPRDKRSRSGRGKHSIRFSQQPSDAAGQNVDNGGIKFRSKYMSSE  394

Query  232  EIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTES  59
            EIESIL+MQH++S  +DPY+DDYYHQAC+AKR+  S+ K  F P   K+  S+SR+  + 
Sbjct  395  EIESILRMQHSTSR-SDPYIDDYYHQACIAKRSASSQQKINFSPMSIKDFPSKSRSGGDQ  453

Query  58   LPHLHVDAEGRVSFSSIRR  2
              +L VDA GRVSFSSIRR
Sbjct  454  HSYLQVDAVGRVSFSSIRR  472



>emb|CAB10277.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78541.1| hypothetical protein [Arabidopsis thaliana]
Length=679

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 22/154 (14%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAKS-HKSKSVR--FSQQGSDAASQKS  278
            SLAH +AL+ QLY                 R+ + KS H+S+  R   SQQ SD ASQKS
Sbjct  234  SLAHLAALQPQLY----------------IREHKHKSSHRSRKNRGGISQQTSDLASQKS  277

Query  277  ESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN  98
            ES   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA LAK++  SR+K +  P+
Sbjct  278  ESGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLAKKSSGSRTKPQLYPS  336

Query  97   --KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
              K+  SRSRNS++  P +HVDA G+++  SI R
Sbjct  337  HLKDHQSRSRNSSDQQPQVHVDALGKITLPSICR  370



>ref|XP_002457098.1| hypothetical protein SORBIDRAFT_03g001160 [Sorghum bicolor]
 gb|EES02218.1| hypothetical protein SORBIDRAFT_03g001160 [Sorghum bicolor]
Length=592

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 5/130 (4%)
 Frame = -2

Query  376  YGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQ  206
            +GMP+  D RA+S   H  +   F  QGS+    K  +   +FRSKYM+ EE+E+IL++Q
Sbjct  152  FGMPEFSDPRARSSMHHGRQGHHFPFQGSEFGIMKMGNGRSRFRSKYMSTEELENILRIQ  211

Query  205  HASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAE  32
            HA++H NDPY+DDYYHQACLA R V+ RSKHRF P   ++ SS +R+  E   +L VDA 
Sbjct  212  HAATHINDPYIDDYYHQACLASRYVDGRSKHRFYPTLIRDPSSCARSKDEPHAYLKVDAL  271

Query  31   GRVSFSSIRR  2
            GR+ FSSIRR
Sbjct  272  GRLPFSSIRR  281



>ref|XP_011038110.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=797

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 116/196 (59%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN-----SFPA  395
            L N+L     HQNG++ PQL+   Q + H     V  S  H   ++SQ++N     S P 
Sbjct  278  LTNMLQPPLSHQNGIMPPQLIPQLQPQQHRLHPPVHSSSGHLLGMQSQVFNPHLSLSPPM  337

Query  394  PAHL-SKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
              +  +  G+ D RD R KS +     VR+ QQG D   QK +   PQFRSKYMT +EIE
Sbjct  338  TNNFDTMLGLTD-RDQRPKSVQKVRPMVRYPQQGFDVNGQKFDIGLPQFRSKYMTTDEIE  396

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            +IL+MQ A++  NDPY+DDYYHQACL+K+   ++ +H FCP   ++   R+R + E    
Sbjct  397  TILRMQLAATQSNDPYMDDYYHQACLSKKTAGAKLRHHFCPIHLRDLPPRARANAEPHAF  456

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GR+ FSSIRR
Sbjct  457  LQVDALGRIPFSSIRR  472



>ref|XP_011038109.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=798

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 116/196 (59%), Gaps = 14/196 (7%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN-----SFPA  395
            L N+L     HQNG++ PQL+   Q + H     V  S  H   ++SQ++N     S P 
Sbjct  279  LTNMLQPPLSHQNGIMPPQLIPQLQPQQHRLHPPVHSSSGHLLGMQSQVFNPHLSLSPPM  338

Query  394  PAHL-SKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIE  224
              +  +  G+ D RD R KS +     VR+ QQG D   QK +   PQFRSKYMT +EIE
Sbjct  339  TNNFDTMLGLTD-RDQRPKSVQKVRPMVRYPQQGFDVNGQKFDIGLPQFRSKYMTTDEIE  397

Query  223  SILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPH  50
            +IL+MQ A++  NDPY+DDYYHQACL+K+   ++ +H FCP   ++   R+R + E    
Sbjct  398  TILRMQLAATQSNDPYMDDYYHQACLSKKTAGAKLRHHFCPIHLRDLPPRARANAEPHAF  457

Query  49   LHVDAEGRVSFSSIRR  2
            L VDA GR+ FSSIRR
Sbjct  458  LQVDALGRIPFSSIRR  473



>dbj|BAJ90621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDA-ASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            +P +RD R++S + K S+RFSQ  SD   SQ  E    +FRSKYM+ EEIESIL+MQH++
Sbjct  344  LPSSRDKRSRSGRGKHSLRFSQPPSDTTGSQNGEGGGLKFRSKYMSSEEIESILRMQHSA  403

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            SH +DPYV DYYHQAC+AK+   SR K  F P   K+  S+SR++ +   +L VDA GRV
Sbjct  404  SHSSDPYVVDYYHQACMAKKGSTSRQKISFSPTSIKDLPSKSRSNGDQHAYLQVDALGRV  463

Query  22   SFSSIRR  2
            SFSSIRR
Sbjct  464  SFSSIRR  470



>dbj|BAJ88890.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDA-ASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            +P +RD R++S + K S+RFSQ  SD   SQ  E    +FRSKYM+ EEIESIL+MQH++
Sbjct  344  LPSSRDKRSRSGRGKHSLRFSQPPSDTTGSQNGEGGGLKFRSKYMSSEEIESILRMQHSA  403

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            SH +DPYV DYYHQAC+AK+   SR K  F P   K+  S+SR++ +   +L VDA GRV
Sbjct  404  SHSSDPYVVDYYHQACMAKKGSTSRQKISFSPTSIKDLPSKSRSNGDQHAYLQVDALGRV  463

