BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017B03 488 bp,

Length=488
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU44776.1|  hypothetical protein MIMGU_mgv1a015745mg                181   1e-54   Erythranthe guttata [common monkey flower]
ref|XP_009631034.1|  PREDICTED: uncharacterized protein LOC104120867    168   6e-49   Nicotiana tomentosiformis
ref|XP_011098442.1|  PREDICTED: uncharacterized protein LOC105177...    164   3e-47   Sesamum indicum [beniseed]
ref|XP_011098440.1|  PREDICTED: uncharacterized protein LOC105177...    164   4e-47   Sesamum indicum [beniseed]
ref|XP_011098441.1|  PREDICTED: uncharacterized protein LOC105177...    164   4e-47   Sesamum indicum [beniseed]
ref|XP_009785949.1|  PREDICTED: uncharacterized protein LOC104234139    159   2e-45   Nicotiana sylvestris
ref|XP_004232317.1|  PREDICTED: uncharacterized protein LOC101257032    159   2e-45   Solanum lycopersicum
ref|XP_006338587.1|  PREDICTED: uncharacterized protein LOC102599852    159   2e-45   Solanum tuberosum [potatoes]
emb|CDP02082.1|  unnamed protein product                                158   4e-45   Coffea canephora [robusta coffee]
ref|XP_009377185.1|  PREDICTED: uncharacterized protein LOC103965821    154   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_002524661.1|  sirohydrochlorin ferrochelatase, putative          154   2e-43   Ricinus communis
gb|KDP45322.1|  hypothetical protein JCGZ_09571                         152   9e-43   Jatropha curcas
ref|XP_010251141.1|  PREDICTED: uncharacterized protein LOC104593...    152   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_008357734.1|  PREDICTED: uncharacterized protein LOC103421473    151   2e-42   
ref|XP_002273543.1|  PREDICTED: uncharacterized protein LOC100244073    151   3e-42   Vitis vinifera
ref|XP_008341717.1|  PREDICTED: uncharacterized protein LOC103404567    149   6e-41   
ref|XP_003524552.1|  PREDICTED: uncharacterized protein LOC100500...    145   4e-40   Glycine max [soybeans]
gb|KHN27452.1|  Sirohydrochlorin ferrochelatase                         145   4e-40   Glycine soja [wild soybean]
ref|XP_009334112.1|  PREDICTED: uncharacterized protein LOC103926952    145   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_006579772.1|  PREDICTED: uncharacterized protein LOC100500...    145   5e-40   Glycine max [soybeans]
gb|KHG13683.1|  Sirohydrochlorin ferrochelatase                         145   1e-39   Gossypium arboreum [tree cotton]
gb|KJB11537.1|  hypothetical protein B456_001G264200                    143   3e-39   Gossypium raimondii
ref|XP_008230561.1|  PREDICTED: uncharacterized protein LOC103329819    141   1e-38   Prunus mume [ume]
ref|XP_007151006.1|  hypothetical protein PHAVU_004G0108001g            138   4e-38   Phaseolus vulgaris [French bean]
ref|XP_007031548.1|  Sirohydrochlorin ferrochelatase B                  140   5e-38   
ref|XP_010093442.1|  Sirohydrochlorin ferrochelatase                    138   3e-37   Morus notabilis
ref|XP_004142793.1|  PREDICTED: sirohydrochlorin ferrochelatase-like    137   5e-37   Cucumis sativus [cucumbers]
ref|XP_009409069.1|  PREDICTED: uncharacterized protein LOC103991...    138   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB11538.1|  hypothetical protein B456_001G264200                    137   1e-36   Gossypium raimondii
ref|XP_006446561.1|  hypothetical protein CICLE_v10016757mg             134   5e-36   Citrus clementina [clementine]
ref|XP_006446562.1|  hypothetical protein CICLE_v10016757mg             134   8e-36   
ref|XP_010251142.1|  PREDICTED: uncharacterized protein LOC104593...    133   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_008458790.1|  PREDICTED: uncharacterized protein LOC103498093    134   1e-35   Cucumis melo [Oriental melon]
ref|XP_010033307.1|  PREDICTED: uncharacterized protein LOC104422628    134   1e-35   Eucalyptus grandis [rose gum]
ref|XP_008348192.1|  PREDICTED: uncharacterized protein LOC103411331    132   2e-35   
ref|XP_010479465.1|  PREDICTED: uncharacterized protein LOC104758...    134   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010479466.1|  PREDICTED: uncharacterized protein LOC104758...    133   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002299633.2|  hypothetical protein POPTR_0001s17900g             133   4e-35   
ref|NP_564562.1|  sirohydrochlorin ferrochelatase B                     132   6e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500571.1|  PREDICTED: uncharacterized protein LOC104777944    132   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010461867.1|  PREDICTED: uncharacterized protein LOC104742...    132   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007217178.1|  hypothetical protein PRUPE_ppa012658mg             130   9e-35   
ref|XP_006829077.1|  hypothetical protein AMTR_s00001p00260270          131   9e-35   Amborella trichopoda
ref|XP_010461868.1|  PREDICTED: uncharacterized protein LOC104742...    132   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011002714.1|  PREDICTED: uncharacterized protein LOC105109...    131   1e-34   Populus euphratica
gb|KDO55191.1|  hypothetical protein CISIN_1g023828mg                   132   1e-34   Citrus sinensis [apfelsine]
gb|AAM67145.1|  unknown                                                 131   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011002713.1|  PREDICTED: uncharacterized protein LOC105109...    131   2e-34   Populus euphratica
ref|XP_006470275.1|  PREDICTED: uncharacterized protein LOC102627039    130   2e-34   Citrus sinensis [apfelsine]
gb|KDO55190.1|  hypothetical protein CISIN_1g023828mg                   131   3e-34   Citrus sinensis [apfelsine]
gb|KDO55189.1|  hypothetical protein CISIN_1g023828mg                   131   3e-34   Citrus sinensis [apfelsine]
emb|CAN60425.1|  hypothetical protein VITISV_021073                     128   4e-34   Vitis vinifera
gb|KFK35946.1|  hypothetical protein AALP_AA4G058800                    130   4e-34   Arabis alpina [alpine rockcress]
gb|KDO55188.1|  hypothetical protein CISIN_1g023828mg                   131   5e-34   Citrus sinensis [apfelsine]
ref|XP_004291766.2|  PREDICTED: uncharacterized protein LOC101314...    129   1e-33   Fragaria vesca subsp. vesca
ref|XP_004291768.2|  PREDICTED: uncharacterized protein LOC101314...    129   1e-33   Fragaria vesca subsp. vesca
ref|XP_006647189.1|  PREDICTED: uncharacterized protein LOC102709053    127   2e-33   
ref|XP_009409070.1|  PREDICTED: uncharacterized protein LOC103991...    126   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK06991.1|  predicted protein                                      127   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY03592.1|  BnaC03g68510D                                          127   5e-33   
ref|XP_010670852.1|  PREDICTED: uncharacterized protein LOC104887804    127   5e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008783194.1|  PREDICTED: uncharacterized protein LOC103702509    126   1e-32   Phoenix dactylifera
ref|XP_010915963.1|  PREDICTED: uncharacterized protein LOC105040...    126   1e-32   Elaeis guineensis
ref|XP_009107234.1|  PREDICTED: uncharacterized protein LOC103832890    126   2e-32   Brassica rapa
emb|CDY45053.1|  BnaA08g02220D                                          125   3e-32   Brassica napus [oilseed rape]
dbj|BAD21683.1|  unknown protein                                        125   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009409075.1|  PREDICTED: uncharacterized protein LOC103991...    123   4e-32   
ref|XP_009409074.1|  PREDICTED: uncharacterized protein LOC103991...    124   5e-32   
ref|XP_004952284.1|  PREDICTED: uncharacterized protein LOC101756...    124   7e-32   
gb|EPS61981.1|  hypothetical protein M569_12814                         122   9e-32   Genlisea aurea
ref|XP_010678615.1|  PREDICTED: uncharacterized protein LOC104894137    121   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010523580.1|  PREDICTED: uncharacterized protein LOC104801894    123   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_010915962.1|  PREDICTED: uncharacterized protein LOC105040...    125   2e-31   Elaeis guineensis
ref|XP_002453737.1|  hypothetical protein SORBIDRAFT_04g012200          123   2e-31   Sorghum bicolor [broomcorn]
ref|XP_004489242.1|  PREDICTED: sirohydrochlorin ferrochelatase-like    122   3e-31   Cicer arietinum [garbanzo]
gb|ACG31626.1|  sirohydrochlorin ferrochelatase                         122   4e-31   Zea mays [maize]
ref|XP_003618170.1|  Sirohydrochlorin ferrochelatase                    122   4e-31   Medicago truncatula
ref|XP_009381040.1|  PREDICTED: uncharacterized protein LOC103969...    122   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381038.1|  PREDICTED: uncharacterized protein LOC103969...    122   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002891559.1|  hypothetical protein ARALYDRAFT_314421             122   6e-31   
gb|AAD50047.1|AC007980_12  Hypothetical protein                         122   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393176.1|  hypothetical protein EUTSA_v10011756mg             121   1e-30   Eutrema salsugineum [saltwater cress]
gb|ACG41745.1|  sirohydrochlorin ferrochelatase                         120   2e-30   Zea mays [maize]
gb|AFK44994.1|  unknown                                                 120   2e-30   Medicago truncatula
ref|NP_001132509.1|  sirohydrochlorin ferrochelatase isoform 1          119   4e-30   Zea mays [maize]
ref|XP_003574408.1|  PREDICTED: uncharacterized protein LOC100845...    119   4e-30   Brachypodium distachyon [annual false brome]
ref|XP_010235070.1|  PREDICTED: uncharacterized protein LOC100845...    119   4e-30   
ref|XP_010238623.1|  PREDICTED: uncharacterized protein LOC100837...    119   4e-30   Brachypodium distachyon [annual false brome]
ref|XP_003578793.1|  PREDICTED: uncharacterized protein LOC100837...    119   5e-30   Brachypodium distachyon [annual false brome]
ref|XP_010530526.1|  PREDICTED: uncharacterized protein LOC104807...    119   5e-30   Tarenaya hassleriana [spider flower]
ref|XP_010530522.1|  PREDICTED: uncharacterized protein LOC104807...    119   1e-29   
ref|XP_003618173.1|  Sirohydrochlorin cobaltochelatase                  117   4e-29   Medicago truncatula
gb|ACR35235.1|  unknown                                                 115   9e-29   Zea mays [maize]
ref|XP_003618171.1|  Sirohydrochlorin ferrochelatase                    112   3e-27   
gb|ABK26418.1|  unknown                                                 110   2e-26   Picea sitchensis
gb|KHN23513.1|  hypothetical protein glysoja_029802                     107   1e-25   Glycine soja [wild soybean]
ref|XP_002964135.1|  hypothetical protein SELMODRAFT_37056              105   5e-25   
ref|XP_002993172.1|  hypothetical protein SELMODRAFT_26806              104   6e-25   
ref|XP_001765290.1|  predicted protein                                  103   2e-24   
ref|XP_008667254.1|  PREDICTED: sirohydrochlorin ferrochelatase i...    101   6e-23   
ref|XP_008353469.1|  PREDICTED: uncharacterized protein LOC103417039  98.6    2e-22   
emb|CBI34882.3|  unnamed protein product                              92.4    1e-20   Vitis vinifera
ref|XP_002506350.1|  predicted protein                                91.7    4e-20   Micromonas commoda
gb|EEC72956.1|  hypothetical protein OsI_06840                        89.0    3e-19   Oryza sativa Indica Group [Indian rice]
ref|WP_040351481.1|  hypothetical protein                             87.0    9e-19   
ref|XP_003083605.1|  unnamed protein product                          88.6    2e-18   Ostreococcus tauri
ref|XP_010461882.1|  PREDICTED: uncharacterized protein LOC104742567  86.3    3e-18   
ref|WP_041378683.1|  hypothetical protein                             85.9    5e-18   
gb|EAQ82176.1|  cbiX protein                                          86.3    5e-18   Blastopirellula marina DSM 3645
ref|XP_001421596.1|  predicted protein                                85.9    6e-18   Ostreococcus lucimarinus CCE9901
dbj|BAM03818.1|  putative sirohydrochlorin cobaltochelatase           85.1    2e-17   Phycisphaera mikurensis NBRC 102666
gb|EWM29197.1|  Cobalamin (vitamin B12) biosynthesis CbiX             83.2    3e-16   Nannochloropsis gaditana
ref|XP_003063280.1|  predicted protein                                81.3    3e-16   Micromonas pusilla CCMP1545
emb|CBJ30308.1|  sirohydrochlorin ferrochelatase, putative chloro...  81.3    1e-15   Ectocarpus siliculosus
ref|XP_001698709.1|  sirohydrochlorin ferrochelatase, SIRB            81.3    1e-15   Chlamydomonas reinhardtii
ref|XP_005851931.1|  hypothetical protein CHLNCDRAFT_133580           79.3    2e-15   Chlorella variabilis
ref|XP_005536035.1|  hypothetical protein, conserved                  73.9    3e-13   Cyanidioschyzon merolae strain 10D
ref|XP_005711482.1|  unnamed protein product                          73.9    7e-13   Chondrus crispus [carageen]
ref|XP_009040729.1|  hypothetical protein AURANDRAFT_32321            70.5    3e-12   Aureococcus anophagefferens
ref|XP_005643741.1|  CbiX-domain-containing protein                   69.7    4e-12   Coccomyxa subellipsoidea C-169
emb|CBE70093.1|  NUDIX hydrolase (modular protein)                    71.6    5e-12   Candidatus Methylomirabilis oxyfera
ref|XP_010530527.1|  PREDICTED: uncharacterized protein LOC104807...  68.6    2e-11   Tarenaya hassleriana [spider flower]
ref|WP_007022881.1|  hypothetical protein                             67.4    3e-11   
ref|WP_034419847.1|  hypothetical protein                             66.2    8e-11   Clostridiales bacterium DRI-13
ref|WP_026174408.1|  hypothetical protein                             66.2    9e-11   
ref|WP_015246709.1|  hypothetical protein                             66.2    1e-10   Singulisphaera acidiphila
ref|XP_007508641.1|  predicted protein                                66.2    2e-10   Bathycoccus prasinos
ref|WP_041971482.1|  sirohydrochlorin cobaltochelatase                64.7    3e-10   Geobacter sp. OR-1
ref|WP_004513845.1|  sirohydrochlorin cobaltochelatase                64.3    3e-10   Geobacter metallireducens
ref|WP_040592008.1|  cobalamin biosynthesis protein CbiX              63.9    5e-10   
ref|WP_033407066.1|  cobalamin biosynthesis protein CbiX              63.9    5e-10   Thiolinea disciformis
ref|WP_044238640.1|  cobalamin biosynthesis protein CbiX              63.9    6e-10   
gb|ADY62006.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     63.5    6e-10   Rubinisphaera brasiliensis DSM 5305
gb|EDL58513.1|  Cobalamin (vitamin B12) biosynthesis CbiX protein     63.5    7e-10   Gimesia maris DSM 8797
ref|WP_039740278.1|  sirohydrochlorin cobaltochelatase                63.2    8e-10   Geobacter pickeringii
gb|KHN12062.1|  Sirohydrochlorin ferrochelatase                       60.8    3e-09   Glycine soja [wild soybean]
ref|WP_026842098.1|  sirohydrochlorin cobaltochelatase                62.0    3e-09   Geobacter bremensis
ref|WP_044742814.1|  sirohydrochlorin cobaltochelatase                63.5    3e-09   Anoxybacillus geothermalis
ref|XP_007216178.1|  hypothetical protein PRUPE_ppa015785mg           60.5    3e-09   
ref|WP_012531975.1|  sirohydrochlorin cobaltochelatase                61.6    3e-09   Geobacter bemidjiensis
ref|WP_033025433.1|  sirohydrochlorin cobaltochelatase                63.5    3e-09   Geobacillus sp. CAMR5420
ref|WP_038084991.1|  hypothetical protein                             61.2    4e-09   Tumebacillus flagellatus
ref|WP_010943630.1|  sirohydrochlorin cobaltochelatase                61.2    4e-09   Geobacter sulfurreducens
ref|WP_033020763.1|  sirohydrochlorin cobaltochelatase                63.2    4e-09   Geobacillus icigianus
ref|WP_019119442.1|  hypothetical protein                             63.2    4e-09   Brevibacillus massiliensis
ref|WP_023634354.1|  sirohydrochlorin cobaltochelatase                63.2    4e-09   Geobacillus sp. MAS1
ref|WP_008880154.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  63.2    4e-09   Geobacillus
ref|WP_015374903.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  63.2    4e-09   Geobacillus
ref|WP_011887477.1|  sirohydrochlorin cobaltochelatase                63.2    5e-09   Geobacillus thermodenitrificans
ref|WP_011735221.1|  sirohydrochlorin cobaltochelatase                61.2    5e-09   Pelobacter propionicus