Query  22   SFSSIRR  2
            SFSSIRR
Sbjct  464  SFSSIRR  470



>dbj|BAK00541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = -2

Query  370  MPDARDSRAKSHKSK-SVRFSQQGSDA-ASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
            +P +RD R++S + K S+RFSQ  SD   SQ  E    +FRSKYM+ EEIESIL+MQH++
Sbjct  344  LPSSRDKRSRSGRGKHSLRFSQPPSDTTGSQNGEGGGLKFRSKYMSSEEIESILRMQHSA  403

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRV  23
            SH +DPYV DYYHQAC+AK+   SR K  F P   K+  S+SR++ +   +L VDA GRV
Sbjct  404  SHSSDPYVVDYYHQACMAKKGSTSRQKISFSPTSIKDLPSKSRSNGDQHAYLQVDALGRV  463

Query  22   SFSSIRR  2
            SFSSIRR
Sbjct  464  SFSSIRR  470



>emb|CDY37402.1| BnaC05g30280D [Brassica napus]
Length=785

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 107/161 (66%), Gaps = 15/161 (9%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARD-----SRAKSHKSKSVRFSQQGSDAASQ  284
            S A  +AL+SQLY S+P+P+    +G  + R+     S  +S K+K +  SQQ SDAASQ
Sbjct  302  SYAQLAALQSQLYRSYPSPSRKVSFGGGEVREQHKHKSSHRSRKNKGI--SQQASDAASQ  359

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAV-ESRSKHRF  107
            KSES   QFRSKYMT EEIESILKMQH++SH NDPYV+DYYHQA LAK++   SR+   F
Sbjct  360  KSESGL-QFRSKYMTSEEIESILKMQHSNSHSNDPYVNDYYHQARLAKKSSGSSRAITLF  418

Query  106  CPNK------EQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             P++      +  SR+ +S +    +HVDA G+++   IRR
Sbjct  419  YPSQLKDHHHQPKSRNNSSEQHQQQVHVDALGKITLPYIRR  459



>ref|XP_006845982.1| hypothetical protein AMTR_s00155p00028780 [Amborella trichopoda]
 gb|ERN07657.1| hypothetical protein AMTR_s00155p00028780 [Amborella trichopoda]
Length=808

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 103/161 (64%), Gaps = 8/161 (5%)
 Frame = -2

Query  460  SVQPSLAHFSALRSQLYNSFPAPAHL--SKYGMP-DARDSRAKSHKSKSVRFSQQGSDAA  290
            S+Q  + H   +  QL++     +H+  SK+  P  A D   +S  ++  R      D  
Sbjct  318  SIQAVMTHLQGINPQLFSPHSQQSHMMMSKFEPPIGAMDQGGRSKATQRSRRGGYVQDQN  377

Query  289  SQKSESNA---PQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRS  119
            SQ++E+N+   PQFRSKYM+ +EIESIL+MQHA++H +DPYVDDYYHQACL+K +  +R 
Sbjct  378  SQRNENNSNGWPQFRSKYMSADEIESILRMQHAATHSSDPYVDDYYHQACLSKSSAGARL  437

Query  118  KHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            KH FCP+  ++   R+R + E   +L VDA GRV FSSIRR
Sbjct  438  KHHFCPSFLRDLPPRARANNEPHAYLQVDALGRVPFSSIRR  478



>ref|XP_011014090.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=797

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 113/195 (58%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN-----SFPA  395
            L N+L     HQNG++ PQL+   Q + H     V  S  H   ++SQ++N     S P 
Sbjct  278  LTNMLQPPLSHQNGIMPPQLIPQLQPQQHRLHPPVHSSSGHLLGMQSQVFNPHLSLSPPM  337

Query  394  PAHLSKYGMPDARDSRAKS-HKSKS-VRFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
              +         RD R KS  K +S V + QQG D   QK +   PQFRSKYMT +EIE+
Sbjct  338  TNNFDTMLGLTNRDQRPKSVQKVRSMVPYPQQGFDVNGQKFDIGLPQFRSKYMTTDEIET  397

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            IL+MQ A++  NDPYVDDYYHQACL+K+   ++ +H FCP   ++   R+R + E    L
Sbjct  398  ILRMQLAATQSNDPYVDDYYHQACLSKKTAGAKLRHHFCPIHLRDLPPRARANAEPHAFL  457

Query  46   HVDAEGRVSFSSIRR  2
             VDA GR+ FSSIRR
Sbjct  458  QVDALGRIPFSSIRR  472



>ref|XP_011014091.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=796

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 113/195 (58%), Gaps = 12/195 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHL---SVQPSLAHFSALRSQLYN-----SFPA  395
            L N+L     HQNG++ PQL+   Q + H     V  S  H   ++SQ++N     S P 
Sbjct  277  LTNMLQPPLSHQNGIMPPQLIPQLQPQQHRLHPPVHSSSGHLLGMQSQVFNPHLSLSPPM  336

Query  394  PAHLSKYGMPDARDSRAKS-HKSKS-VRFSQQGSDAASQKSESNAPQFRSKYMTGEEIES  221
              +         RD R KS  K +S V + QQG D   QK +   PQFRSKYMT +EIE+
Sbjct  337  TNNFDTMLGLTNRDQRPKSVQKVRSMVPYPQQGFDVNGQKFDIGLPQFRSKYMTTDEIET  396

Query  220  ILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHL  47
            IL+MQ A++  NDPYVDDYYHQACL+K+   ++ +H FCP   ++   R+R + E    L
Sbjct  397  ILRMQLAATQSNDPYVDDYYHQACLSKKTAGAKLRHHFCPIHLRDLPPRARANAEPHAFL  456

Query  46   HVDAEGRVSFSSIRR  2
             VDA GR+ FSSIRR
Sbjct  457  QVDALGRIPFSSIRR  471



>ref|XP_009149098.1| PREDICTED: protein PAT1 homolog 1-like [Brassica rapa]
Length=764

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 119/197 (60%), Gaps = 18/197 (9%)
 Frame = -2