ref|WP_033843838.1|  sirohydrochlorin cobaltochelatase                63.2    5e-09   Geobacillus
ref|WP_013523816.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  62.8    5e-09   Geobacillus
ref|XP_005703681.1|  sirohydrochlorin cobaltochelatase-like protein   61.6    5e-09   Galdieria sulphuraria
ref|WP_041400479.1|  cobalamin biosynthesis protein CbiX              60.8    5e-09   
ref|WP_026894565.1|  hypothetical protein                             60.8    6e-09   Clostridiisalibacter paucivorans
ref|WP_040888328.1|  cobalamin biosynthesis protein CbiX              60.5    7e-09   
ref|WP_011936979.1|  sirohydrochlorin cobaltochelatase                60.1    1e-08   Geobacter uraniireducens
ref|WP_015838817.1|  sirohydrochlorin cobaltochelatase                60.1    1e-08   Geobacter sp. M21
ref|WP_010041782.1|  cobalamin biosynthesis protein CbiX              59.7    1e-08   Gemmata obscuriglobus
ref|WP_025950690.1|  sirohydrochlorin cobaltochelatase                61.6    1e-08   Geobacillus thermocatenulatus
ref|WP_033005389.1|  sirohydrochlorin cobaltochelatase                61.6    1e-08   Geobacillus
ref|WP_011231294.1|  sirohydrochlorin cobaltochelatase                61.6    1e-08   Geobacillus
ref|WP_033010025.1|  sirohydrochlorin cobaltochelatase                61.6    1e-08   
ref|WP_013145274.1|  sirohydrochlorin cobaltochelatase                61.6    1e-08   Geobacillus sp. C56-T3
ref|WP_031409368.1|  sirohydrochlorin cobaltochelatase                61.6    1e-08   Geobacillus vulcani
ref|WP_033016971.1|  sirohydrochlorin cobaltochelatase                61.6    1e-08   Geobacillus stearothermophilus
ref|WP_039646717.1|  sirohydrochlorin cobaltochelatase                59.7    1e-08   Geobacter
gb|EPR28848.1|  Sirohydrochlorin cobaltochelatase                     61.6    1e-08   Geobacillus sp. WSUCF1
ref|WP_044737026.1|  sirohydrochlorin cobaltochelatase                61.2    2e-08   Geobacillus kaustophilus
ref|WP_020561351.1|  hypothetical protein                             59.3    2e-08   Thiofilum flexile
ref|WP_012645135.1|  sirohydrochlorin cobaltochelatase                59.3    2e-08   Geobacter daltonii
ref|WP_028490034.1|  cobalamin biosynthesis protein CbiX              59.3    2e-08   Thiothrix lacustris
ref|WP_040099907.1|  sirohydrochlorin cobaltochelatase                58.9    3e-08   Geoalkalibacter ferrihydriticus
ref|WP_010870484.1|  sirohydrochlorin cobaltochelatase                58.9    3e-08   Methanocaldococcus jannaschii
ref|WP_043904546.1|  sirohydrochlorin cobaltochelatase                60.8    3e-08   Parageobacillus genomosp. 1
ref|WP_026604006.1|  cobalamin biosynthesis protein CbiX              58.5    3e-08   Methylomonas sp. 11b
ref|WP_020485404.1|  hypothetical protein                             58.5    3e-08   Methylomonas sp. MK1
ref|WP_035741568.1|  cobalamin biosynthesis protein CbiX              58.5    4e-08   
ref|WP_036272023.1|  cobalamin biosynthesis protein CbiX              57.4    7e-08   
ref|WP_003250807.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  59.7    7e-08   Bacillaceae
ref|WP_042384847.1|  sirohydrochlorin cobaltochelatase                59.7    7e-08   Parageobacillus thermoglucosidasius
ref|WP_015732608.1|  sirohydrochlorin cobaltochelatase                57.8    8e-08   Methanocaldococcus vulcanius
ref|WP_036581629.1|  sirohydrochlorin cobaltochelatase                59.7    8e-08   
gb|EXX87131.1|  sirohydrochlorin cobaltochelatase                     59.7    8e-08   Paenibacillus darwinianus
dbj|BAL52372.1|  cobalamin (vitamin B12) biosynthesis CbiX protein    57.8    9e-08   uncultured planctomycete
ref|XP_002184254.1|  predicted protein                                59.7    9e-08   Phaeodactylum tricornutum CCAP 1055/1
gb|AIJ06099.1|  sirohydrochlorin cobaltochelatase                     57.4    1e-07   Methanocaldococcus bathoardescens
ref|WP_019395087.1|  MULTISPECIES: hypothetical protein               58.9    1e-07   Bacillus
ref|WP_013277760.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  57.0    1e-07   
ref|WP_029518590.1|  sirohydrochlorin cobaltochelatase                59.7    1e-07   Paenibacillus polymyxa
ref|WP_015791410.1|  sirohydrochlorin cobaltochelatase                57.4    1e-07   Methanocaldococcus fervens
ref|WP_039271661.1|  sirohydrochlorin cobaltochelatase                59.7    1e-07   Paenibacillus polymyxa
ref|WP_015863807.1|  sirohydrochlorin cobaltochelatase                58.9    1e-07   Geobacillus sp. WCH70
ref|WP_017434177.1|  sirohydrochlorin cobaltochelatase                58.9    1e-07   Parageobacillus caldoxylosilyticus
ref|WP_025719598.1|  sirohydrochlorin cobaltochelatase                59.3    1e-07   Paenibacillus polymyxa
ref|WP_004591394.1|  sirohydrochlorin cobaltochelatase                56.6    1e-07   
ref|WP_043882384.1|  sirohydrochlorin cobaltochelatase                59.3    1e-07   Paenibacillus polymyxa
ref|WP_025678200.1|  sirohydrochlorin cobaltochelatase                59.3    2e-07   Paenibacillus polymyxa
ref|WP_043107510.1|  cobalamin biosynthesis protein CbiX              56.6    2e-07   endosymbiont of unidentified scaly snail isolate Monju
ref|WP_020959933.1|  sirohydrochlorin cobaltochelatase                58.5    2e-07   Geobacillus genomosp. 3
ref|WP_040102666.1|  sirohydrochlorin cobaltochelatase                59.3    2e-07   Paenibacillus polymyxa
gb|ADM72307.1|  Sirohydrochlorin cobaltochelatase (CbiXL)             59.3    2e-07   
ref|WP_040209287.1|  MULTISPECIES: cobalamin biosynthesis protein...  58.2    2e-07   Bacillus
ref|WP_017980990.1|  sirohydrochlorin cobaltochelatase                56.6    2e-07   
ref|WP_016324845.1|  sirohydrochlorin cobaltochelatase                59.3    2e-07   Paenibacillus polymyxa
ref|WP_013373524.1|  sirohydrochlorin cobaltochelatase                59.3    2e-07   Paenibacillus polymyxa
ref|WP_041644405.1|  hypothetical protein                             56.6    2e-07   
gb|AEE96420.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     56.6    2e-07   Mahella australiensis 50-1 BON
ref|WP_042407897.1|  sirohydrochlorin cobaltochelatase                58.5    2e-07   Parageobacillus caldoxylosilyticus
ref|WP_008637213.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    58.2    2e-07   Bacillaceae
ref|WP_042346195.1|  hypothetical protein                             57.8    2e-07   Bacillus massiliogorillae
ref|WP_012980610.1|  sirohydrochlorin cobaltochelatase                56.6    2e-07   Methanocaldococcus sp. FS406-22
ref|WP_004891937.1|  sirohydrochlorin cobaltochelatase                58.2    2e-07   Anoxybacillus flavithermus
ref|WP_028309103.1|  hypothetical protein                             56.2    2e-07   Desulfitibacter alkalitolerans
ref|WP_028400402.1|  sirohydrochlorin ferrochelatase                  57.8    3e-07   Bacillus panaciterrae
ref|WP_040979252.1|  cobalamin biosynthesis protein CbiX              57.4    3e-07   
ref|WP_007044825.1|  sirohydrochlorin cobaltochelatase                56.2    3e-07   
ref|WP_003352908.1|  hypothetical protein                             57.8    3e-07   Bacillus smithii
gb|KHF24626.1|  hypothetical protein JV46_05650                       55.8    3e-07   Solemya velum gill symbiont
ref|WP_027319687.1|  cobalamin biosynthesis protein CbiX              57.4    3e-07   Bacillus sp. URHB0009
ref|WP_043116871.1|  cobalamin biosynthesis protein CbiX              55.8    3e-07   Solemya velum gill symbiont
ref|WP_009673137.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  58.5    3e-07   Paenibacillus
ref|WP_014278563.1|  sirohydrochlorin cobaltochelatase                58.5    3e-07   Paenibacillus terrae
ref|WP_013798434.1|  sirohydrochlorin cobaltochelatase                55.8    4e-07   Methanotorris igneus
ref|WP_014704010.1|  cobalamin biosynthesis protein CbiX              55.5    4e-07   Methylophaga frappieri
ref|NP_001046609.1|  Os02g0296800                                     55.5    4e-07   
ref|WP_035300781.1|  sirohydrochlorin cobaltochelatase                57.8    4e-07   Brevibacillus thermoruber
ref|WP_025908099.1|  sirohydrochlorin ferrochelatase                  57.0    5e-07   Bacillus
ref|WP_007715908.1|  sirohydrochlorin cobaltochelatase                57.8    5e-07   Brevibacillus sp. BC25
ref|WP_004030768.1|  sirohydrochlorin cobaltochelatase                55.5    5e-07   Methanobacterium formicicum
ref|WP_003395469.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  57.4    5e-07   
ref|WP_019688872.1|  sirohydrochlorin cobaltochelatase                57.8    5e-07   Paenibacillus polymyxa
ref|WP_023990791.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  57.8    5e-07   Paenibacillus
ref|WP_034124136.1|  cobalamin biosynthesis protein CbiX              55.1    5e-07   
ref|WP_017428597.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  57.8    5e-07   Paenibacillus
ref|WP_017247390.1|  sirohydrochlorin cobaltochelatase                57.4    6e-07   Brevibacillus brevis
ref|WP_044786211.1|  sirohydrochlorin cobaltochelatase                57.8    6e-07   Paenibacillus polymyxa
ref|WP_016822797.1|  sirohydrochlorin cobaltochelatase                57.8    6e-07   Paenibacillus polymyxa
ref|WP_031462386.1|  sirohydrochlorin cobaltochelatase                57.8    6e-07   Paenibacillus polymyxa
ref|WP_012684974.1|  sirohydrochlorin cobaltochelatase                57.4    6e-07   Brevibacillus brevis
ref|WP_028552448.1|  sirohydrochlorin cobaltochelatase                57.4    6e-07   Paenibacillus sp. UNC451MF
ref|WP_025715977.1|  sirohydrochlorin cobaltochelatase                57.4    7e-07   Paenibacillus sp. 1-18
ref|WP_016741767.1|  sirohydrochlorin cobaltochelatase                57.4    7e-07   Bacillales
ref|WP_015326928.1|  hypothetical protein                             54.7    7e-07   Halobacteroides halobius
ref|WP_002708045.1|  cobalamin biosynthesis protein CbiX              55.1    7e-07   
ref|WP_014706051.1|  cobalamin biosynthesis protein CbiX              54.7    7e-07   Methylophaga nitratireducenticrescens
ref|WP_042233528.1|  sirohydrochlorin cobaltochelatase                57.4    7e-07   Paenibacillus chitinolyticus
ref|WP_005831998.1|  sirohydrochlorin cobaltochelatase                57.0    8e-07   Brevibacillus agri
ref|WP_007785817.1|  sirohydrochlorin cobaltochelatase                57.0    8e-07   Brevibacillus sp. CF112
ref|WP_025847508.1|  sirohydrochlorin cobaltochelatase                57.0    9e-07   Brevibacillus agri
ref|WP_012065982.1|  sirohydrochlorin cobaltochelatase                54.7    9e-07   Methanococcus vannielii
ref|WP_026557944.1|  sirohydrochlorin cobaltochelatase                57.0    9e-07   Bacillus sp. NSP2.1
ref|WP_018154379.1|  sirohydrochlorin cobaltochelatase                54.7    9e-07   
ref|WP_034405951.1|  hypothetical protein                             54.3    9e-07   
ref|WP_015718893.1|  sirohydrochlorin cobaltochelatase                54.3    1e-06   Geobacter sp. M18
ref|WP_007432845.1|  sirohydrochlorin cobaltochelatase                57.0    1e-06   Paenibacillus sp. Aloe-11
ref|WP_027716685.1|  sirohydrochlorin cobaltochelatase                54.3    1e-06   Desulfuromonas sp. TF
ref|WP_020932864.1|  Cobalamin (vitamin B12) biosynthesis CbiX        54.3    1e-06   Cycloclasticus zancles
ref|WP_035665796.1|  sirohydrochlorin cobaltochelatase                56.2    1e-06   Bacillus akibai
ref|WP_043977189.1|  sirohydrochlorin ferrochelatase                  55.8    1e-06   Bacillus megaterium
ref|WP_016765792.1|  sirohydrochlorin ferrochelatase                  55.8    1e-06   Bacillus
ref|WP_033155442.1|  cobalamin biosynthesis protein CbiX              53.9    1e-06   Methylomonas sp. LW13
ref|WP_010347177.1|  sirohydrochlorin cobaltochelatase                56.6    1e-06   Paenibacillus peoriae
ref|WP_013059579.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    55.8    1e-06   Bacillus
gb|KHF30441.1|  Sirohydrochlorin cobaltochelatase                     55.5    1e-06   Anoxybacillus sp. BCO1
ref|WP_042991840.1|  sirohydrochlorin ferrochelatase                  55.8    1e-06   Bacillus megaterium
ref|WP_013414036.1|  sirohydrochlorin cobaltochelatase                54.3    1e-06   Methanothermus fervidus
ref|WP_029097841.1|  sirohydrochlorin cobaltochelatase                56.2    1e-06   Brevibacillus thermoruber
sp|P61817.1|SIRB_BACME  RecName: Full=Sirohydrochlorin ferrochela...  55.8    1e-06   Bacillus megaterium
ref|WP_013085292.1|  sirohydrochlorin ferrochelatase                  55.8    2e-06   Bacillus megaterium
ref|WP_025366059.1|  sirohydrochlorin cobaltochelatase                56.2    2e-06   Paenibacillus polymyxa
ref|WP_023275406.1|  hypothetical protein                             53.5    2e-06   Mucispirillum schaedleri
ref|WP_011735191.1|  sirohydrochlorin cobaltochelatase                53.5    2e-06   Pelobacter propionicus
ref|WP_028409577.1|  sirohydrochlorin ferrochelatase                  55.5    2e-06   Bacillus sp. 171095_106
gb|ACJ34538.1|  Sirohydrochlorin cobaltochelatase (CbiXL)             55.8    2e-06   Anoxybacillus flavithermus WK1
ref|WP_027409804.1|  sirohydrochlorin cobaltochelatase                55.8    2e-06   Anoxybacillus tepidamans
ref|WP_006893616.1|  cobalamin biosynthesis protein CbiX              53.5    2e-06   Methylobacter tundripaludum
ref|WP_041638791.1|  sirohydrochlorin cobaltochelatase                55.5    2e-06   Anoxybacillus flavithermus
dbj|GAC90162.1|  sirohydrochlorin cobaltochelatase CbiXL              55.5    2e-06   Anoxybacillus flavithermus NBRC 109594
ref|WP_043963753.1|  sirohydrochlorin cobaltochelatase                55.5    2e-06   
gb|KIQ95675.1|  Sirohydrochlorin cobaltochelatase                     55.5    2e-06   
ref|WP_026369597.1|  hypothetical protein                             53.5    2e-06   
ref|WP_035019712.1|  sirohydrochlorin cobaltochelatase                55.5    2e-06   
gb|EPZ39496.1|  Sirohydrochlorin cobaltochelatase (CbiXL)             55.5    2e-06   
ref|WP_026582457.1|  sirohydrochlorin cobaltochelatase                55.5    2e-06   
ref|WP_033580478.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    55.1    2e-06   
ref|WP_035062928.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  55.5    2e-06   
ref|WP_032100806.1|  sirohydrochlorin cobaltochelatase                55.5    2e-06   
ref|WP_028412599.1|  sirohydrochlorin ferrochelatase                  55.1    3e-06   
ref|WP_038091833.1|  sirohydrochlorin cobaltochelatase                55.5    3e-06   
ref|WP_038541467.1|  cobalamin biosynthesis protein CbiX              54.7    3e-06   
ref|WP_015592227.1|  sirohydrochlorin cobaltochelatase                55.5    3e-06   
ref|WP_041068879.1|  hypothetical protein                             53.1    3e-06   
ref|WP_028403310.1|  sirohydrochlorin cobaltochelatase                55.5    3e-06   
gb|EMS61947.1|  Sirohydrochlorin ferrochelatase                       52.8    3e-06   
ref|WP_013100678.1|  sirohydrochlorin cobaltochelatase                53.1    3e-06   
ref|WP_036939047.1|  cobalamin biosynthesis protein CbiX              53.1    3e-06   
ref|WP_033287078.1|  cobalamin biosynthesis protein CbiX              55.5    3e-06   
ref|WP_035329920.1|  cobalamin biosynthesis protein CbiX              54.7    3e-06   
ref|WP_019067380.1|  cobalamin biosynthesis protein CbiX              55.5    3e-06   
gb|EMS54863.1|  Sirohydrochlorin ferrochelatase                       52.8    3e-06   
ref|WP_019060629.1|  cobalamin biosynthesis protein CbiX              55.5    3e-06   
ref|WP_043685217.1|  cobalamin biosynthesis protein CbiX              55.1    3e-06   
ref|WP_022628363.1|  hypothetical protein                             55.1    3e-06   
ref|WP_025853113.1|  sirohydrochlorin cobaltochelatase                55.5    3e-06   
gb|EMT14170.1|  Sirohydrochlorin ferrochelatase                       52.4    3e-06   
ref|WP_003388113.1|  sirohydrochlorin cobaltochelatase                55.1    3e-06   
ref|WP_028842031.1|  hypothetical protein                             52.8    4e-06   
ref|WP_031932191.1|  sirohydrochlorin cobaltochelatase                55.1    4e-06   
ref|WP_024983474.1|  sirohydrochlorin cobaltochelatase                55.1    4e-06   