Query  550  LNNVLPHQ-FPHQNGllspqlmspqqqrLHLSV----QPSLAHFSALRSQLYNSFPAPA-  389
            +NN+LP Q  PHQNGLL PQ   PQ      ++    QP   H   ++ Q +NS  + + 
Sbjct  254  MNNMLPQQQLPHQNGLLPPQQRMPQMPVPQNNIPHPMQPH-GHLPGMQPQFFNSHLSRSS  312

Query  388  ----HLSKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
                + +  G  D R++R  S +   +++RF QQ  D   Q+ +S   +FRSKYM+ +EI
Sbjct  313  SSGSYDAMLGFGDMREARPGSGQGNRQNMRFHQQSFDGGLQRRDS---RFRSKYMSADEI  369

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLP  53
            E++LK+Q A +  NDPYVDDYYHQA LAK+    + KHRFCPN  ++  SR+R + E   
Sbjct  370  ENMLKIQLAGTLTNDPYVDDYYHQARLAKKPEGEKQKHRFCPNHLRDLPSRARTNNEPHA  429

Query  52   HLHVDAEGRVSFSSIRR  2
             LHVDA GRV FSS+RR
Sbjct  430  FLHVDALGRVPFSSVRR  446



>ref|XP_009416762.1| PREDICTED: protein PAT1 homolog 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=742

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = -2

Query  373  GMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            GM  +RD R+K SH+ + ++R SQ+ S+    KS S   Q RSKYM+ EEIESIL+MQHA
Sbjct  282  GMSSSRDHRSKTSHRGRHNMRLSQRASETGILKSNSGF-QLRSKYMSAEEIESILRMQHA  340

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGR  26
            ++H  DPY+DDYYHQACLAK++  SR  H FCP   K+  SRSR + ES  +  VDA GR
Sbjct  341  ATHITDPYIDDYYHQACLAKKSASSRLNHNFCPTVIKDPPSRSRANNESHANCQVDALGR  400

Query  25   VSFSSIRR  2
            V  SSI R
Sbjct  401  VQLSSIPR  408



>emb|CDY35105.1| BnaA06g11150D [Brassica napus]
Length=551

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 117/197 (59%), Gaps = 18/197 (9%)
 Frame = -2

Query  550  LNNVLPHQ-FPHQNGllspqlmspqqqrLHLSV----QPSLAHFSALRSQLYNSFPAPAH  386
            +NN+LP Q  PHQNGLL PQ   PQ      S+    QP   H   ++ Q++NS  + + 
Sbjct  41   MNNMLPQQQLPHQNGLLPPQQRMPQMPVPQNSIPHPMQPH-GHLPGMQPQVFNSHLSRSS  99

Query  385  L-----SKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
                  +  G  D R++R  S +   +++RF Q   D   Q+ +S    FRSKYM+ +EI
Sbjct  100  SSGSYDAMLGFGDMREARPGSGQGNRQNMRFHQHSFDGGLQRRDSC---FRSKYMSADEI  156

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLP  53
            E++LK+Q A +  NDPYVDDYYHQA LAK+    + KHRFCPN  ++  SR+R + E   
Sbjct  157  ENMLKIQLAGTLTNDPYVDDYYHQARLAKKPEGEKQKHRFCPNHLRDLPSRARTNNEPHA  216

Query  52   HLHVDAEGRVSFSSIRR  2
             LHVDA GRV FSS+RR
Sbjct  217  FLHVDALGRVPFSSVRR  233



>ref|NP_001145976.1| hypothetical protein [Zea mays]
 gb|ACN33235.1| unknown [Zea mays]
 gb|AFW70877.1| hypothetical protein ZEAMMB73_167578 [Zea mays]
Length=791

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 89/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  382  SKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILK  212
            + + MPD  D RA+S   H+    R+  QG +  + + ++   +FRSKYM  EEIE+I +
Sbjct  345  ANFAMPDLSDPRARSMLQHERLGQRYPHQGYELNNIRIDNGWSRFRSKYMCTEEIENIAR  404

Query  211  MQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVD  38
            MQ A++H NDPY+DDYYHQACLAK++  ++ KH FCP   ++ SSR+R+  E   +L VD
Sbjct  405  MQQAATHINDPYIDDYYHQACLAKKSAGAQLKHHFCPTLIRDPSSRARSKDEPHAYLQVD  464

Query  37   AEGRVSFSSIRR  2
            A GR+ FSSIRR
Sbjct  465  ALGRLPFSSIRR  476



>ref|XP_009416761.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=808

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = -2

Query  373  GMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            GM  +RD R+K SH+ + ++R SQ+ S+    KS S   Q RSKYM+ EEIESIL+MQHA
Sbjct  348  GMSSSRDHRSKTSHRGRHNMRLSQRASETGILKSNSGF-QLRSKYMSAEEIESILRMQHA  406

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGR  26
            ++H  DPY+DDYYHQACLAK++  SR  H FCP   K+  SRSR + ES  +  VDA GR
Sbjct  407  ATHITDPYIDDYYHQACLAKKSASSRLNHNFCPTVIKDPPSRSRANNESHANCQVDALGR  466

Query  25   VSFSSIRR  2
            V  SSI R
Sbjct  467  VQLSSIPR  474



>ref|XP_009416760.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = -2

Query  373  GMPDARDSRAK-SHKSK-SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            GM  +RD R+K SH+ + ++R SQ+ S+    KS S   Q RSKYM+ EEIESIL+MQHA
Sbjct  376  GMSSSRDHRSKTSHRGRHNMRLSQRASETGILKSNSGF-QLRSKYMSAEEIESILRMQHA  434

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGR  26
            ++H  DPY+DDYYHQACLAK++  SR  H FCP   K+  SRSR + ES  +  VDA GR
Sbjct  435  ATHITDPYIDDYYHQACLAKKSASSRLNHNFCPTVIKDPPSRSRANNESHANCQVDALGR  494

Query  25   VSFSSIRR  2
            V  SSI R
Sbjct  495  VQLSSIPR  502



>ref|XP_009108983.1| PREDICTED: uncharacterized protein LOC103834665 isoform X1 [Brassica 
rapa]
Length=774

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 11/157 (7%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPA-HLSKYGMPDARDS---RAKSHKS-KSVRFSQQGS-DAAS  287
            S A  +A++SQL +S+P+P+     +G+ D R+    ++ SH+S K+   SQQ S DAAS
Sbjct  289  SYAQLAAIQSQLCSSYPSPSSRKVPFGVGDVREQHKHKSSSHRSRKNKGISQQASSDAAS  348

Query  286  QKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRF  107
            QKSES   QFRSKYMT EEIESILKM+H++SH NDPYV+DYYHQA LAK++  + S   F
Sbjct  349  QKSESGL-QFRSKYMTSEEIESILKMKHSNSHSNDPYVNDYYHQARLAKKSRATIS--HF  405

Query  106  CPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             P+  K+   RSRNS+E    +HVDA G+++   IRR
Sbjct  406  YPSQLKDHQPRSRNSSEQHQQVHVDALGKITLPYIRR  442



>ref|XP_009108988.1| PREDICTED: uncharacterized protein LOC103834665 isoform X2 [Brassica 
rapa]
Length=773

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 109/157 (69%), Gaps = 11/157 (7%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPA-HLSKYGMPDARDS---RAKSHKS-KSVRFSQQGS-DAAS  287
            S A  +A++SQL +S+P+P+     +G+ D R+    ++ SH+S K+   SQQ S DAAS
Sbjct  288  SYAQLAAIQSQLCSSYPSPSSRKVPFGVGDVREQHKHKSSSHRSRKNKGISQQASSDAAS  347

Query  286  QKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRF  107
            QKSES   QFRSKYMT EEIESILKM+H++SH NDPYV+DYYHQA LAK++  + S   F
Sbjct  348  QKSESGL-QFRSKYMTSEEIESILKMKHSNSHSNDPYVNDYYHQARLAKKSRATIS--HF  404

Query  106  CPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             P+  K+   RSRNS+E    +HVDA G+++   IRR
Sbjct  405  YPSQLKDHQPRSRNSSEQHQQVHVDALGKITLPYIRR  441



>emb|CDX87408.1| BnaA07g34650D [Brassica napus]
Length=754

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 109/188 (58%), Gaps = 11/188 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            +NN L  Q  HQNGL+ PQL   Q +  H  +QP L         L  S  + ++    G
Sbjct  251  MNNALLQQPSHQNGLMPPQLQGSQNRLQH-PMQPQL-----FNPHLSRSSSSGSYDGMLG  304

Query  370  MPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
              D R++R  S +   +++RF QQG D   Q+  S  P +RSKYM+  E+E+IL+ Q A+
Sbjct  305  FVDPREARPGSAQGNRQNMRFHQQGFDGGVQRRNSGWPPYRSKYMSAGELENILRAQLAA  364

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQS---SRSRNSTESLPHLHVDAEGR  26
            +H NDPYVDDYYHQACLAK +   + +H FCPN  +     R+R + E    L VDA GR
Sbjct  365  THSNDPYVDDYYHQACLAKNSAGGKLRHHFCPNHLRDLLHPRARTNNEPHAFLQVDALGR  424

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  425  VPFSSIRR  432



>ref|XP_009106629.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=754

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 109/188 (58%), Gaps = 11/188 (6%)
 Frame = -2

Query  550  LNNVLPHQFPHQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNSFPAPAHLSKYG  371
            +NN L  Q  HQNGL+ PQL   Q +  H  +QP L         L  S  + ++    G
Sbjct  251  MNNALLQQPSHQNGLMPPQLQGSQNRLQH-PMQPQL-----FNPHLSRSSSSGSYDGMLG  304

Query  370  MPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHAS  197
              D R++R  S +   +++RF QQG D   Q+  S  P +RSKYM+  E+E+IL+ Q A+
Sbjct  305  FVDPREARPGSAQGNRQNMRFHQQGFDGGVQRRNSGWPPYRSKYMSAGELENILRAQLAA  364

Query  196  SHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQS---SRSRNSTESLPHLHVDAEGR  26
            +H NDPYVDDYYHQACLAK +   + +H FCPN  +     R+R + E    L VDA GR
Sbjct  365  THSNDPYVDDYYHQACLAKNSAGGKLRHHFCPNHLRDLLHPRARTNNEPHAFLQVDALGR  424

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  425  VPFSSIRR  432



>ref|XP_009419548.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=739

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 92/143 (64%), Gaps = 10/143 (7%)
 Frame = -2

Query  418  QLYNSFPAPAHLSKYGMPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKY  245
            Q+ N F A       GM D RD R++      ++    QQ SD  +QK    + +FRSK 
Sbjct  273  QMINRFEA-----VLGMADFRDQRSRPIYRGRQNFGLPQQYSDVGNQKYNGWS-RFRSKC  326

Query  244  MTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRN  71
            MT EE+E+IL++QH ++H NDPYVDDYYHQACLAK++  S  KH FCPN  K+ SSR+ +
Sbjct  327  MTTEELENILRLQHVATHSNDPYVDDYYHQACLAKKSAGSSLKHHFCPNLTKDLSSRAHS  386

Query  70   STESLPHLHVDAEGRVSFSSIRR  2
              E   +L VDA GR+SFSSIRR
Sbjct  387  KDEPHAYLQVDALGRLSFSSIRR  409



>gb|EEC72953.1| hypothetical protein OsI_06835 [Oryza sativa Indica Group]
Length=830

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 91/145 (63%), Gaps = 10/145 (7%)
 Frame = -2

Query  421  SQLYNSFPAPAHLSKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRS  251
            SQ+ + F A        MPD  D RA++   H      +  QG + AS + ++  P+FRS
Sbjct  358  SQMMSGFDA-----NLAMPDLSDPRARAMLHHGVHGQHYLPQGFELASMRMDNGWPRFRS  412

Query  250  KYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRS  77
            KYM+  EIE+I +MQ A++  NDPY+DDYYHQACLAK++   + KH FCP   ++ SSR+
Sbjct  413  KYMSTAEIENIARMQQAATQINDPYIDDYYHQACLAKKSAGGQLKHHFCPTLIRDPSSRA  472

Query  76   RNSTESLPHLHVDAEGRVSFSSIRR  2
            R+  E   +L VDA GR+ FSSIRR
Sbjct  473  RSKDEPHAYLQVDALGRLPFSSIRR  497