ref|WP_007145131.1|  cobalamin biosynthesis protein CbiX              52.8    4e-06   
ref|WP_040205392.1|  MULTISPECIES: hypothetical protein               54.3    4e-06   
ref|WP_039070784.1|  sirohydrochlorin cobaltochelatase                55.1    4e-06   
ref|WP_016402103.1|  hypothetical protein                             52.4    4e-06   
ref|WP_012546612.1|  sirohydrochlorin cobaltochelatase                52.8    4e-06   
ref|WP_026674981.1|  sirohydrochlorin cobaltochelatase                54.7    4e-06   
ref|WP_039793444.1|  sirohydrochlorin cobaltochelatase                54.7    4e-06   
ref|WP_031405718.1|  sirohydrochlorin ferrochelatase                  54.3    4e-06   
ref|WP_041050733.1|  sirohydrochlorin cobaltochelatase                55.1    4e-06   
ref|WP_013075784.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  52.4    5e-06   
ref|WP_010788565.1|  Sirohydrochlorin ferrochelatase                  54.3    5e-06   
ref|WP_013643784.1|  sirohydrochlorin cobaltochelatase                52.8    5e-06   
ref|WP_025752730.1|  sirohydrochlorin ferrochelatase                  54.3    5e-06   
ref|WP_015005472.1|  MULTISPECIES: cobalamin biosynthesis protein...  52.4    5e-06   
ref|WP_011977540.1|  sirohydrochlorin cobaltochelatase                52.4    6e-06   
ref|WP_007506469.1|  sirohydrochlorin cobaltochelatase                54.3    6e-06   
ref|WP_026011727.1|  MULTISPECIES: sirohydrochlorin cobaltochelatase  54.3    6e-06   
ref|WP_007083674.1|  sirohydrochlorin ferrochelatase                  53.9    6e-06   
ref|WP_006600017.1|  colbalt chelase thioredoxin                      54.7    6e-06   
ref|WP_033020593.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    53.9    7e-06   
gb|EMT15526.1|  Sirohydrochlorin ferrochelatase                       52.0    7e-06   
ref|WP_036687663.1|  sirohydrochlorin cobaltochelatase                54.3    7e-06   
ref|WP_010037822.1|  cobalamin biosynthesis protein CbiX              54.3    7e-06   
ref|WP_008606661.1|  colbalt chelase thioredoxin                      54.3    7e-06   
ref|WP_004572755.1|  colbalt chelase thioredoxin                      54.3    8e-06   
ref|WP_013563872.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  52.0    8e-06   
ref|WP_025700843.1|  sirohydrochlorin cobaltochelatase                53.9    8e-06   
ref|WP_014956262.1|  sirohydrochlorin cobaltochelatase CbiX           51.6    8e-06   
ref|WP_028396246.1|  sirohydrochlorin ferrochelatase                  53.5    8e-06   
ref|WP_014254984.1|  cobalamin biosynthesis protein CbiX [            51.6    8e-06   
ref|WP_011974089.1|  sirohydrochlorin cobaltochelatase                52.0    8e-06   
ref|WP_035102093.1|  sirohydrochlorin cobaltochelatase                53.9    8e-06   
ref|WP_006524556.1|  cobalamin biosynthesis protein CbiX              51.6    1e-05   
emb|CEG32767.1|  sirohydrochlorin ferrochelatase                      53.5    1e-05   
ref|WP_044644390.1|  sirohydrochlorin cobaltochelatase                53.9    1e-05   
gb|EHN12368.1|  ATPase component NikO of energizing module of nic...  54.3    1e-05   
ref|WP_026591274.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
ref|WP_012193495.1|  sirohydrochlorin cobaltochelatase                51.6    1e-05   
ref|WP_025682314.1|  sirohydrochlorin cobaltochelatase                53.9    1e-05   
ref|WP_014968621.1|  cobalamin (vitamin B12) biosynthesis protein...  51.2    1e-05   
ref|WP_037743713.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
ref|WP_037756943.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
ref|WP_031118892.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
ref|WP_033310890.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
ref|WP_004968498.1|  colbalt chelase thioredoxin                      53.9    1e-05   
ref|WP_034409739.1|  cobalamin biosynthesis protein CbiX              51.2    1e-05   
ref|WP_031111344.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
gb|EMT21287.1|  Sirohydrochlorin ferrochelatase                       50.4    1e-05   
ref|WP_031477297.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
ref|WP_006143392.1|  cobalamin biosynthesis protein CbiX              53.5    1e-05   
ref|WP_026585256.1|  cobalamin biosynthesis protein CbiX              53.1    1e-05   
ref|WP_006562971.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  53.1    1e-05   
ref|WP_044743448.1|  sirohydrochlorin cobaltochelatase                53.1    1e-05   
ref|WP_006094168.1|  MULTISPECIES: cobalamin biosynthesis protein...  52.8    1e-05   
ref|WP_026573746.1|  cobalamin biosynthesis protein CbiX              52.8    1e-05   
ref|WP_003206312.1|  cobalamin biosynthesis protein CbiX              52.8    1e-05   
ref|WP_034132770.1|  hypothetical protein                             50.8    1e-05   
ref|WP_018764223.1|  cobalamin biosynthesis protein CbiX              52.8    1e-05   
ref|WP_042664703.1|  ferredoxin                                       53.5    2e-05   
ref|WP_014793154.1|  MULTISPECIES: cobalamin biosynthesis protein...  50.8    2e-05   
ref|WP_025671924.1|  hypothetical protein                             51.2    2e-05   
ref|WP_035194977.1|  sirohydrochlorin cobaltochelatase                53.1    2e-05   
ref|WP_003196216.1|  cobalamin biosynthesis protein CbiX              52.8    2e-05   
ref|WP_033671030.1|  cobalamin biosynthesis protein CbiX              52.8    2e-05   
ref|XP_002292960.1|  predicted protein                                53.5    2e-05   
ref|WP_008097012.1|  colbalt chelase thioredoxin                      53.5    2e-05   
ref|WP_022967393.1|  cobalamin biosynthesis protein CbiX              50.8    2e-05   
ref|WP_010987805.1|  cobalamin biosynthesis protein CbiX              53.1    2e-05   
ref|WP_026559411.1|  hypothetical protein                             52.8    2e-05   
ref|WP_025025664.1|  sirohydrochlorin cobaltochelatase                53.1    2e-05   
emb|CAJ74655.1|  conserved hypothetical protein                       53.1    2e-05   
ref|WP_007201273.1|  sirohydrochlorin cobaltochelatase                52.8    2e-05   
ref|WP_004041100.1|  ferredoxin                                       53.1    2e-05   
ref|WP_004624440.1|  MULTISPECIES: cobalamin (vitamin B12) biosyn...  50.4    2e-05   
ref|WP_000648895.1|  cobalamin biosynthesis protein CbiX              52.4    2e-05   
ref|WP_015593409.1|  sirohydrochlorin ferrochelatase                  52.4    2e-05   
ref|WP_035350149.1|  sirohydrochlorin ferrochelatase                  52.4    2e-05   
ref|WP_039230896.1|  hypothetical protein                             52.4    2e-05   
ref|WP_023555957.1|  sirohydrochlorin cobaltochelatase                52.8    2e-05   
ref|WP_010897661.1|  hypothetical protein                             52.8    2e-05   
ref|WP_029192916.1|  sirohydrochlorin cobaltochelatase                52.8    2e-05   
ref|WP_026964975.1|  hypothetical protein                             52.8    2e-05   
ref|WP_043063649.1|  sirohydrochlorin cobaltochelatase                52.8    2e-05   
ref|WP_003329007.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    52.4    2e-05   
ref|WP_016482666.1|  hypothetical protein                             50.4    2e-05   
ref|WP_009623864.1|  cobalamin biosynthesis protein CbiX              50.4    2e-05   
ref|WP_019391267.1|  sirohydrochlorin cobaltochelatase                52.8    2e-05   
ref|WP_031142787.1|  cobalamin biosynthesis protein CbiX              52.8    2e-05   
ref|WP_035435249.1|  cobalamin biosynthesis protein CbiX              52.4    3e-05   
ref|WP_013920497.1|  sirohydrochlorin cobaltochelatase                52.8    3e-05   
ref|WP_013986294.1|  sirohydrochlorin cobaltochelatase                52.4    3e-05   
ref|WP_010632624.1|  ferrochelatase                                   52.4    3e-05   
ref|WP_014372190.1|  sirohydrochlorin cobaltochelatase                52.8    3e-05   
ref|WP_020028218.1|  hypothetical protein                             50.4    3e-05   
ref|WP_030852460.1|  cobalamin biosynthesis protein CbiX              52.4    3e-05   
ref|WP_040056892.1|  sirohydrochlorin cobaltochelatase                52.4    3e-05   
ref|WP_043069346.1|  sirohydrochlorin cobaltochelatase                52.4    3e-05   
ref|WP_028803342.1|  cobalamin biosynthesis protein CbiX              52.4    3e-05   
ref|WP_014652696.1|  sirohydrochlorin cobaltochelatase                52.4    3e-05   
ref|WP_013111156.1|  cobalamin biosynthesis protein CbiX              50.4    3e-05   
ref|WP_028394278.1|  sirohydrochlorin cobaltochelatase                52.4    3e-05   
ref|WP_006715202.1|  cobalamin biosynthesis protein CbiX              50.1    3e-05   
ref|WP_030248724.1|  MULTISPECIES: cobalamin biosynthesis protein...  52.4    3e-05   
ref|WP_009793607.1|  MULTISPECIES: cobalamin biosynthesis protein...  52.0    3e-05   
ref|WP_003332155.1|  sirohydrochlorin cobaltochelatase                52.4    3e-05   
ref|WP_020026479.1|  hypothetical protein                             50.1    3e-05   
ref|WP_033317812.1|  cobalamin biosynthesis protein CbiX              52.4    3e-05   
emb|CEO90272.1|  Cobalamin (vitamin B12) biosynthesis CobH/CbiC, ...  52.4    3e-05   
ref|WP_018923116.1|  hypothetical protein                             52.0    3e-05   
ref|WP_030954992.1|  cobalamin biosynthesis protein CbiX              52.4    3e-05   
ref|WP_028828771.1|  cobalamin biosynthesis protein CbiX              50.1    3e-05   
ref|WP_023542581.1|  cobalamin biosynthesis protein CbiX              52.0    4e-05   
ref|WP_026693481.1|  cobalamin biosynthesis protein CbiX              51.6    4e-05   
ref|WP_030612435.1|  cobalamin biosynthesis protein CbiX              52.0    4e-05   
ref|WP_031537983.1|  cobalamin biosynthesis protein CbiX              51.6    4e-05   
ref|WP_033101532.1|  sirohydrochlorin cobaltochelatase                51.6    4e-05   
ref|WP_034611392.1|  cobalamin biosynthesis protein CbiX              49.7    4e-05   
ref|WP_013177407.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  51.6    4e-05   
ref|WP_031043985.1|  cobalamin biosynthesis protein CbiX              52.0    4e-05   
ref|WP_027140169.1|  cobalamin biosynthesis protein CbiX              49.7    4e-05   
ref|WP_034306931.1|  sirohydrochlorin ferrochelatase                  51.6    4e-05   
ref|WP_030378980.1|  MULTISPECIES: cobalamin biosynthesis protein...  52.0    4e-05   
ref|WP_033398315.1|  cobalamin biosynthesis protein CbiX              49.7    5e-05   
ref|WP_030960334.1|  cobalamin biosynthesis protein CbiX              51.6    5e-05   
ref|WP_003349638.1|  sirohydrochlorin ferrochelatase                  51.6    5e-05   
ref|WP_043439183.1|  cobalamin biosynthesis protein CbiX              51.6    5e-05   
ref|WP_043903524.1|  sirohydrochlorin ferrochelatase                  51.2    5e-05   
ref|WP_004029385.1|  sirohydrochlorin cobaltochelatase                49.7    5e-05   
gb|ACU90784.1|  cobalamin (vitamin B12) biosynthesis CbiX protein     49.3    5e-05   
ref|WP_012860466.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  49.3    6e-05   
ref|WP_011689108.1|  cobalamin (vitamin B12) biosynthesis CbiX pr...  49.3    6e-05   
ref|WP_007497792.1|  cobalamin biosynthesis protein CbiX              51.6    6e-05   
ref|WP_003351041.1|  sirohydrochlorin ferrochelatase                  51.2    6e-05   
ref|WP_034602407.1|  cobalamin biosynthesis protein CbiX              49.3    6e-05   
ref|WP_037623802.1|  cobalamin biosynthesis protein CbiX              51.6    6e-05   
ref|WP_020939231.1|  metal binding protein                            51.6    6e-05   
ref|WP_035046226.1|  sirohydrochlorin cobaltochelatase                51.2    6e-05   
ref|WP_044415002.1|  hypothetical protein                             49.3    6e-05   
ref|WP_017298202.1|  hypothetical protein                             51.6    6e-05   
ref|WP_000648892.1|  cobalamin biosynthesis protein CbiX              51.2    6e-05   
ref|WP_042463964.1|  cobalamin biosynthesis protein CbiX              51.2    6e-05   
ref|WP_026674977.1|  hypothetical protein                             51.2    6e-05   
ref|WP_018884068.1|  hypothetical protein                             51.6    7e-05   
ref|WP_000648882.1|  cobalamin biosynthesis protein CbiX              50.8    7e-05   
ref|WP_025680727.1|  sirohydrochlorin cobaltochelatase                51.6    7e-05   
ref|WP_014903046.1|  cobalamin biosynthesis protein CbiX              48.9    7e-05   
ref|WP_005959738.1|  MULTISPECIES: cobalamin biosynthesis protein...  49.3    7e-05   
ref|WP_003989357.1|  cobalamin biosynthesis protein CbiX              51.2    7e-05   
ref|WP_011170108.1|  sirohydrochlorin cobaltochelatase                49.3    7e-05   
ref|WP_004002258.1|  putative Metal binding protein                   51.2    7e-05   
ref|WP_007274208.1|  colbalt chelase thioredoxin                      51.2    8e-05   
ref|WP_010355563.1|  cobalamin biosynthesis protein CbiX              51.2    8e-05   
dbj|BAP60286.1|  sirohydrochlorin cobaltochelatase                    49.3    8e-05   
ref|WP_000648879.1|  MULTISPECIES: cobalamin biosynthesis protein...  50.8    8e-05   
ref|WP_016204101.1|  hypothetical protein                             50.8    8e-05   
ref|WP_004972139.1|  colbalt chelase thioredoxin                      51.2    8e-05   
ref|WP_008573109.1|  MULTISPECIES: colbalt chelase thioredoxin        51.2    8e-05   
ref|WP_029127574.1|  uroporphyrin-III methyltransferase               51.2    8e-05   
ref|WP_024716106.1|  sirohydrochlorin ferrochelatase                  50.8    8e-05   
ref|WP_035985965.1|  sirohydrochlorin cobaltochelatase                51.2    8e-05   
ref|WP_028996775.1|  cobalamin biosynthesis protein CbiX              50.8    8e-05   
ref|WP_007699642.1|  hypothetical protein                             51.2    8e-05   
ref|WP_027639839.1|  cobalamin biosynthesis protein CbiX              48.9    9e-05   
ref|WP_003976961.1|  MULTISPECIES: cobalamin biosynthesis protein...  50.8    9e-05   
ref|WP_011869257.1|  sirohydrochlorin cobaltochelatase                49.3    9e-05   
ref|WP_015661374.1|  metal binding protein                            50.8    9e-05   
ref|WP_011028014.1|  cobalamin biosynthesis protein CbiX              50.8    9e-05   
ref|WP_017152594.1|  cobalamin biosynthesis protein CbiX              50.8    9e-05   
ref|WP_013352206.1|  MULTISPECIES: sirohydrochlorin ferrochelatase    50.8    9e-05   
ref|WP_035712578.1|  hypothetical protein                             50.8    9e-05   
ref|WP_019258361.1|  sirohydrochlorin ferrochelatase                  50.8    9e-05   
ref|WP_003238637.1|  sirohydrochlorin ferrochelatase                  50.8    9e-05   
ref|WP_000648886.1|  CbiX domain-containing protein                   50.4    1e-04   
ref|WP_000648885.1|  MULTISPECIES: cobalamin biosynthesis protein...  50.4    1e-04   
ref|WP_020140775.1|  cobalamin biosynthesis protein CbiX              50.8    1e-04   
ref|WP_044445177.1|  sirohydrochlorin ferrochelatase                  50.8    1e-04   
ref|WP_044428010.1|  sirohydrochlorin ferrochelatase                  50.8    1e-04   
ref|WP_018567673.1|  cobalamin biosynthesis protein CbiX              50.8    1e-04   
ref|WP_035661689.1|  hypothetical protein                             50.8    1e-04   
ref|WP_008289964.1|  cobalamin biosynthesis protein CbiX              48.5    1e-04   
ref|WP_016117472.1|  CbiX protein                                     50.4    1e-04   
ref|WP_000648883.1|  MULTISPECIES: cobalamin biosynthesis protein...  50.4    1e-04   
ref|WP_041337938.1|  sirohydrochlorin ferrochelatase                  50.4    1e-04   
ref|WP_015715865.1|  sirohydrochlorin ferrochelatase                  50.4    1e-04   
ref|WP_039655314.1|  MULTISPECIES: cobalamin biosynthesis protein...  50.8    1e-04   
ref|WP_015252119.1|  sirohydrochlorin ferrochelatase                  50.4    1e-04   
ref|WP_030318446.1|  cobalamin biosynthesis protein CbiX              50.8    1e-04   
ref|WP_000648891.1|  cobalamin biosynthesis protein CbiX              50.4    1e-04   
ref|WP_042206096.1|  sirohydrochlorin cobaltochelatase                50.8    1e-04   
ref|WP_042975742.1|  sirohydrochlorin ferrochelatase                  50.4    1e-04   



>gb|EYU44776.1| hypothetical protein MIMGU_mgv1a015745mg [Erythranthe guttata]
Length=147

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +3

Query  135  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRR  311
             R+   AI  FVK+ + PSK+ Y   RLCLA ANGG FR  +N + VGDGVIIVDHGSRR
Sbjct  28   ARSPNFAIHQFVKLHRDPSKSKYSPSRLCLASANGGGFRKVQNGVDVGDGVIIVDHGSRR  87

Query  312  KESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            KESNLMLNEFVAMF+EKTKYPIVEPAHMELAEPSIKDAFN+CVQQGA+R+IVSPFFLF
Sbjct  88   KESNLMLNEFVAMFREKTKYPIVEPAHMELAEPSIKDAFNSCVQQGAKRVIVSPFFLF  145



>ref|XP_009631034.1| PREDICTED: uncharacterized protein LOC104120867 [Nicotiana tomentosiformis]
Length=206

 Score =   168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 3/111 (3%)
 Frame = +3

Query  150  GAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLM  329
             A+P+FVK+ K PSK+ YL  R C+A  N   R E N I+ GDGVIIVDHGSRRKESNLM
Sbjct  26   SAVPEFVKLHKGPSKSRYLPQRYCMATTN---REELNGIEEGDGVIIVDHGSRRKESNLM  82

Query  330  LNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            LNEFVAMF+++TKYPIVEPAHMELAEPSI+DAFN CVQ+GARR+IVSPFFL
Sbjct  83   LNEFVAMFRQRTKYPIVEPAHMELAEPSIRDAFNLCVQRGARRVIVSPFFL  133



>ref|XP_011098442.1| PREDICTED: uncharacterized protein LOC105177107 isoform X3 [Sesamum 
indicum]
Length=208

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  156  IPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            IP FVK+   P KT YL+ R C A ANGG FR E   +  GD VIIVDHGSRR +SNLML
Sbjct  26   IPGFVKLPGDPFKTKYLSSRFCFATANGGGFRKELKGVGRGDAVIIVDHGSRRNDSNLML  85

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            NEFV MF+EKTKYPIVEPAHMELAEPSIKDAF++CVQQGA+R+IVSPFFLF
Sbjct  86   NEFVVMFREKTKYPIVEPAHMELAEPSIKDAFSSCVQQGAQRVIVSPFFLF  136



>ref|XP_011098440.1| PREDICTED: uncharacterized protein LOC105177107 isoform X1 [Sesamum 
indicum]
Length=213

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  156  IPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            IP FVK+   P KT YL+ R C A ANGG FR E   +  GD VIIVDHGSRR +SNLML
Sbjct  31   IPGFVKLPGDPFKTKYLSSRFCFATANGGGFRKELKGVGRGDAVIIVDHGSRRNDSNLML  90

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            NEFV MF+EKTKYPIVEPAHMELAEPSIKDAF++CVQQGA+R+IVSPFFLF
Sbjct  91   NEFVVMFREKTKYPIVEPAHMELAEPSIKDAFSSCVQQGAQRVIVSPFFLF  141



>ref|XP_011098441.1| PREDICTED: uncharacterized protein LOC105177107 isoform X2 [Sesamum 
indicum]
Length=209

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  156  IPDFVKVRKFPSKTGYLAPRLCLAIANGG-FRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            IP FVK+   P KT YL+ R C A ANGG FR E   +  GD VIIVDHGSRR +SNLML
Sbjct  27   IPGFVKLPGDPFKTKYLSSRFCFATANGGGFRKELKGVGRGDAVIIVDHGSRRNDSNLML  86

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            NEFV MF+EKTKYPIVEPAHMELAEPSIKDAF++CVQQGA+R+IVSPFFLF
Sbjct  87   NEFVVMFREKTKYPIVEPAHMELAEPSIKDAFSSCVQQGAQRVIVSPFFLF  137



>ref|XP_009785949.1| PREDICTED: uncharacterized protein LOC104234139 [Nicotiana sylvestris]
Length=206

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+P+FV++ K PSK+ YL  R C+A A+   R   N I  GDGVIIVDHGSRR ESNLML
Sbjct  27   AVPEFVRLHKGPSKSRYLPQRYCMATAS---REGLNGIGEGDGVIIVDHGSRRNESNLML  83

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            NEFVAMF+E+TKYPIVEPAHMELAEPSI+DAF+ CVQ+GARR+IVSPFFL
Sbjct  84   NEFVAMFRERTKYPIVEPAHMELAEPSIRDAFSLCVQRGARRVIVSPFFL  133



>ref|XP_004232317.1| PREDICTED: uncharacterized protein LOC101257032 [Solanum lycopersicum]
Length=206

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 94/111 (85%), Gaps = 5/111 (5%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIAN-GGFRGERNCIKVGDGVIIVDHGSRRKESNLM  329
            A+P+FVK+ K PSK+ YL  R C+A ++  G +G    I+ GDGVIIVDHGSRRKESNLM
Sbjct  27   AVPEFVKLLKGPSKSRYLPQRYCMATSSREGLKG----IEEGDGVIIVDHGSRRKESNLM  82

Query  330  LNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            LN FVAMF+E+TKYPIVEPAHMELAEPSI+DAF+ CVQQGARR+IVSPFFL
Sbjct  83   LNGFVAMFRERTKYPIVEPAHMELAEPSIRDAFSLCVQQGARRVIVSPFFL  133



>ref|XP_006338587.1| PREDICTED: uncharacterized protein LOC102599852 [Solanum tuberosum]
Length=206

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 3/110 (3%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+P+FVK+ K PSK+ YL  R  +A ++   R   N I+ GDGVIIVDHGSRRKESNLML
Sbjct  27   AVPEFVKLHKGPSKSRYLPQRYRMAASS---REGLNGIEEGDGVIIVDHGSRRKESNLML  83

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            NEFVAMF+E+TKYPIVEPAHMELAEPSI+DAF+ CVQQGARR+IVSPFFL
Sbjct  84   NEFVAMFRERTKYPIVEPAHMELAEPSIRDAFSLCVQQGARRVIVSPFFL  133



>emb|CDP02082.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  135  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            GR H  A   FVKV + P    Y+  + CLA A GGF      +  GDGVIIVDHGSRRK
Sbjct  22   GRNHGRAASGFVKVPQKPWHRRYVGTQPCLATARGGFSQGLPGVGDGDGVIIVDHGSRRK  81

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ESNLML+EFV MF+EKTKYPIVEPAHMELAEPSIK+AF++CVQ+GARRI+VSPFFLF
Sbjct  82   ESNLMLSEFVTMFKEKTKYPIVEPAHMELAEPSIKNAFSSCVQKGARRIVVSPFFLF  138



>ref|XP_009377185.1| PREDICTED: uncharacterized protein LOC103965821 [Pyrus x bretschneideri]
Length=210

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+ +F  +R+ PS++  L+ RLC+   NGGF    + +   DGVIIVDHGSRRKESNLML
Sbjct  29   AVLNFSNLRRGPSRSRNLSLRLCMGSGNGGFGQNPHGVGDKDGVIIVDHGSRRKESNLML  88

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            NEFV+MF+E+T YPIVEPAHMELAEPSI+DAFN+CV+QGA R+IVSPFFL 
Sbjct  89   NEFVSMFRERTGYPIVEPAHMELAEPSIRDAFNSCVEQGADRVIVSPFFLL  139



>ref|XP_002524661.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis]
 gb|EEF37680.1| sirohydrochlorin ferrochelatase, putative [Ricinus communis]
Length=210

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +3

Query  135  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            G +++   P F K    PSKT YL+ R+ L+ AN GF      I   DG+IIVDHGSRRK
Sbjct  25   GASYKWTQPAFAKFPTCPSKTKYLSSRMYLSTANSGFT--DGIIGDEDGLIIVDHGSRRK  82

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ESNLMLNEFV MF+++T YPIVEPAHMELAEPSIKDAF  CVQQGA R+IVSPFFLF
Sbjct  83   ESNLMLNEFVNMFRDRTGYPIVEPAHMELAEPSIKDAFGLCVQQGANRVIVSPFFLF  139



>gb|KDP45322.1| hypothetical protein JCGZ_09571 [Jatropha curcas]
Length=210

 Score =   152 bits (385),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P F K+   P KT Y + RLCL   NG      + ++  DG+IIVDHGSRRKESNLMLNE
Sbjct  31   PKFSKLPGVPCKTKYSSTRLCLRTGNGEITKNAHGVRERDGLIIVDHGSRRKESNLMLNE  90

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF++K+ YPIVEPAHMELAEPSIKDAF  CVQQGA R+IVSPFFLF
Sbjct  91   FVAMFRDKSGYPIVEPAHMELAEPSIKDAFGLCVQQGANRVIVSPFFLF  139



>ref|XP_010251141.1| PREDICTED: uncharacterized protein LOC104593131 isoform X1 [Nelumbo 
nucifera]
Length=210

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  RGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNL  326
            R A P FVK+ +  +K+  L+    L   N GF  E++ +   DGVIIVDHGSRR+ESNL
Sbjct  26   RWASPKFVKLPRISAKSRPLSKTFSLTAENNGFSLEKHGVSDRDGVIIVDHGSRRQESNL  85

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            MLNEFV MF+++T YPIVEPAHMELAEPSIKDAFN CVQQGA R+IVSPFFLF
Sbjct  86   MLNEFVKMFRDRTGYPIVEPAHMELAEPSIKDAFNLCVQQGANRVIVSPFFLF  138



>ref|XP_008357734.1| PREDICTED: uncharacterized protein LOC103421473 [Malus domestica]
Length=210

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+ +F  +++ PS++G L  RLC+  A+GGF    + +  GDGVIIVDHGSRRKESNLML
Sbjct  29   AVLNFSNLQRGPSRSGNLIIRLCMGSADGGFGRNPHGVCDGDGVIIVDHGSRRKESNLML  88

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            NEFV+MF+E+T YPIVE AHMELAEPSI+DAF++CV+QGA R++VSPFFL
Sbjct  89   NEFVSMFRERTGYPIVEAAHMELAEPSIRDAFSSCVEQGANRVVVSPFFL  138



>ref|XP_002273543.1| PREDICTED: uncharacterized protein LOC100244073 [Vitis vinifera]
Length=208

 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +3

Query  135  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            G   +  +P+FVK+++    + YL  + CLA  NGG   + N +   DGVIIVDHGSRRK
Sbjct  21   GTNPKWVLPNFVKLQRSWKNSRYLPTKGCLAAGNGGLGQQTNGVGDKDGVIIVDHGSRRK  80

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ESNLMLNEFV MF++KT Y IVEPAHMELAEPSI +AF++CVQQGA R+IVSPFFLF
Sbjct  81   ESNLMLNEFVTMFRDKTGYLIVEPAHMELAEPSITNAFSSCVQQGANRVIVSPFFLF  137



>ref|XP_008341717.1| PREDICTED: uncharacterized protein LOC103404567 [Malus domestica]
Length=247

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+  F  +++ PS++  L+ RLC+   NGGF      +   DGVIIVDHGSRRKESNLML
Sbjct  66   AVLSFSNLQRGPSRSRNLSFRLCMGSGNGGFGQNPRGVGDKDGVIIVDHGSRRKESNLML  125

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            NEFV+MF+E+T YPIVEPAHMEL EPSI DAFN+CV+QGA R+IVSPFFL 
Sbjct  126  NEFVSMFRERTGYPIVEPAHMELXEPSIXDAFNSCVEQGANRVIVSPFFLL  176



>ref|XP_003524552.1| PREDICTED: uncharacterized protein LOC100500125 isoform X1 [Glycine 
max]
 ref|XP_006579770.1| PREDICTED: uncharacterized protein LOC100500125 isoform X2 [Glycine 
max]
 ref|XP_006579771.1| PREDICTED: uncharacterized protein LOC100500125 isoform X3 [Glycine 
max]
Length=211

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  150  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            G  P +V ++   S      PR     LCL+  NGGFR     + +GD VIIVDHGSRRK
Sbjct  24   GTNPSWVPLKSLNSLCCSSKPRNLCRFLCLSTQNGGFRENSGEVGLGDAVIIVDHGSRRK  83