>ref|NP_001046606.2| Os02g0294700 [Oryza sativa Japonica Group]
 dbj|BAD22175.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08520.2| Os02g0294700 [Oryza sativa Japonica Group]
Length=657

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 90/145 (62%), Gaps = 10/145 (7%)
 Frame = -2

Query  421  SQLYNSFPAPAHLSKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRS  251
            SQ+ + F A        MPD  D RA++   H      +  QG + A  + ++  P+FRS
Sbjct  185  SQMMSGFDA-----NLAMPDLSDPRARAMLHHGVHGQHYLPQGFELAGMRMDNGWPRFRS  239

Query  250  KYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRS  77
            KYM+  EIE+I +MQ A++  NDPY+DDYYHQACLAK++   + KH FCP   ++ SSR+
Sbjct  240  KYMSTPEIENIARMQQAATQINDPYIDDYYHQACLAKKSAGGQLKHHFCPTLIRDPSSRA  299

Query  76   RNSTESLPHLHVDAEGRVSFSSIRR  2
            R+  E   +L VDA GR+ FSSIRR
Sbjct  300  RSKDEPHAYLQVDALGRLPFSSIRR  324



>ref|XP_009419549.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=813

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 92/143 (64%), Gaps = 10/143 (7%)
 Frame = -2

Query  418  QLYNSFPAPAHLSKYGMPDARDSRAKS--HKSKSVRFSQQGSDAASQKSESNAPQFRSKY  245
            Q+ N F A       GM D RD R++      ++    QQ SD  +QK    + +FRSK 
Sbjct  347  QMINRFEA-----VLGMADFRDQRSRPIYRGRQNFGLPQQYSDVGNQKYNGWS-RFRSKC  400

Query  244  MTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRN  71
            MT EE+E+IL++QH ++H NDPYVDDYYHQACLAK++  S  KH FCPN  K+ SSR+ +
Sbjct  401  MTTEELENILRLQHVATHSNDPYVDDYYHQACLAKKSAGSSLKHHFCPNLTKDLSSRAHS  460

Query  70   STESLPHLHVDAEGRVSFSSIRR  2
              E   +L VDA GR+SFSSIRR
Sbjct  461  KDEPHAYLQVDALGRLSFSSIRR  483



>gb|KJB84264.1| hypothetical protein B456_N0144002, partial [Gossypium raimondii]
Length=317

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = -2

Query  355  DSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPY  176
            D RAKS  ++  R S +G D+ + KS+   PQF SKYM+ +EIE IL+MQ  ++H NDPY
Sbjct  1    DQRAKS--AQKGRQSLRGFDSGALKSDFGWPQFTSKYMSTDEIEGILRMQLVATHSNDPY  58

Query  175  VDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            VDDYYHQACLA+++  ++ +H FCP   ++   R+R +TE    L VDA GR+ FSSIRR
Sbjct  59   VDDYYHQACLARKSAGAKLRHHFCPTHLRDLPPRARANTEPHAFLQVDALGRLPFSSIRR  118



>ref|XP_006585425.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Glycine max]
Length=682

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = -2

Query  373  GMPDARDSRAKSHK--SKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            G+ + RD   KS +   +++RF  QG D  S +S S  P+FRSKYM+ EEIE+IL+MQ  
Sbjct  216  GLMEMRDPMPKSAQLGRQNLRFPPQGFDMGSLRSNSGWPRFRSKYMSIEEIENILRMQLV  275

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVDAEGR  26
            ++H NDPYVDDYYHQ CLAK++  ++ +H F P + +    R S+ + PH  L VDA GR
Sbjct  276  ATHSNDPYVDDYYHQGCLAKKSSGAKLRHHFSPAQIKELPLRPSSNAEPHAFLQVDALGR  335

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  336  VPFSSIRR  343



>gb|KHN27739.1| Protein PAT1 like 1 [Glycine soja]
Length=837

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = -2

Query  373  GMPDARDSRAKSHK--SKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            G+ + RD   KS +   +++RF  QG D    +S S  P+FRSKYMT EEIE+IL+MQ  
Sbjct  362  GLMEMRDQIPKSAQLGRQNLRFPPQGFDMGGLRSNSGWPRFRSKYMTTEEIENILRMQLV  421

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVDAEGR  26
            ++H NDPYVDDYYHQ CLAK++  ++ +H F P + +    R S+ + PH  L VDA GR
Sbjct  422  ATHSNDPYVDDYYHQGCLAKKSSGAKLRHHFSPAQIKELPLRPSSNAEPHAFLQVDALGR  481

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  482  VPFSSIRR  489



>ref|XP_003545912.1| PREDICTED: protein PAT1 homolog 1-like [Glycine max]
Length=828

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = -2

Query  373  GMPDARDSRAKSHK--SKSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            G+ + RD   KS +   +++RF  QG D    +S S  P+FRSKYMT EEIE+IL+MQ  
Sbjct  362  GLMELRDQIPKSAQLGRQNLRFPPQGFDMGGLRSNSGWPRFRSKYMTTEEIENILRMQLV  421

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVDAEGR  26
            ++H NDPYVDDYYHQ CLAK++  ++ +H F P + +    R S+ + PH  L VDA GR
Sbjct  422  ATHSNDPYVDDYYHQGCLAKKSSGAKLRHHFSPAQIKELPLRPSSNAEPHAFLQVDALGR  481

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  482  VPFSSIRR  489



>ref|XP_007149274.1| hypothetical protein PHAVU_005G056500g [Phaseolus vulgaris]
 gb|ESW21268.1| hypothetical protein PHAVU_005G056500g [Phaseolus vulgaris]
Length=828

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = -2

Query  373  GMPDARDSRAKSHKSK--SVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            G+ + RD   KS +    ++RFS QG D +  +S S  P+FRSK+MT EEIE+IL+MQ A
Sbjct  362  GLMELRDQMPKSAQIGRPNLRFSPQGFDTSGLRSNSGWPRFRSKHMTTEEIENILRMQLA  421