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            ESNLMLNEFV MF+ KT Y IVEPAHMELAEPSI+DAF +CV+QGA RIIVSPFFL
Sbjct  84   ESNLMLNEFVEMFKHKTGYEIVEPAHMELAEPSIRDAFQSCVEQGAHRIIVSPFFL  139



>gb|KHN27452.1| Sirohydrochlorin ferrochelatase [Glycine soja]
Length=211

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  150  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            G  P +V ++   S      PR     LCL+  NGGFR     + +GD VIIVDHGSRRK
Sbjct  24   GTNPSWVPLKSLNSLCCSSKPRKLCRFLCLSTQNGGFRENSGEVGLGDAVIIVDHGSRRK  83

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            ESNLMLNEFV MF+ KT Y IVEPAHMELAEPSI+DAF +CV+QGA RIIVSPFFL
Sbjct  84   ESNLMLNEFVEMFKHKTGYEIVEPAHMELAEPSIRDAFQSCVEQGAHRIIVSPFFL  139



>ref|XP_009334112.1| PREDICTED: uncharacterized protein LOC103926952 [Pyrus x bretschneideri]
Length=220

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+ +F  +++ PS+ G L+ RLC   ANGGF    + +  GDGVIIVDHGSRRKESNLML
Sbjct  29   AVLNFSNLQRGPSRNGNLSRRLCRGSANGGFGQNPHGVCDGDGVIIVDHGSRRKESNLML  88

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            NEFV+MF+E+T YP+V  AHMELAEPSI+DAF++CV+QGA R++VS FFL
Sbjct  89   NEFVSMFRERTGYPVVVAAHMELAEPSIRDAFSSCVEQGANRVVVSLFFL  138



>ref|XP_006579772.1| PREDICTED: uncharacterized protein LOC100500125 isoform X4 [Glycine 
max]
 ref|XP_006579773.1| PREDICTED: uncharacterized protein LOC100500125 isoform X5 [Glycine 
max]
Length=206

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  150  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            G  P +V ++   S      PR     LCL+  NGGFR     + +GD VIIVDHGSRRK
Sbjct  19   GTNPSWVPLKSLNSLCCSSKPRNLCRFLCLSTQNGGFRENSGEVGLGDAVIIVDHGSRRK  78

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            ESNLMLNEFV MF+ KT Y IVEPAHMELAEPSI+DAF +CV+QGA RIIVSPFFL
Sbjct  79   ESNLMLNEFVEMFKHKTGYEIVEPAHMELAEPSIRDAFQSCVEQGAHRIIVSPFFL  134



>gb|KHG13683.1| Sirohydrochlorin ferrochelatase [Gossypium arboreum]
Length=219

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  KVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAM  350
            K ++ PS+    + +  L   NGGF+   N +   DGVIIVDHGSRRKESNLMLNEFVAM
Sbjct  36   KFQRGPSRIRSFSAKSSLGFENGGFKQVPNGVGEKDGVIIVDHGSRRKESNLMLNEFVAM  95

Query  351  FQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            F+EK+ YPIVEPAHMELAEPSIKDAF  CVQ+GA R+IVSPFFLF
Sbjct  96   FREKSGYPIVEPAHMELAEPSIKDAFGLCVQRGANRVIVSPFFLF  140



>gb|KJB11537.1| hypothetical protein B456_001G264200 [Gossypium raimondii]
Length=219

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  KVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAM  350
            K +  PS+    + +  L   NGGF+   N +   DGVIIVDHGSRRKESNLMLNEFVAM
Sbjct  36   KFQTGPSRIRNFSAKSSLGFENGGFKQFPNGVGEKDGVIIVDHGSRRKESNLMLNEFVAM  95

Query  351  FQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            F+EK+ YPIVEPAHMELAEPSIKDAF  CVQ+GA R+IVSPFFLF
Sbjct  96   FREKSGYPIVEPAHMELAEPSIKDAFGLCVQRGANRVIVSPFFLF  140



>ref|XP_008230561.1| PREDICTED: uncharacterized protein LOC103329819 [Prunus mume]
Length=203

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  213  RLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAH  392
            RLC+   NGGF    N +   DGVIIVDHGSRRKESNLMLNEFV+MF+E+T YPIVEPAH
Sbjct  42   RLCMGSGNGGFGQNPNGVGDRDGVIIVDHGSRRKESNLMLNEFVSMFKERTGYPIVEPAH  101

Query  393  MELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            MELAEPSI  AFN+CV QGA R+IVSPFFLF
Sbjct  102  MELAEPSIHVAFNSCVLQGANRVIVSPFFLF  132



>ref|XP_007151006.1| hypothetical protein PHAVU_004G0108001g, partial [Phaseolus vulgaris]
 gb|ESW23000.1| hypothetical protein PHAVU_004G0108001g, partial [Phaseolus vulgaris]
Length=143

 Score =   138 bits (348),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  189  SKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTK  368
            SK+  L+  LCL+  NG FR     +  GD VIIVDHGSRRKESN MLN+FV MF+ KT 
Sbjct  38   SKSRNLSGFLCLSAQNGSFRENSGEVGHGDAVIIVDHGSRRKESNFMLNDFVKMFKYKTG  97

Query  369  YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            Y IVEPAHMELAEPSI+DAF +CVQQGA RIIVSPFFL
Sbjct  98   YEIVEPAHMELAEPSIRDAFQSCVQQGANRIIVSPFFL  135



>ref|XP_007031548.1| Sirohydrochlorin ferrochelatase B [Theobroma cacao]
 gb|EOY02474.1| Sirohydrochlorin ferrochelatase B [Theobroma cacao]
Length=210

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +3

Query  162  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEF  341
            DF +V   P K+   + R  L+  NGG++   N +   DGVIIVDHGSRR+ESNLMLNEF
Sbjct  35   DFQRV---PPKSRNFSARSSLSFENGGYKQFPNGVGAKDGVIIVDHGSRRRESNLMLNEF  91

Query  342  VAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            VAMF++KT Y IVEPAHMELAEPSI+DAF  CVQ+GA R+IVSPFFLF
Sbjct  92   VAMFRDKTGYQIVEPAHMELAEPSIRDAFGLCVQRGANRVIVSPFFLF  139



>ref|XP_010093442.1| Sirohydrochlorin ferrochelatase [Morus notabilis]
 gb|EXB54066.1| Sirohydrochlorin ferrochelatase [Morus notabilis]
Length=211

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  GAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLM  329
            GA+P+F K      ++  L  RLCL   NGGF    + I   D +IIVDHGSRRKESNLM
Sbjct  29   GALPNFSKSLGVCFRSRNLIRRLCLRTENGGFEQIPHGIGEKDAIIIVDHGSRRKESNLM  88

Query  330  LNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            LNEFV MF+++T Y IVEPAHMELAEPSI+++F+ CVQ GA R+IVSPFFLF
Sbjct  89   LNEFVTMFRQRTGYEIVEPAHMELAEPSIRNSFDKCVQLGASRVIVSPFFLF  140



>ref|XP_004142793.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cucumis sativus]
 ref|XP_004156688.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cucumis sativus]
 gb|KGN51370.1| hypothetical protein Csa_5G523150 [Cucumis sativus]
Length=205

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 84/117 (72%), Gaps = 13/117 (11%)
 Frame = +3

Query  141  AHRGAIP--DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            + R +IP     K R F S       R  ++I NG      N I  GD VIIVDHGSRR+
Sbjct  29   SQRSSIPVGRLSKFRNFTS-------RFRMSIDNGS----SNRIGAGDAVIIVDHGSRRR  77

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ESNLMLNEFVAMF++KT YPIVEPAHMELAEPSIKD+F  CV+QGA+RIIVSPFFLF
Sbjct  78   ESNLMLNEFVAMFKDKTGYPIVEPAHMELAEPSIKDSFTLCVEQGAKRIIVSPFFLF  134



>ref|XP_009409069.1| PREDICTED: uncharacterized protein LOC103991368 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=247

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+FVK+R+  +K+  L+ +  L++ N       + +   D VIIVDHGSRR+ESNLMLNE
Sbjct  66   PNFVKLRRIMTKSSPLSAKFGLSLRNEATGRVEHTVGDNDAVIIVDHGSRRQESNLMLNE  125

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+ +T Y IVEPAHMELAEPSI+DAF  CVQ+GA+R+IVSPFFLF
Sbjct  126  FVAMFKARTGYHIVEPAHMELAEPSIRDAFKLCVQEGAKRVIVSPFFLF  174



>gb|KJB11538.1| hypothetical protein B456_001G264200 [Gossypium raimondii]
Length=218

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = +3

Query  171  KVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAM  350
            K +  PS+    + +  L   NGGF+   N +   DGVIIVDHGSRRKESNLMLNEFVAM
Sbjct  36   KFQTGPSRIRNFSAKSSLGFENGGFKQFPNGVGEKDGVIIVDHGSRRKESNLMLNEFVAM  95

Query  351  FQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            F+EK+ YPIVEPAHM LAEPSIKDAF  CVQ+GA R+IVSPFFLF
Sbjct  96   FREKSGYPIVEPAHM-LAEPSIKDAFGLCVQRGANRVIVSPFFLF  139



>ref|XP_006446561.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
 gb|ESR59801.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
Length=181

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 10/109 (9%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+ + +++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLMLN+
Sbjct  32   PNSLNLQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLNQ  81

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLF
Sbjct  82   FVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLF  130



>ref|XP_006446562.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
 gb|ESR59802.1| hypothetical protein CICLE_v10016757mg [Citrus clementina]
Length=202

 Score =   134 bits (337),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 10/109 (9%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+ + +++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLMLN+
Sbjct  32   PNSLNLQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLNQ  81

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLF
Sbjct  82   FVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLF  130



>ref|XP_010251142.1| PREDICTED: uncharacterized protein LOC104593131 isoform X2 [Nelumbo 
nucifera]
Length=166

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  252  ERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFN  431
            E++ +   DGVIIVDHGSRR+ESNLMLNEFV MF+++T YPIVEPAHMELAEPSIKDAFN
Sbjct  17   EKHGVSDRDGVIIVDHGSRRQESNLMLNEFVKMFRDRTGYPIVEPAHMELAEPSIKDAFN  76

Query  432  ACVQQGARRIIVSPFFLF  485
             CVQQGA R+IVSPFFLF
Sbjct  77   LCVQQGANRVIVSPFFLF  94



>ref|XP_008458790.1| PREDICTED: uncharacterized protein LOC103498093 [Cucumis melo]
Length=205

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 84/117 (72%), Gaps = 13/117 (11%)
 Frame = +3

Query  141  AHRGAIP--DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRK  314
            + R  IP     K R F S       R+ ++I NG      N I  GD VIIVDHGSRR+
Sbjct  29   SQRSPIPIGRLSKFRNFTS-------RVRMSIDNGS----SNRIGAGDAVIIVDHGSRRR  77

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ESN MLNEFVAMF++KT YPIVEPAHMELAEPSI+D+F +CV+QGA+RIIVSPFFLF
Sbjct  78   ESNRMLNEFVAMFRDKTGYPIVEPAHMELAEPSIRDSFTSCVEQGAKRIIVSPFFLF  134



>ref|XP_010033307.1| PREDICTED: uncharacterized protein LOC104422628 [Eucalyptus grandis]
 ref|XP_010033308.1| PREDICTED: uncharacterized protein LOC104422628 [Eucalyptus grandis]
 gb|KCW52917.1| hypothetical protein EUGRSUZ_J02232 [Eucalyptus grandis]
Length=222

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  213  RLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAH  392
            R CL   NGGF      I   DG+IIVDHGSRR+ESNLMLNEFVAMF++KT YPIVEPAH
Sbjct  61   RSCLKPENGGFGPRSFGIGERDGLIIVDHGSRRRESNLMLNEFVAMFRDKTGYPIVEPAH  120

Query  393  MELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            MELAEPSIKDAF++CV++G  R+IV+PFFLF
Sbjct  121  MELAEPSIKDAFSSCVRRGVTRVIVTPFFLF  151



>ref|XP_008348192.1| PREDICTED: uncharacterized protein LOC103411331, partial [Malus 
domestica]
Length=161

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  231  ANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEP  410
            A+GGF    + +  GDGVIIVDHGSRRKESNLMLNEFV+MF+E+T YPIVE AHMELAEP
Sbjct  6    ADGGFGRNPHGVCDGDGVIIVDHGSRRKESNLMLNEFVSMFRERTGYPIVEAAHMELAEP  65

Query  411  SIKDAFNACVQQGARRIIVSPFFL  482
            SI+DAF++CV+QGA R++VSPFFL
Sbjct  66   SIRDAFSSCVEQGANRVVVSPFFL  89



>ref|XP_010479465.1| PREDICTED: uncharacterized protein LOC104758326 isoform X1 [Camelina 
sativa]
Length=230

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +3

Query  138  RAHRG-AIPDFVKVRKFPSKTGYLAPRL-CL-AIANGGFRGERNCIKVGDGVIIVDHGSR  308
            R +R  A+P  +KV KF S+ G       C  +  NGG    RN I   DG+IIVDHGSR
Sbjct  40   RTNRSWALPVSLKVEKFRSQRGRRRRGSPCFGSFENGGLL--RNGIGDADGIIIVDHGSR  97

Query  309  RKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            R+ESNLML EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  98   RRESNLMLEEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLF  156



>ref|XP_010479466.1| PREDICTED: uncharacterized protein LOC104758326 isoform X2 [Camelina 
sativa]
Length=227

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRL-CL-AIANGGFRGERNCIKVGDGVIIVDHGSRRKESNL  326
            A+P  +KV KF S+ G       C  +  NGG    RN I   DG+IIVDHGSRR+ESNL
Sbjct  43   ALPVSLKVEKFRSQRGRRRRGSPCFGSFENGGLL--RNGIGDADGIIIVDHGSRRRESNL  100

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ML EFV MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  101  MLEEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLF  153



>ref|XP_002299633.2| hypothetical protein POPTR_0001s17900g [Populus trichocarpa]
 gb|EEE84438.2| hypothetical protein POPTR_0001s17900g [Populus trichocarpa]
Length=220

 Score =   133 bits (334),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +3

Query  216  LCLAIANGGF-----RGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIV  380
            LCL   +GG      RG    +   DGVIIVDHGSRRKESNLMLNEFVAMF++KT Y IV
Sbjct  55   LCLNSGDGGIMKTNPRGNGVFVGDKDGVIIVDHGSRRKESNLMLNEFVAMFRDKTGYLIV  114

Query  381  EPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            EPAHMELAEPSI+DAF  CVQQGA R+IVSPFFLF
Sbjct  115  EPAHMELAEPSIRDAFGLCVQQGANRVIVSPFFLF  149



>ref|NP_564562.1| sirohydrochlorin ferrochelatase B [Arabidopsis thaliana]
 gb|AAO42090.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50678.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32521.1| sirohydrochlorin ferrochelatase B [Arabidopsis thaliana]
Length=225

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  255  RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNA  434
            +N I   DG+IIVDHGSRR+ESNLML EFV MF+EKT YPIVEPAHMELAEPSIKDAF+ 
Sbjct  75   KNGIGDADGIIIVDHGSRRRESNLMLEEFVKMFKEKTGYPIVEPAHMELAEPSIKDAFSL  134

Query  435  CVQQGARRIIVSPFFLF  485
            CVQQGA+R++VSPFFLF
Sbjct  135  CVQQGAKRVVVSPFFLF  151



>ref|XP_010500571.1| PREDICTED: uncharacterized protein LOC104777944 [Camelina sativa]
Length=226

 Score =   132 bits (332),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +3

Query  237  GGFRGE---RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAE  407
            G F  E   RN I   DG+IIVDHGSRR+ESNLML EFV MF++KT YPIVEPAHMELAE
Sbjct  67   GSFENEGSLRNGIGDADGIIIVDHGSRRRESNLMLEEFVKMFKDKTGYPIVEPAHMELAE  126

Query  408  PSIKDAFNACVQQGARRIIVSPFFLF  485
            PSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  127  PSIKDAFSLCVQKGAKRVVVSPFFLF  152



>ref|XP_010461867.1| PREDICTED: uncharacterized protein LOC104742549 isoform X1 [Camelina 
sativa]
Length=230

 Score =   132 bits (332),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +3

Query  237  GGFRGE---RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAE  407
            G F  E   RN I   DG+IIVDHGSRR+ESNLML EFV MF++KT YPIVEPAHMELAE
Sbjct  71   GSFENEGSLRNGIGDADGIIIVDHGSRRRESNLMLEEFVKMFKDKTGYPIVEPAHMELAE  130

Query  408  PSIKDAFNACVQQGARRIIVSPFFLF  485
            PSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  131  PSIKDAFSLCVQKGAKRVVVSPFFLF  156



>ref|XP_007217178.1| hypothetical protein PRUPE_ppa012658mg [Prunus persica]
 gb|EMJ18377.1| hypothetical protein PRUPE_ppa012658mg [Prunus persica]
Length=159

 Score =   130 bits (327),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +3

Query  222  LAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMEL  401
            +   NGGF    N +   DGVIIVDHGSRR ESNLMLNEFV+MF+E+T YPIVEPAHMEL
Sbjct  1    MGSGNGGFGQNPNGVGDRDGVIIVDHGSRRTESNLMLNEFVSMFKERTGYPIVEPAHMEL  60

Query  402  AEPSIKDAFNACVQQGARRIIVSPFFLF  485
            AEPSI  AFN+CV QGA R+IVSPFFL 
Sbjct  61   AEPSIHVAFNSCVLQGANRVIVSPFFLL  88



>ref|XP_006829077.1| hypothetical protein AMTR_s00001p00260270 [Amborella trichopoda]
 gb|ERM96493.1| hypothetical protein AMTR_s00001p00260270 [Amborella trichopoda]
Length=204

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 7/90 (8%)
 Frame = +3

Query  237  GGFRGER------NC-IKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHM  395
            G  R ER      NC I+ GDGVI+VDHGSRR+ESNLMLN FVAMF+E++ YPIVEPAHM
Sbjct  42   GMVRDERFMIEKDNCGIRNGDGVIVVDHGSRRQESNLMLNAFVAMFKERSGYPIVEPAHM  101

Query  396  ELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ELA PSIKDAF ACVQQGA RI+VSP+FLF
Sbjct  102  ELATPSIKDAFCACVQQGANRIVVSPYFLF  131



>ref|XP_010461868.1| PREDICTED: uncharacterized protein LOC104742549 isoform X2 [Camelina 
sativa]
Length=227

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +3

Query  237  GGFRGE---RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAE  407
            G F  E   RN I   DG+IIVDHGSRR+ESNLML EFV MF++KT YPIVEPAHMELAE
Sbjct  68   GSFENEGSLRNGIGDADGIIIVDHGSRRRESNLMLEEFVKMFKDKTGYPIVEPAHMELAE  127

Query  408  PSIKDAFNACVQQGARRIIVSPFFLF  485
            PSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  128  PSIKDAFSLCVQKGAKRVVVSPFFLF  153



>ref|XP_011002714.1| PREDICTED: uncharacterized protein LOC105109646 isoform X2 [Populus 
euphratica]
Length=189

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 6/85 (7%)
 Frame = +3

Query  231  ANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEP  410
             NG F G++      DGVIIVDHGSRRKESNLMLNEFVAMF++KT Y IVEPAHMELAEP
Sbjct  71   GNGVFVGDK------DGVIIVDHGSRRKESNLMLNEFVAMFRDKTGYLIVEPAHMELAEP  124

Query  411  SIKDAFNACVQQGARRIIVSPFFLF  485
            SI+DAF  CVQQGA R+IVSPFFLF
Sbjct  125  SIRDAFGLCVQQGANRVIVSPFFLF  149



>gb|KDO55191.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=221

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 10/109 (9%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML +
Sbjct  98   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  147

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLF
Sbjct  148  FVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLF  196



>gb|AAM67145.1| unknown [Arabidopsis thaliana]
Length=225

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  255  RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNA  434
            +N I   DG+IIVDHGSRR+ESNLML EFV MF++KT YPIVEPAHMELAEPSIKDAF+ 
Sbjct  75   KNGIGDADGIIIVDHGSRRRESNLMLEEFVKMFKDKTGYPIVEPAHMELAEPSIKDAFSL  134

Query  435  CVQQGARRIIVSPFFLF  485
            CVQQGA+R++VSPFFLF
Sbjct  135  CVQQGAKRVVVSPFFLF  151



>ref|XP_011002713.1| PREDICTED: uncharacterized protein LOC105109646 isoform X1 [Populus 
euphratica]
Length=220

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 6/85 (7%)
 Frame = +3

Query  231  ANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEP  410
             NG F G++      DGVIIVDHGSRRKESNLMLNEFVAMF++KT Y IVEPAHMELAEP
Sbjct  71   GNGVFVGDK------DGVIIVDHGSRRKESNLMLNEFVAMFRDKTGYLIVEPAHMELAEP  124

Query  411  SIKDAFNACVQQGARRIIVSPFFLF  485
            SI+DAF  CVQQGA R+IVSPFFLF
Sbjct  125  SIRDAFGLCVQQGANRVIVSPFFLF  149



>ref|XP_006470275.1| PREDICTED: uncharacterized protein LOC102627039 [Citrus sinensis]
Length=210

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 10/109 (9%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML +
Sbjct  32   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  81

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLF
Sbjct  82   FVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLF  130



>gb|KDO55190.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=246

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 10/109 (9%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML +
Sbjct  98   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  147

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLF
Sbjct  148  FVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLF  196



>gb|KDO55189.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=247

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 10/109 (9%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML +
Sbjct  98   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  147

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLF
Sbjct  148  FVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLF  196



>emb|CAN60425.1| hypothetical protein VITISV_021073 [Vitis vinifera]
Length=150

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            DGVIIVDHGSRRKESNLMLNEFV MF++KT Y IVEPAHMELAEPSI +AFN+CVQQGA 
Sbjct  5    DGVIIVDHGSRRKESNLMLNEFVTMFRDKTGYLIVEPAHMELAEPSITNAFNSCVQQGAN  64

Query  456  RIIVSPFFLF  485
            R+IVSPFFLF
Sbjct  65   RVIVSPFFLF  74



>gb|KFK35946.1| hypothetical protein AALP_AA4G058800 [Arabis alpina]
Length=217

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 80/108 (74%), Gaps = 7/108 (6%)
 Frame = +3

Query  162  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEF  341
            D +KV  F S+ G      CL    G FR   N +   DG+IIVDHGSRRKESNLML EF
Sbjct  43   DSLKVENFRSQRGSKRGLTCL----GRFR---NGVGDTDGIIIVDHGSRRKESNLMLEEF  95

Query  342  VAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            V MF+++T Y IVEPAHMELA+PSIKDAF+ CVQQGA+R++VSPFFLF
Sbjct  96   VKMFKDETGYLIVEPAHMELAKPSIKDAFSLCVQQGAKRVVVSPFFLF  143



>gb|KDO55188.1| hypothetical protein CISIN_1g023828mg [Citrus sinensis]
Length=276

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 10/109 (9%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P+ +  ++ PS+T +L+ +             R+ +   DGVIIVDHGSRR+ESNLML +
Sbjct  98   PNSLNFQRGPSRTKHLSIK----------SSSRDGVGDKDGVIIVDHGSRRRESNLMLKQ  147

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            FVAMF+EKT Y IVEPAHMELAEPSIKDAF +CVQQGA R+IVSPFFLF
Sbjct  148  FVAMFREKTGYLIVEPAHMELAEPSIKDAFGSCVQQGANRVIVSPFFLF  196



>ref|XP_004291766.2| PREDICTED: uncharacterized protein LOC101314340 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=221

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 80/110 (73%), Gaps = 7/110 (6%)
 Frame = +3

Query  162  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLMLN  335
            + +   + PS+T  ++    +   NGG  G+     VGD   VI+VDHGSRRKESNLMLN
Sbjct  47   NLLNWHRSPSRTRNMS----IESGNGGL-GQSKLDGVGDRDAVIVVDHGSRRKESNLMLN  101

Query  336  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            EFV MF+E+T Y IVEPAHMELAEPSI DAFN+CV+QGA RIIVSPFFL 
Sbjct  102  EFVDMFRERTGYAIVEPAHMELAEPSIHDAFNSCVEQGANRIIVSPFFLL  151



>ref|XP_004291768.2| PREDICTED: uncharacterized protein LOC101314340 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=210

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 80/110 (73%), Gaps = 7/110 (6%)
 Frame = +3

Query  162  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLMLN  335
            + +   + PS+T  ++    +   NGG  G+     VGD   VI+VDHGSRRKESNLMLN
Sbjct  47   NLLNWHRSPSRTRNMS----IESGNGGL-GQSKLDGVGDRDAVIVVDHGSRRKESNLMLN  101

Query  336  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            EFV MF+E+T Y IVEPAHMELAEPSI DAFN+CV+QGA RIIVSPFFL 
Sbjct  102  EFVDMFRERTGYAIVEPAHMELAEPSIHDAFNSCVEQGANRIIVSPFFLL  151



>ref|XP_006647189.1| PREDICTED: uncharacterized protein LOC102709053 [Oryza brachyantha]
Length=165

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  231  ANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEP  410
            ++ G  GE   +   DGVIIVDHGSRR+ESNLMLN+FVAMF+ +T Y IVEPAHMELAEP
Sbjct  9    SSSGTAGESYTVGEKDGVIIVDHGSRRQESNLMLNDFVAMFRTRTGYKIVEPAHMELAEP  68

Query  411  SIKDAFNACVQQGARRIIVSPFFL  482
            +IKDAF  CVQQGA R+IVSP+FL
Sbjct  69   TIKDAFGKCVQQGASRVIVSPYFL  92



>ref|XP_009409070.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409072.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409073.1| PREDICTED: uncharacterized protein LOC103991368 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=173

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  189  SKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTK  368
            +K+  L+ +  L++ N       + +   D VIIVDHGSRR+ESNLMLNEFVAMF+ +T 
Sbjct  2    TKSSPLSAKFGLSLRNEATGRVEHTVGDNDAVIIVDHGSRRQESNLMLNEFVAMFKARTG  61

Query  369  YPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            Y IVEPAHMELAEPSI+DAF  CVQ+GA+R+IVSPFFLF
Sbjct  62   YHIVEPAHMELAEPSIRDAFKLCVQEGAKRVIVSPFFLF  100



>dbj|BAK06991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = +3

Query  162  DFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVG--DGVIIVDHGSRRKESNLMLN  335
            DFVK+    + +GY A       A+     E     VG  DGVIIVDHGSRR+ESNLMLN
Sbjct  31   DFVKLLTIGTSSGYRAMNSGPTSASKSETTEEQDYAVGENDGVIIVDHGSRRQESNLMLN  90

Query  336  EFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            +FV MF+ +T Y IVEPAHMELAEPSIK+AF  CVQQGA RIIVSP+FL
Sbjct  91   DFVTMFRARTGYRIVEPAHMELAEPSIKEAFGKCVQQGASRIIVSPYFL  139



>emb|CDY03592.1| BnaC03g68510D [Brassica napus]
Length=222

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+P  +KV  F  +        CLA    G    R+ I   DG+IIVDHGSRR+ESNLML
Sbjct  39   ALPCSLKVDTFQFQRTTRRGSPCLARFEDG-ELLRSGIGDADGIIIVDHGSRRRESNLML  97

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
             EFV MF++ T YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLF
Sbjct  98   EEFVKMFKDNTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLF  148



>ref|XP_010670852.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670853.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670854.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670855.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670856.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670857.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670859.1| PREDICTED: uncharacterized protein LOC104887804 [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  204  LAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVE  383
            L+P LC  +           +   DGVIIVDHGSRRKESN++LNEFV MF+ +T YPIVE
Sbjct  47   LSPSLCFPMDQKSVHEGAFGVGQKDGVIIVDHGSRRKESNILLNEFVLMFKSRTGYPIVE  106

Query  384  PAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            PAHMELAEPSIKDAF+ CVQQGA  +I+SPFFLF
Sbjct  107  PAHMELAEPSIKDAFDLCVQQGANCVIISPFFLF  140



>ref|XP_008783194.1| PREDICTED: uncharacterized protein LOC103702509 [Phoenix dactylifera]
Length=205

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P F K  +  +K   L+ + CL++ + G     + +   D VIIVDHGSRR+ESN MLNE
Sbjct  26   PGFHKFSRITTKGRTLSTKCCLSVRSEGLERFEHLMGDKDAVIIVDHGSRRQESNFMLNE  85

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            FVAMF+ +T Y IVEPAHMELA PSI+DAF  CV QGA R+IVSPFFL
Sbjct  86   FVAMFKARTGYRIVEPAHMELAAPSIRDAFKTCVLQGANRVIVSPFFL  133



>ref|XP_010915963.1| PREDICTED: uncharacterized protein LOC105040911 isoform X2 [Elaeis 
guineensis]
Length=205

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P F K+ +  +K   L+ + CL++   G     + +   D VIIVDHGSRR+ESN ML+E
Sbjct  26   PVFHKLSRITAKGRTLSTKCCLSVRGEGLERFEHSVGDKDAVIIVDHGSRRQESNFMLDE  85

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            FVAMF+ +T Y IVEPAHMELA PSI+DAF  CV QGA+R+IVSPFFL
Sbjct  86   FVAMFKARTGYRIVEPAHMELAAPSIRDAFETCVLQGAKRVIVSPFFL  133



>ref|XP_009107234.1| PREDICTED: uncharacterized protein LOC103832890 [Brassica rapa]
Length=228

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLA-IANGGFRGERNCIKVGDGVIIVDHGSRRKESNLM  329
            A+P  +KV    S+        CLA   NG     R+ I   DG+IIVDHGSRR+ESN+M
Sbjct  41   ALPCSLKVDNVQSRRIKRRGSPCLARFENGELL--RSGIGDADGIIIVDHGSRRRESNIM  98

Query  330  LNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            L EFV MF++ T YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLF
Sbjct  99   LEEFVKMFKDNTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLF  150



>emb|CDY45053.1| BnaA08g02220D [Brassica napus]
Length=228

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLA-IANGGFRGERNCIKVGDGVIIVDHGSRRKESNLM  329
            A+P  +KV    S+        CLA   NG     R+ I   DG+IIVDHGSRR+ESN+M
Sbjct  41   ALPCSLKVDNVQSRRIKRRGSPCLARFENGELL--RSGIGDADGIIIVDHGSRRRESNIM  98

Query  330  LNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            L EFV MF++ T YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLF
Sbjct  99   LEEFVKMFKDNTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLF  150



>dbj|BAD21683.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD22195.1| unknown protein [Oryza sativa Japonica Group]
Length=212

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 5/88 (6%)
 Frame = +3

Query  234  NGGF-----RGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHME  398
            N GF     +GE   +   DGVIIVDHGSRR+ESNLMLN+FVAMF+ +T Y IVEPAHME
Sbjct  52   NSGFSSETAQGESCTVGEKDGVIIVDHGSRREESNLMLNDFVAMFRARTGYKIVEPAHME  111

Query  399  LAEPSIKDAFNACVQQGARRIIVSPFFL  482
            LAEP+IKDAF  CVQQGA R+IVSP+FL
Sbjct  112  LAEPTIKDAFGKCVQQGASRVIVSPYFL  139



>ref|XP_009409075.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409076.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409077.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409078.1| PREDICTED: uncharacterized protein LOC103991368 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=161

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D VIIVDHGSRR+ESNLMLNEFVAMF+ +T Y IVEPAHMELAEPSI+DAF  CVQ+GA+
Sbjct  19   DAVIIVDHGSRRQESNLMLNEFVAMFKARTGYHIVEPAHMELAEPSIRDAFKLCVQEGAK  78

Query  456  RIIVSPFFLF  485
            R+IVSPFFLF
Sbjct  79   RVIVSPFFLF  88



>ref|XP_009409074.1| PREDICTED: uncharacterized protein LOC103991368 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=172

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D VIIVDHGSRR+ESNLMLNEFVAMF+ +T Y IVEPAHMELAEPSI+DAF  CVQ+GA+
Sbjct  30   DAVIIVDHGSRRQESNLMLNEFVAMFKARTGYHIVEPAHMELAEPSIRDAFKLCVQEGAK  89

Query  456  RIIVSPFFLF  485
            R+IVSPFFLF
Sbjct  90   RVIVSPFFLF  99



>ref|XP_004952284.1| PREDICTED: uncharacterized protein LOC101756522 isoform X1 [Setaria 
italica]
 ref|XP_004952285.1| PREDICTED: uncharacterized protein LOC101756522 isoform X2 [Setaria 
italica]
Length=212