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVDAEGR  26
            ++H NDPYVDDYYHQ CLAK++  ++ +H F P + +    R S+ + PH  L VDA GR
Sbjct  422  ATHSNDPYVDDYYHQGCLAKKSSGAKLRHHFSPAQIRELPLRPSSNAEPHAFLQVDALGR  481

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  482  VPFSSIRR  489



>gb|EAZ22672.1| hypothetical protein OsJ_06342 [Oryza sativa Japonica Group]
Length=898

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 90/145 (62%), Gaps = 10/145 (7%)
 Frame = -2

Query  421  SQLYNSFPAPAHLSKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRS  251
            SQ+ + F A        MPD  D RA++   H      +  QG + A  + ++  P+FRS
Sbjct  426  SQMMSGFDA-----NLAMPDLSDPRARAMLHHGVHGQHYLPQGFELAGMRMDNGWPRFRS  480

Query  250  KYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRS  77
            KYM+  EIE+I +MQ A++  NDPY+DDYYHQACLAK++   + KH FCP   ++ SSR+
Sbjct  481  KYMSTPEIENIARMQQAATQINDPYIDDYYHQACLAKKSAGGQLKHHFCPTLIRDPSSRA  540

Query  76   RNSTESLPHLHVDAEGRVSFSSIRR  2
            R+  E   +L VDA GR+ FSSIRR
Sbjct  541  RSKDEPHAYLQVDALGRLPFSSIRR  565



>ref|XP_006647188.1| PREDICTED: protein PAT1 homolog 1-like [Oryza brachyantha]
Length=827

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 91/146 (62%), Gaps = 8/146 (5%)
 Frame = -2

Query  418  QLYNSFPAPAHL-----SKYGMPDARDSRAKSHKSKSVRFSQQGSDAASQKSESNAPQFR  254
            Q+YN  P P+ L     +   MPD  D RA++     V           Q+ ++  P+FR
Sbjct  350  QMYNP-PRPSQLMSGFDANLAMPDLSDPRARAMLHHGVHGQHYLPQGFEQRMDNGWPRFR  408

Query  253  SKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSR  80
            SKYM+  EIE+I +MQ A++H NDPY+DDYYHQACLA+++  ++ KH FCP   ++ SSR
Sbjct  409  SKYMSTSEIENIARMQQAATHINDPYIDDYYHQACLARKSAGAQLKHHFCPTLIRDPSSR  468

Query  79   SRNSTESLPHLHVDAEGRVSFSSIRR  2
            +R+  E   +L VDA GR+ FSSIRR
Sbjct  469  ARSKDEPHAYLQVDALGRLPFSSIRR  494



>emb|CDY40046.1| BnaC05g12690D [Brassica napus]
Length=761

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 117/197 (59%), Gaps = 18/197 (9%)
 Frame = -2

Query  550  LNNVLPHQ-FPHQNGllspqlmspqqqrLHLSV----QPSLAHFSALRSQLYNSFPAPA-  389
            + N+LP Q  PHQNGLL PQ   PQ      S+    QP   H   ++ Q++NS  + + 
Sbjct  251  IMNMLPQQQLPHQNGLLPPQQRMPQMPVPQNSIPHPMQPH-GHLPGMQPQVFNSHLSRSS  309

Query  388  ----HLSKYGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEI  227
                + +  G  D R++R  S +   +++RF Q   D   Q+ +S    FRSKYM+ +EI
Sbjct  310  SSGSYDAMLGFGDMREARPGSGQGNRQNMRFHQHSFDGGLQRRDSC---FRSKYMSADEI  366

Query  226  ESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRSRNSTESLP  53
            E++LK+Q A +  NDPYVDDYYHQA LAK+    + KHRFCPN  ++  SR+R + E   
Sbjct  367  ENMLKIQLAGTLTNDPYVDDYYHQARLAKKPEGEKQKHRFCPNHLRDLPSRARTNNEPHA  426

Query  52   HLHVDAEGRVSFSSIRR  2
             LHVDA GRV FSS+RR
Sbjct  427  FLHVDALGRVPFSSVRR  443



>emb|CDX88505.1| BnaC06g39490D [Brassica napus]
Length=761

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  376  YGMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQH  203
             G  D R++R  S +   +++RF Q G D   Q+  S  P +RSKYM+  E+E+IL+ Q 
Sbjct  310  LGFVDPREARPGSAQGNRQNMRFHQHGFDGGVQRRNSGWPPYRSKYMSAGELENILRAQL  369

Query  202  ASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQS---SRSRNSTESLPHLHVDAE  32
            A++H NDPYVDDYYHQACLAK++  +  KH FCPN  +     R+R + E    L VDA 
Sbjct  370  AATHSNDPYVDDYYHQACLAKKSAGANLKHHFCPNHLRDLLHPRARTNNEPHAFLQVDAL  429

Query  31   GRVSFSSIRR  2
            GRV FSSIRR
Sbjct  430  GRVPFSSIRR  439



>gb|KEH38343.1| topoisomerase II-associated protein PAT1 [Medicago truncatula]
Length=880

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 105/158 (66%), Gaps = 12/158 (8%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHL--SKYGMPDARDSRAKS-HKSK-SVRFSQQGSDAA  290
            VQ S  + S  +S L+N   +P+    SKY      D R KS  K K S R S QGSDA+
Sbjct  390  VQQSAGYLSGFQSHLFNPHLSPSSSVNSKY------DHRHKSSQKGKHSHRLSHQGSDAS  443

Query  289  SQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHR  110
            SQKSES++ QFRSK+MT +EIESIL+MQ A +H NDPY+DDYYHQ  LAK+   ++ KH 
Sbjct  444  SQKSESSSLQFRSKHMTSDEIESILRMQLAVTHSNDPYIDDYYHQGRLAKKPSVAKLKHP  503

Query  109  FCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            FCP   KE  SR+R+S +    L VD+ GRVSFSSIRR
Sbjct  504  FCPTQIKELPSRTRSSNDPHAFLQVDSLGRVSFSSIRR  541



>gb|EAY85452.1| hypothetical protein OsI_06832 [Oryza sativa Indica Group]
Length=898