 Score =   124 bits (311),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 80/116 (69%), Gaps = 3/116 (3%)
 Frame = +3

Query  141  AHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRK  314
            A R +I DF ++R+    +G L        A+G     R    VGD   V+IVDHGSRR+
Sbjct  25   AARNSI-DFTELRRAGRSSGNLVMSSMPNPASGSETSGREDFNVGDKDAVVIVDHGSRRQ  83

Query  315  ESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            ESNLMLN+FV MF+ +T Y IVEPAHMELAEP+IKDAF  CVQQGA RIIVSP+FL
Sbjct  84   ESNLMLNDFVEMFRTRTGYKIVEPAHMELAEPTIKDAFGKCVQQGASRIIVSPYFL  139



>gb|EPS61981.1| hypothetical protein M569_12814, partial [Genlisea aurea]
Length=150

 Score =   122 bits (306),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  264  IKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQ  443
            I   DG+IIVDHGSRR+ESNLML++FV+MF+EKTKY IVEPAHMELAEPSIK+AF++CV+
Sbjct  5    ISGSDGIIIVDHGSRRRESNLMLDDFVSMFREKTKYAIVEPAHMELAEPSIKNAFDSCVR  64

Query  444  QGARRIIVSPFFLF  485
            +GA+ ++VSPFFLF
Sbjct  65   RGAKCVVVSPFFLF  78



>ref|XP_010678615.1| PREDICTED: uncharacterized protein LOC104894137 [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  204  LAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVE  383
            L+P LC  +           +   DGVIIVDHGSRRKESN++LN+FV MF+ +T YPIVE
Sbjct  34   LSPSLCFPMDQKSVHEGAFGVGQKDGVIIVDHGSRRKESNILLNKFVLMFKSRTGYPIVE  93

Query  384  PAHMELAEPSIKDAFNACVQQGARRIIVSPF  476
            PAHMELA+PSIKDAF+ CVQQGA R+I+SPF
Sbjct  94   PAHMELADPSIKDAFDLCVQQGANRVIISPF  124



>ref|XP_010523580.1| PREDICTED: uncharacterized protein LOC104801894 [Tarenaya hassleriana]
Length=227

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 4/113 (4%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRL-CLAIA-NGGFRGERNCIKVGDGVIIVDHGSRRKESNL  326
            A+P  VK +K  +K       L C A + NGGF   RN I  GDG+IIVDHGSRR+ESNL
Sbjct  43   ALPGSVKFQKLHTKHRQRMCSLPCFATSENGGFF--RNGIGDGDGIIIVDHGSRRRESNL  100

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ML+EFV MF+++T YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R+++SPFFLF
Sbjct  101  MLDEFVKMFKDQTGYPIVEPAHMELAEPSIKDAFSICVQKGAKRVVISPFFLF  153



>ref|XP_010915962.1| PREDICTED: uncharacterized protein LOC105040911 isoform X1 [Elaeis 
guineensis]
Length=293

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  159  PDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNE  338
            P F K+ +  +K   L+ + CL++   G     + +   D VIIVDHGSRR+ESN ML+E
Sbjct  114  PVFHKLSRITAKGRTLSTKCCLSVRGEGLERFEHSVGDKDAVIIVDHGSRRQESNFMLDE  173

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            FVAMF+ +T Y IVEPAHMELA PSI+DAF  CV QGA+R+IVSPFFL
Sbjct  174  FVAMFKARTGYRIVEPAHMELAAPSIRDAFETCVLQGAKRVIVSPFFL  221



>ref|XP_002453737.1| hypothetical protein SORBIDRAFT_04g012200 [Sorghum bicolor]
 gb|EES06713.1| hypothetical protein SORBIDRAFT_04g012200 [Sorghum bicolor]
Length=212

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  165  FVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLMLNE  338
            FV +R+    +G LA       A G     R    VGD   V+IVDHGSRR+ESNL+LN+
Sbjct  32   FVNLRRAGKSSGNLAMNSISKPAPGSETSGREDFAVGDKDAVVIVDHGSRRQESNLLLND  91

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            FV MF+ KT Y IVEPAHMELAEP+IKDAF  CVQQGA R+IVSP+FL
Sbjct  92   FVEMFRAKTSYRIVEPAHMELAEPTIKDAFGKCVQQGASRVIVSPYFL  139



>ref|XP_004489242.1| PREDICTED: sirohydrochlorin ferrochelatase-like [Cicer arietinum]
Length=200

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 67/89 (75%), Gaps = 6/89 (7%)
 Frame = +3

Query  216  LCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHM  395
            LC++  N    G        D VIIVDHGSRRKESNLMLNEFV MF+ KT Y IVE AHM
Sbjct  45   LCMSTQNSSRVGP------NDAVIIVDHGSRRKESNLMLNEFVEMFRHKTGYQIVELAHM  98

Query  396  ELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            ELAEPSI DAF +CVQQGARR+I+SPFFL
Sbjct  99   ELAEPSIGDAFQSCVQQGARRVIISPFFL  127



>gb|ACG31626.1| sirohydrochlorin ferrochelatase [Zea mays]
Length=212

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  165  FVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLMLNE  338
            FV +R     +G LA       A G     R    VGD   V+IVDHGSRR+ESNLMLN+
Sbjct  32   FVNLRTAGRSSGNLAMNSVPKPAPGSETSGREDFAVGDKDAVVIVDHGSRRQESNLMLND  91

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            FV MF+ KT Y IVEPAHMELAEP+IKDAF  CVQQGA R+I+SP+FL
Sbjct  92   FVEMFRAKTSYRIVEPAHMELAEPTIKDAFGKCVQQGASRVIISPYFL  139



>ref|XP_003618170.1| Sirohydrochlorin ferrochelatase [Medicago truncatula]
 gb|AES74388.1| sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=200

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  RGERNCIKVG--DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIK  419
            +  +N   VG  D VIIVDHGSRRKESNLMLNEFV M++ KT Y IVEPAHMELAEPSI 
Sbjct  47   KSTQNSSGVGPDDAVIIVDHGSRRKESNLMLNEFVEMYRRKTGYQIVEPAHMELAEPSIG  106

Query  420  DAFNACVQQGARRIIVSPFFL  482
            DAF +CVQQGA RII+SPFFL
Sbjct  107  DAFQSCVQQGAHRIIISPFFL  127



>ref|XP_009381040.1| PREDICTED: uncharacterized protein LOC103969271 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  144  HRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVG--DGVIIVDHGSRRKE  317
            HR   P  VK+++   K+        L++ N   RG R   KVG  D VIIVDHGSRR+E
Sbjct  20   HRLPFPISVKLQRIMMKSSSFPTNSSLSLVNEE-RG-RVEHKVGEHDAVIIVDHGSRRQE  77

Query  318  SNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            SNLMLNEFVAMF+ +T Y IVEPAHMELA+PSI DAF  C+Q+GA+R+I+SPFFL
Sbjct  78   SNLMLNEFVAMFKARTGYQIVEPAHMELAKPSINDAFRLCMQKGAKRVIISPFFL  132



>ref|XP_009381038.1| PREDICTED: uncharacterized protein LOC103969271 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=218

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  144  HRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVG--DGVIIVDHGSRRKE  317
            HR   P  VK+++   K+        L++ N   RG R   KVG  D VIIVDHGSRR+E
Sbjct  31   HRLPFPISVKLQRIMMKSSSFPTNSSLSLVNEE-RG-RVEHKVGEHDAVIIVDHGSRRQE  88

Query  318  SNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            SNLMLNEFVAMF+ +T Y IVEPAHMELA+PSI DAF  C+Q+GA+R+I+SPFFL
Sbjct  89   SNLMLNEFVAMFKARTGYQIVEPAHMELAKPSINDAFRLCMQKGAKRVIISPFFL  143



>ref|XP_002891559.1| hypothetical protein ARALYDRAFT_314421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67818.1| hypothetical protein ARALYDRAFT_314421 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 13/90 (14%)
 Frame = +3

Query  255  RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHM-------------  395
            +N I   DG+IIVDHGSRR+ESNLML EFV MF++KT YPIVEPAHM             
Sbjct  69   KNGIGDADGIIIVDHGSRRRESNLMLEEFVKMFKDKTGYPIVEPAHMLCLLFADVHTLHQ  128

Query  396  ELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ELAEPSIKDAF+ CVQQGA+R++VSPFFLF
Sbjct  129  ELAEPSIKDAFSLCVQQGAKRVVVSPFFLF  158



>gb|AAD50047.1|AC007980_12 Hypothetical protein [Arabidopsis thaliana]
Length=242

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 69/94 (73%), Gaps = 17/94 (18%)
 Frame = +3

Query  255  RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHM-------------  395
            +N I   DG+IIVDHGSRR+ESNLML EFV MF+EKT YPIVEPAHM             
Sbjct  75   KNGIGDADGIIIVDHGSRRRESNLMLEEFVKMFKEKTGYPIVEPAHMMTFKLCLLFADFY  134

Query  396  ----ELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
                ELAEPSIKDAF+ CVQQGA+R++VSPFFLF
Sbjct  135  TLHQELAEPSIKDAFSLCVQQGAKRVVVSPFFLF  168



>ref|XP_006393176.1| hypothetical protein EUTSA_v10011756mg [Eutrema salsugineum]
 gb|ESQ30462.1| hypothetical protein EUTSA_v10011756mg [Eutrema salsugineum]
Length=226

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 82/120 (68%), Gaps = 7/120 (6%)
 Frame = +3

Query  135  GRAHRGAIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGE---RNCIKVGDGVIIVDHGS  305
            G     A+P  +KV KF  +        CL    G F  E    N I   DG+IIVDHGS
Sbjct  37   GTNRSWALPISLKVEKFRPQRASRRGSPCL----GSFENEGLLSNGIGGADGIIIVDHGS  92

Query  306  RRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            RR+ESNLML EFV MF++KT YPIVEPAHMELAEPSIK AF+ CVQQGA+R++VSPFFLF
Sbjct  93   RRRESNLMLEEFVKMFKDKTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVVVSPFFLF  152



>gb|ACG41745.1| sirohydrochlorin ferrochelatase [Zea mays]
 gb|ACG45177.1| sirohydrochlorin ferrochelatase [Zea mays]
Length=212

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +3

Query  165  FVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLMLNE  338
            FV +R     +G LA       A G     R    VGD   V+IVDHGSRR+ESNLMLN+
Sbjct  32   FVNLRTAGRSSGNLAMNSVPKPALGSETSWREDFAVGDKDAVVIVDHGSRRQESNLMLND  91

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            FV MF+ KT Y IVE AHMELAEP+IKDAF  CVQQGA R+IVSP+FL
Sbjct  92   FVEMFRAKTSYSIVEAAHMELAEPTIKDAFGKCVQQGASRVIVSPYFL  139



>gb|AFK44994.1| unknown [Medicago truncatula]
Length=200

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  246  RGERNCIKVG--DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIK  419
            +  +N   VG  D VIIVDHGSRRKESNLMLNEFV M++ KT Y IVEPAHMELAEPSI 
Sbjct  47   KSTQNSSGVGPDDAVIIVDHGSRRKESNLMLNEFVEMYRRKTGYQIVEPAHMELAEPSIG  106

Query  420  DAFNACVQQGARRIIVSPFFL  482
            DAF +CVQQG  RII+SPFFL
Sbjct  107  DAFQSCVQQGVHRIIISPFFL  127



>ref|NP_001132509.1| sirohydrochlorin ferrochelatase isoform 1 [Zea mays]
 gb|ACF81375.1| unknown [Zea mays]
Length=212

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +3

Query  165  FVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLMLNE  338
            FV +      +G LA       A G     R    VGD   V+IVDHGSRR+ESNLMLN+
Sbjct  32   FVNLWTAGRSSGNLAMNSVPKPAPGSETSGREDFAVGDKDAVVIVDHGSRRQESNLMLND  91

Query  339  FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            FV MF+ KT Y IVEPAHMELAEP+IKDAF  CVQQGA R+I+SP+FL
Sbjct  92   FVEMFRAKTSYRIVEPAHMELAEPTIKDAFGKCVQQGASRVIISPYFL  139



>ref|XP_003574408.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235063.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235064.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235065.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235066.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235067.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235068.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235069.1| PREDICTED: uncharacterized protein LOC100845003 isoform X1 [Brachypodium 
distachyon]
Length=213

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  249  GERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAF  428
            G+   +   DGVIIVDHGSRR+ESNLMLN+FV MF+ +T Y IVEPAHMELAEP+IK+AF
Sbjct  63   GQDYTVGENDGVIIVDHGSRRQESNLMLNDFVTMFRARTGYRIVEPAHMELAEPTIKEAF  122

Query  429  NACVQQGARRIIVSPFFL  482
              CVQQGA R+IVSP+FL
Sbjct  123  GKCVQQGASRVIVSPYFL  140



>ref|XP_010235070.1| PREDICTED: uncharacterized protein LOC100845003 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010235072.1| PREDICTED: uncharacterized protein LOC100845003 isoform X2 [Brachypodium 
distachyon]
Length=212

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  249  GERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAF  428
            G+   +   DGVIIVDHGSRR+ESNLMLN+FV MF+ +T Y IVEPAHMELAEP+IK+AF
Sbjct  62   GQDYTVGENDGVIIVDHGSRRQESNLMLNDFVTMFRARTGYRIVEPAHMELAEPTIKEAF  121

Query  429  NACVQQGARRIIVSPFFL  482
              CVQQGA R+IVSP+FL
Sbjct  122  GKCVQQGASRVIVSPYFL  139



>ref|XP_010238623.1| PREDICTED: uncharacterized protein LOC100837021 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010238624.1| PREDICTED: uncharacterized protein LOC100837021 isoform X1 [Brachypodium 
distachyon]
Length=213

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  249  GERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAF  428
            G+   +   DGVIIVDHGSRR+ESNLMLN+FV MF+ +T Y IVEPAHMELAEP+IK+AF
Sbjct  63   GQDYTVGENDGVIIVDHGSRRQESNLMLNDFVTMFRARTGYRIVEPAHMELAEPTIKEAF  122

Query  429  NACVQQGARRIIVSPFFL  482
              CVQQGA R+IVSP+FL
Sbjct  123  GKCVQQGASRVIVSPYFL  140



>ref|XP_003578793.1| PREDICTED: uncharacterized protein LOC100837021 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010238625.1| PREDICTED: uncharacterized protein LOC100837021 isoform X2 [Brachypodium 
distachyon]
Length=212

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  249  GERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAF  428
            G+   +   DGVIIVDHGSRR+ESNLMLN+FV MF+ +T Y IVEPAHMELAEP+IK+AF
Sbjct  62   GQDYTVGENDGVIIVDHGSRRQESNLMLNDFVTMFRARTGYRIVEPAHMELAEPTIKEAF  121

Query  429  NACVQQGARRIIVSPFFL  482
              CVQQGA R+IVSP+FL
Sbjct  122  GKCVQQGASRVIVSPYFL  139



>ref|XP_010530526.1| PREDICTED: uncharacterized protein LOC104807109 isoform X2 [Tarenaya 
hassleriana]
Length=196

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRL-CLAIA-NGGFRGERNCIKVGDGVIIVDHGSRRKESNL  326
            A+P  VK +K  +K       L C A + N GF   RN I  GDG+IIVDHGS R ESNL
Sbjct  43   ALPGSVKFQKLHTKNRQRMCSLSCFATSENVGFF--RNGIGDGDGIIIVDHGSHRHESNL  100

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ML+EFV MF+++T YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  101  MLDEFVKMFKDQTGYPIVEPAHMELAEPSIKDAFSICVQKGAKRVVVSPFFLF  153



>ref|XP_010530522.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530523.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530524.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530525.1| PREDICTED: uncharacterized protein LOC104807109 isoform X1 [Tarenaya 
hassleriana]
Length=227

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRL-CLAIA-NGGFRGERNCIKVGDGVIIVDHGSRRKESNL  326
            A+P  VK +K  +K       L C A + N GF   RN I  GDG+IIVDHGS R ESNL
Sbjct  43   ALPGSVKFQKLHTKNRQRMCSLSCFATSENVGFF--RNGIGDGDGIIIVDHGSHRHESNL  100