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 10/145 (7%)
 Frame = -2

Query  421  SQLYNSFPAPAHLSKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRS  251
            SQ+ + F A        MPD  D RA++   H      +  QG + A  + ++  P+FRS
Sbjct  426  SQMMSGFDA-----NLAMPDLSDPRARAMLHHGVHGQHYLPQGFELAGMRMDNGWPRFRS  480

Query  250  KYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRS  77
            KYM+  EIE+I +MQ A++  NDPY+DDYYHQACLAK++   + KH FCP   ++ SSR+
Sbjct  481  KYMSTAEIENIARMQQAATQINDPYIDDYYHQACLAKKSAGGQLKHHFCPTLIRDPSSRA  540

Query  76   RNSTESLPHLHVDAEGRVSFSSIRR  2
            ++  E   +L VDA GR+ FSSIRR
Sbjct  541  QSKDEPHAYLQVDALGRLPFSSIRR  565



>ref|NP_001172909.1| Os02g0295700 [Oryza sativa Japonica Group]
 dbj|BAD22185.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ22674.1| hypothetical protein OsJ_06343 [Oryza sativa Japonica Group]
 dbj|BAG91987.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91638.1| Os02g0295700 [Oryza sativa Japonica Group]
Length=830

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 90/145 (62%), Gaps = 10/145 (7%)
 Frame = -2

Query  421  SQLYNSFPAPAHLSKYGMPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQFRS  251
            SQ+ + F A        MPD  D RA++   H      +  QG + AS + ++  P+FRS
Sbjct  358  SQMMSGFDA-----NLAMPDLSDPRARAMLHHGVHGQHYLPQGFELASMRMDNGWPRFRS  412

Query  250  KYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQSSRS  77
            KYM+  EIE+I +MQ A++  NDPY+DDYYHQACLAK++   + KH FCP   ++ SS +
Sbjct  413  KYMSTAEIENIARMQQAATQINDPYIDDYYHQACLAKKSAGGQLKHHFCPTLIRDPSSCA  472

Query  76   RNSTESLPHLHVDAEGRVSFSSIRR  2
            R+  E   +L VDA GR+ FSSIRR
Sbjct  473  RSKDEPHAYLQVDALGRLPFSSIRR  497



>ref|XP_003578526.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Brachypodium 
distachyon]
Length=722

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 110/208 (53%), Gaps = 40/208 (19%)
 Frame = -2

Query  547  NNVLPHQFP---HQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNS---------  404
            N ++P Q P    QNG+              L +Q S   FS L +Q+            
Sbjct  202  NGLVPPQMPPLRQQNGM--------------LPIQQSPPQFSQLHAQMLGPQHSPPQNLH  247

Query  403  -----FPAPAHLSKYG----MPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQ  260
                  P P  + ++     MPD  D RA+S   H  + +R+   G +  + + ++   +
Sbjct  248  MFGPRHPPPQMMGRFDPNLVMPDLSDPRARSMLHHGRQGLRYPPHGFELNNMRMDNRFQR  307

Query  259  FRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQS  86
            FRSKYM+ EEIE+I +MQ A++  NDPY+DDYYHQACLA++   ++ K  FCP   ++ S
Sbjct  308  FRSKYMSTEEIENIARMQQAATQINDPYIDDYYHQACLARKTAGAQLKRHFCPTLIRDPS  367

Query  85   SRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            SR+R+  E   +L VDA GR+ FSSIRR
Sbjct  368  SRARSRDEPHAYLQVDALGRLPFSSIRR  395



>ref|XP_010238435.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
Length=718

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 110/208 (53%), Gaps = 40/208 (19%)
 Frame = -2

Query  547  NNVLPHQFP---HQNGllspqlmspqqqrLHLSVQPSLAHFSALRSQLYNS---------  404
            N ++P Q P    QNG+              L +Q S   FS L +Q+            
Sbjct  198  NGLVPPQMPPLRQQNGM--------------LPIQQSPPQFSQLHAQMLGPQHSPPQNLH  243

Query  403  -----FPAPAHLSKYG----MPDARDSRAKS---HKSKSVRFSQQGSDAASQKSESNAPQ  260
                  P P  + ++     MPD  D RA+S   H  + +R+   G +  + + ++   +
Sbjct  244  MFGPRHPPPQMMGRFDPNLVMPDLSDPRARSMLHHGRQGLRYPPHGFELNNMRMDNRFQR  303

Query  259  FRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPN--KEQS  86
            FRSKYM+ EEIE+I +MQ A++  NDPY+DDYYHQACLA++   ++ K  FCP   ++ S
Sbjct  304  FRSKYMSTEEIENIARMQQAATQINDPYIDDYYHQACLARKTAGAQLKRHFCPTLIRDPS  363

Query  85   SRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            SR+R+  E   +L VDA GR+ FSSIRR
Sbjct  364  SRARSRDEPHAYLQVDALGRLPFSSIRR  391



>ref|XP_004488835.1| PREDICTED: uncharacterized protein LOC101501230 isoform X1 [Cicer 
arietinum]
Length=827

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = -2

Query  373  GMPDARDSRAKSHKS--KSVRFSQQGSDAASQKSESNAPQFRSKYMTGEEIESILKMQHA  200
            GM + RD   KS +   +++RFS QG D +S K  +  P+FRSKYMT EEIE+I +MQ  
Sbjct  364  GMMELRDQMPKSAQIGRQNLRFSPQGFDISSNKFNNGWPRFRSKYMTTEEIENIFRMQLQ  423

Query  199  SSHCNDPYVDDYYHQACLAKRAVESRSKHRFCPNKEQSSRSRNSTESLPH--LHVDAEGR  26
            ++H NDPYVDDYY+Q CLAK++  ++ +H F P + +    R S    PH  L VDA GR
Sbjct  424  ATHTNDPYVDDYYNQGCLAKKSSGAKLRHHFSPAQIREIPPRASANE-PHAFLQVDALGR  482

Query  25   VSFSSIRR  2
            V FSSIRR
Sbjct  483  VPFSSIRR  490



>ref|XP_004488834.1| PREDICTED: uncharacterized protein LOC101500903 [Cicer arietinum]
Length=879

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 103/158 (65%), Gaps = 11/158 (7%)
 Frame = -2

Query  457  VQPSLAHFSALRSQLYNSFPAPAHLSKYGMPDAR--DSRAKS-HKSK-SVRFSQQGSDAA  290
            VQ S  + S  +S LYN      HLS  G       D R KS  K K S R S QGSDA+
Sbjct  388  VQQSAGYLSGFQSHLYN-----PHLSSSGSSVNSKYDHRPKSSQKGKHSHRLSHQGSDAS  442

Query  289  SQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHR  110
            SQKS+S++ QFRSKYMT +EIESIL+MQ A +H NDPY+DDYYHQ  LAK+   S+ KH 
Sbjct  443  SQKSDSSSLQFRSKYMTSDEIESILRMQLAVTHSNDPYIDDYYHQGRLAKKPSVSKLKHP  502

Query  109  FCPN--KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            FCP   KE  SR+R++++    L VD  GRVSFSSIRR
Sbjct  503  FCPTQIKELPSRTRSNSDPHAFLQVDTLGRVSFSSIRR  540



>ref|XP_009399054.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=822

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 100/159 (63%), Gaps = 17/159 (11%)
 Frame = -2

Query  451  PSLAHFSALRSQLYNSFPAPAHLSKYG----MPDARDSRAKSHK--SKSVRFSQQGSDAA  290
            PSL HFS L+++L      P    K+     M D RD R K+ +   ++ RFS Q SD  
Sbjct  333  PSLPHFSHLQTRLNPHGSPPQMRYKFDLAIPMFDTRDHRLKASQRGKQTFRFSHQSSD--  390

Query  289  SQKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVES-RSKH  113
              KS++  PQ RSKYM+ EEIE+IL++Q+A++H +DPYV+DYYHQACLAK++  + R KH
Sbjct  391  -MKSDNKWPQIRSKYMSPEEIENILRIQNAATHASDPYVNDYYHQACLAKKSTGTGRLKH  449

Query  112  RFCP--NKEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             FCP   K+  SRS  + ES     VDA  +V  SS+RR
Sbjct  450  NFCPIAIKDLPSRSHGNNES-----VDALRKVPLSSVRR  483



>emb|CDY54867.1| BnaC01g22630D [Brassica napus]
Length=764

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 105/160 (66%), Gaps = 19/160 (12%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKSVR----FSQQGSDAASQ  284
            SLAH +AL+SQLY+S P+P+        + R+ + K SH+S+  R     SQQ S  +SQ
Sbjct  308  SLAHLAALQSQLYSSCPSPSR------QEVREHKHKPSHRSRKNRSGGGLSQQAS-LSSQ  360

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            KSE+   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA L K++  SR+K +FC
Sbjct  361  KSETGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLTKKSSGSRAKTQFC  419

Query  103  PN------KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            P+         S  S +S +  P +HVDA G+++   + R
Sbjct  420  PSHLKDHQSRSSRNSSSSDQQQPQVHVDALGKITLPHVCR  459



>emb|CDY46332.1| BnaC01g31660D [Brassica napus]
Length=774

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 12/158 (8%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLS-KYGMPDARDS---RAKSHKS-KSVRFSQQGS-DAAS  287
            S A  +A++SQLY+S+P+P+     +G+ D R+    ++ SH+S K+   SQQ S DAAS
Sbjct  289  SYAQLAAIQSQLYSSYPSPSSRKVPFGVGDVREQHKHKSSSHRSRKNKGISQQASSDAAS  348

Query  286  QKSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRF  107
            QKSES   QFRSKYMT EEIESILKM+H++SH NDPYV+DYYHQA LAK++  + S   F
Sbjct  349  QKSESGL-QFRSKYMTSEEIESILKMKHSNSHSNDPYVNDYYHQARLAKKSRATIS--HF  405

Query  106  CPNKEQS---SRSRNSTESLPHLHVDAEGRVSFSSIRR  2
             P++ +     RSRNS+E    +HVDA G+++   IRR
Sbjct  406  YPSQLKDHHQPRSRNSSEQHQQVHVDALGKITLPYIRR  443



>emb|CDY50269.1| BnaAnng10330D [Brassica napus]
Length=768

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 19/160 (12%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKSVR----FSQQGSDAASQ  284
            SLAH +AL+SQLY+S P+P+        + R+ + K SH+S+  R     SQQ S  +SQ
Sbjct  313  SLAHPAALQSQLYSSCPSPSR------QEVREHKHKPSHRSRKNRSGGGLSQQAS-LSSQ  365

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            KSE+   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA L K++  SR K +FC
Sbjct  366  KSETGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLTKKSSGSRVKTQFC  424

Query  103  PN--KE----QSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            P+  KE     S  S +S +  P +HVDA G+++   + R
Sbjct  425  PSHLKEHQSRSSRNSSSSDQQQPQVHVDALGKITLPHVCR  464



>ref|XP_009147964.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=768

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 104/160 (65%), Gaps = 19/160 (12%)
 Frame = -2

Query  448  SLAHFSALRSQLYNSFPAPAHLSKYGMPDARDSRAK-SHKSKSVR----FSQQGSDAASQ  284
            SLAH +AL+SQLY+S P+P+        + R+ + K SH+S+  R     SQQ S  +SQ
Sbjct  313  SLAHPAALQSQLYSSCPSPSR------QEVREHKHKPSHRSRKNRSGGGLSQQAS-LSSQ  365

Query  283  KSESNAPQFRSKYMTGEEIESILKMQHASSHCNDPYVDDYYHQACLAKRAVESRSKHRFC  104
            KSE+   QFRSKYMT EEIESILKMQH++SH +DPYV+DYYHQA L K++  SR K +FC
Sbjct  366  KSETGL-QFRSKYMTSEEIESILKMQHSNSHSSDPYVNDYYHQARLTKKSSGSRVKTQFC  424

Query  103  PN------KEQSSRSRNSTESLPHLHVDAEGRVSFSSIRR  2
            P+         S  S +S +  P +HVDA G+++   + R
Sbjct  425  PSHLKDHQSRSSRNSSSSDQQQPQVHVDALGKITLPHVCR  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720