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            ML+EFV MF+++T YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  101  MLDEFVKMFKDQTGYPIVEPAHMELAEPSIKDAFSICVQKGAKRVVVSPFFLF  153



>ref|XP_003618173.1| Sirohydrochlorin cobaltochelatase [Medicago truncatula]
 gb|ACJ85904.1| unknown [Medicago truncatula]
 gb|AES74391.1| sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=208

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            GD VIIVDHGS RKE+NLML++FV MF+ KT Y IVEPAHMELA+PSI DAF +CVQQGA
Sbjct  58   GDAVIIVDHGSNRKEANLMLSKFVEMFRNKTGYKIVEPAHMELAKPSIADAFQSCVQQGA  117

Query  453  RRIIVSPFFL  482
             RII+SPFFL
Sbjct  118  HRIIISPFFL  127



>gb|ACR35235.1| unknown [Zea mays]
Length=166

 Score =   115 bits (287),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+IVDHGSRR+ESNLMLN+FV MF+ KT Y IVE AHMELAEP+IKDAF  CVQQG  
Sbjct  25   DAVVIVDHGSRRQESNLMLNDFVEMFRAKTSYSIVEAAHMELAEPTIKDAFGKCVQQGVS  84

Query  456  RIIVSPFFL  482
            R+IVSP+FL
Sbjct  85   RVIVSPYFL  93



>ref|XP_003618171.1| Sirohydrochlorin ferrochelatase [Medicago truncatula]
Length=210

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 66/91 (73%), Gaps = 12/91 (13%)
 Frame = +3

Query  246  RGERNCIKVG--DGVIIVDHGSRRKESNLMLN----------EFVAMFQEKTKYPIVEPA  389
            +  +N   VG  D VIIVDHGSRRKESNLML+          EFV M++ KT Y IVEPA
Sbjct  47   KSTQNSSGVGPDDAVIIVDHGSRRKESNLMLSKNSLSKLVIYEFVEMYRRKTGYQIVEPA  106

Query  390  HMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            HMELAEPSI DAF +CVQQGA RII+SPFFL
Sbjct  107  HMELAEPSIGDAFQSCVQQGAHRIIISPFFL  137



>gb|ABK26418.1| unknown [Picea sitchensis]
Length=214

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  234  NGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPS  413
            +   R E+   +  DGVIIVDHGSRR+ESN ML+ FV M++++T +PIVE AHMELA+P+
Sbjct  58   SATIRNEQAGFREHDGVIIVDHGSRRQESNCMLDAFVDMYKKRTGHPIVELAHMELAQPT  117

Query  414  IKDAFNACVQQGARRIIVSPFFL  482
            IK+AF++CV QGA R+I+SP+FL
Sbjct  118  IKEAFDSCVNQGAARVIISPYFL  140



>gb|KHN23513.1| hypothetical protein glysoja_029802 [Glycine soja]
Length=169

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 77/134 (57%), Gaps = 22/134 (16%)
 Frame = +3

Query  150  GAIPDFVKVRKFPSKTGYLAPR-----LCLAIANGG-FRGERNCIKVGDGVIIVDHGSRR  311
            G  P +V ++   S      PR     LCL+  NGG FR     +  GD  IIVDHGSRR
Sbjct  21   GTNPSWVPLKSSNSLCCSSKPRNLSRFLCLSTQNGGGFRENSGEVGRGDAAIIVDHGSRR  80

Query  312  KESNLMLNE----------------FVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQ  443
            KESNLML++                F+ +F        VEPAHMELAEPSI+DAF +CV+
Sbjct  81   KESNLMLSKLNPSVLCFITVFVLTPFIFLFFGGGVGVCVEPAHMELAEPSIRDAFQSCVE  140

Query  444  QGARRIIVSPFFLF  485
            QGA RIIVSPFFLF
Sbjct  141  QGAHRIIVSPFFLF  154



>ref|XP_002964135.1| hypothetical protein SELMODRAFT_37056, partial [Selaginella moellendorffii]
 gb|EFJ34468.1| hypothetical protein SELMODRAFT_37056, partial [Selaginella moellendorffii]
Length=158

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            DG++IVDHGSRR ESN ML EFV M++ KT + IV+ AHMELA PSI+DAF+ CV+ GA+
Sbjct  20   DGIVIVDHGSRRAESNSMLEEFVEMYKRKTGHEIVQAAHMELAAPSIEDAFDRCVELGAQ  79

Query  456  RIIVSPFFLF  485
            R+IVSP+FLF
Sbjct  80   RVIVSPYFLF  89



>ref|XP_002993172.1| hypothetical protein SELMODRAFT_26806, partial [Selaginella moellendorffii]
 gb|EFJ05812.1| hypothetical protein SELMODRAFT_26806, partial [Selaginella moellendorffii]
Length=158

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            DG++IVDHGSRR ESN ML EFV M++ KT + IV+ AHMELA PSI+DAF+ CV+ GA+
Sbjct  20   DGIVIVDHGSRRAESNSMLEEFVNMYKRKTGHEIVQAAHMELAAPSIEDAFDRCVELGAQ  79

Query  456  RIIVSPFFLF  485
            R+IVSP+FLF
Sbjct  80   RVIVSPYFLF  89



>ref|XP_001765290.1| predicted protein [Physcomitrella patens]
 gb|EDQ70018.1| predicted protein, partial [Physcomitrella patens]
Length=155

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            DGV+IVDHGSRR +SN ML+ FV ++++KT +PIVE AHMELAEPSI  AF+ CV+QGA 
Sbjct  1    DGVVIVDHGSRRAQSNEMLHLFVDLYKQKTGHPIVEAAHMELAEPSISHAFDRCVEQGAE  60

Query  456  RIIVSPFFLF  485
            R+I+ P+F F
Sbjct  61   RVIICPYFFF  70



>ref|XP_008667254.1| PREDICTED: sirohydrochlorin ferrochelatase isoform 1 isoform 
X1 [Zea mays]
Length=248

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 73/144 (51%), Gaps = 38/144 (26%)
 Frame = +3

Query  165  FVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGD--GVIIVDHGSRRKESNLMLNE  338
            FV +      +G LA       A G     R    VGD   V+IVDHGSRR+ESNLMLN+
Sbjct  32   FVNLWTAGRSSGNLAMNSVPKPAPGSETSGREDFAVGDKDAVVIVDHGSRRQESNLMLND  91

Query  339  FVAMFQEKTKYPIVEPAHM------------------------------------ELAEP  410
            FV MF+ KT Y IVEPAHM                                    ELAEP
Sbjct  92   FVEMFRAKTSYRIVEPAHMASREEGELQGSEKEESCGEGGELLTAEREIDICAGEELAEP  151

Query  411  SIKDAFNACVQQGARRIIVSPFFL  482
            +IKDAF  CVQQGA R+I+SP+FL
Sbjct  152  TIKDAFGKCVQQGASRVIISPYFL  175



>ref|XP_008353469.1| PREDICTED: uncharacterized protein LOC103417039 [Malus domestica]
Length=178

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLML  332
            A+ +F  +++ PS++  L+ RLC+   NGGF    + +   DGVIIVDHGSRRKESNLML
Sbjct  66   AVLNFSNLQRGPSRSRNLSLRLCMGSGNGGFGQNPHGVGDKDGVIIVDHGSRRKESNLML  125

Query  333  NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQG  449
            NEFV+MF+E+T Y IVEPAHM + +    D    CV  G
Sbjct  126  NEFVSMFRERTGYLIVEPAHMIVLQQKGTD----CVTPG  160



>emb|CBI34882.3| unnamed protein product [Vitis vinifera]
Length=124

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            MLNEFV MF++KT Y IVEPAHMELAEPSI +AF++CVQQGA R+IVSPFFLF
Sbjct  1    MLNEFVTMFRDKTGYLIVEPAHMELAEPSITNAFSSCVQQGANRVIVSPFFLF  53



>ref|XP_002506350.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO67608.1| predicted protein, partial [Micromonas sp. RCC299]
Length=133

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRI  461
            V+IVDHGSRRK SN +L EFV M++E+T  PIVE AHMEL EP I  AF+ CV+QGA  +
Sbjct  1    VVIVDHGSRRKASNDLLEEFVRMYREETGRPIVELAHMELCEPGIDVAFSRCVEQGATLV  60

Query  462  IVSPFFL  482
             VSPFFL
Sbjct  61   AVSPFFL  67



>gb|EEC72956.1| hypothetical protein OsI_06840 [Oryza sativa Indica Group]
 gb|EEE56777.1| hypothetical protein OsJ_06350 [Oryza sativa Japonica Group]
Length=125

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            MLN+FVAMF+ +T Y IVEPAHMELAEP+IKDAF  CVQQGA R+IVSP+FL
Sbjct  1    MLNDFVAMFRARTGYKIVEPAHMELAEPTIKDAFGKCVQQGASRVIVSPYFL  52



>ref|WP_040351481.1| hypothetical protein, partial [Blastopirellula marina]
Length=94

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            G+++VDHGSRR  SN +L E V +F++ T  PIVE AHMELAEPSI  AF  CV QGA  
Sbjct  2    GIVVVDHGSRRAASNDLLLEVVQLFRQTTGRPIVEAAHMELAEPSIAAAFARCVAQGAGL  61

Query  459  IIVSPFFL  482
            +IV P+FL
Sbjct  62   VIVHPYFL  69



>ref|XP_003083605.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL58154.1| Cobalamin (vitamin B12) biosynthesis CbiX [Ostreococcus tauri]
Length=202

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  AIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELA  404
            AIA      + +  +   GV+IVDHGSRRKESN  L  FV  +   T   IVE AHMELA
Sbjct  44   AIARASMWSDDSATEDVLGVVIVDHGSRRKESNAQLEVFVEQYARVTGRDIVEAAHMELA  103

Query  405  EPSIKDAFNACVQQGARRIIVSPFFL  482
             PSI DAF  CV +GA  I+V+PFFL
Sbjct  104  SPSIADAFGRCVDRGANVIVVAPFFL  129



>ref|XP_010461882.1| PREDICTED: uncharacterized protein LOC104742567 [Camelina sativa]
Length=116

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  348  MFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            MF++KT YPIVEPAHMELAEPSIKDAF+ CVQ+GA+R++VSPFFLF
Sbjct  1    MFKDKTGYPIVEPAHMELAEPSIKDAFSLCVQKGAKRVVVSPFFLF  46



>ref|WP_041378683.1| hypothetical protein, partial [Phycisphaera mikurensis]
Length=122

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEK-TKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            GVIIVDHGSRR +SN  L E   +F ++ +  PIVE AHMELA P I  A++ACV++GAR
Sbjct  2    GVIIVDHGSRRAQSNASLEEVARLFAQRFSDAPIVEAAHMELAMPDIAAAYDACVRRGAR  61

Query  456  RIIVSPFFL  482
            RI++ PFFL
Sbjct  62   RIVILPFFL  70



>gb|EAQ82176.1| cbiX protein [Blastopirellula marina DSM 3645]
Length=152

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            G+++VDHGSRR  SN +L E V +F++ T  PIVE AHMELAEPSI  AF  CV QGA  
Sbjct  12   GIVVVDHGSRRAASNDLLLEVVQLFRQTTGRPIVEAAHMELAEPSIAAAFARCVAQGAGL  71

Query  459  IIVSPFFL  482
            +IV P+FL
Sbjct  72   VIVHPYFL  79



>ref|XP_001421596.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99889.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=134

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GV++VDHGSRR  SN  L  F A++   T   +VEPAHMELA P+I DAF  CV++GA  
Sbjct  1    GVVVVDHGSRRAASNEQLERFAALYATATGRAVVEPAHMELAPPTIADAFERCVERGANV  60

Query  459  IIVSPFFL  482
            ++V+PFFL
Sbjct  61   VVVAPFFL  68



>dbj|BAM03818.1| putative sirohydrochlorin cobaltochelatase [Phycisphaera mikurensis 
NBRC 102666]
Length=178

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEK-TKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            GVIIVDHGSRR +SN  L E   +F ++ +  PIVE AHMELA P I  A++ACV++GAR
Sbjct  13   GVIIVDHGSRRAQSNASLEEVARLFAQRFSDAPIVEAAHMELAMPDIAAAYDACVRRGAR  72

Query  456  RIIVSPFFL  482
            RI++ PFFL
Sbjct  73   RIVILPFFL  81



>gb|EWM29197.1| Cobalamin (vitamin B12) biosynthesis CbiX [Nannochloropsis gaditana]
Length=257

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GVI+VDHGSRRKE+N  L    + F+  + Y +VEPAHMEL EPSI  AF  CV++GA  
Sbjct  119  GVIVVDHGSRRKEANEALESVASEFKALSGYELVEPAHMELCEPSIATAFGRCVERGATF  178

Query  459  IIVSPFFL  482
            II  PFFL
Sbjct  179  IICHPFFL  186



>ref|XP_003063280.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH52416.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=139

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLML----NEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQ  446
            GV++VDHGSRRK SN +L    +EFV M+ E T   +VE AHME+AEPSI  AF  CV++
Sbjct  4    GVVVVDHGSRRKASNELLARPSSEFVRMYVEHTGRGLVELAHMEIAEPSIDVAFARCVER  63

Query  447  GARRIIVSPFFL  482
            GA  + VSPFFL
Sbjct  64   GATLVAVSPFFL  75



>emb|CBJ30308.1| sirohydrochlorin ferrochelatase, putative chloroplast precursor 
[Ectocarpus siliculosus]
Length=215

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GVI+ DHGSRR+ +N ML E    ++  + + IVE AHMELAEPSI++AF+ CV  GA++
Sbjct  88   GVIVCDHGSRRENANTMLFEVAERYRSFSGFEIVEAAHMELAEPSIEEAFDRCVAAGAQK  147

Query  459  IIVSPFFL  482
            +++ PFFL
Sbjct  148  VVLHPFFL  155



>ref|XP_001698709.1| sirohydrochlorin ferrochelatase, SIRB [Chlamydomonas reinhardtii]
 gb|EDO99391.1| sirohydrochlorin ferrochelatase, SIRB [Chlamydomonas reinhardtii]
Length=234

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GV+IVDHGSR++ SN ML+EF A++ + T + +VE AHME+AEP+I  A   C ++GA  
Sbjct  93   GVVIVDHGSRKRASNDMLHEFGALYGQLTGHDLVEVAHMEIAEPTIAQAVGRCAERGAST  152

Query  459  IIVSPFFL  482
            ++++P+FL
Sbjct  153  VVIAPYFL  160



>ref|XP_005851931.1| hypothetical protein CHLNCDRAFT_133580 [Chlorella variabilis]
 gb|EFN59829.1| hypothetical protein CHLNCDRAFT_133580 [Chlorella variabilis]
Length=158

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GV++VDHGS++ E+N  L EF  ++++ T   +VE AHMELAEP+I+ A   C   GARR
Sbjct  32   GVVVVDHGSKKAEANDALLEFAELYKKVTGRQVVEVAHMELAEPTIEQAVGRCAAAGARR  91

Query  459  IIVSPFFL  482
            ++V+P+FL
Sbjct  92   VVVAPYFL  99



>ref|XP_005536035.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79749.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=175

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query  267  KVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIV-EPAHMELAEPSIKDAFNACVQ  443
              G  +++VDHGSRRKE+N  L + + + + +    I+   AHME+AEP++ D F ACV+
Sbjct  44   NAGHALLLVDHGSRRKEANEALFDMIELLRRRAPPGIIIHGAHMEMAEPTLDDGFRACVE  103

Query  444  QGARRIIVSPFFL  482
             GAR I+V P+FL
Sbjct  104  AGARHIVVVPYFL  116



>ref|XP_005711482.1| unnamed protein product [Chondrus crispus]
 emb|CDF41188.1| unnamed protein product [Chondrus crispus]
Length=289

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +3

Query  210  PRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPA  389
            PR  +A+ N   +   +  +    +++VDHGS+R  +N ML+    M +EK+  P+   A
Sbjct  152  PRF-VAVTNNPSKPVESQTRQSSALLLVDHGSKRASANEMLSRVADMIREKSDIPVYT-A  209

Query  390  HMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            HME+A P+I D    CVQ GA  +IV PFFL
Sbjct  210  HMEIASPTIADGMEQCVQNGAEHVIVVPFFL  240



>ref|XP_009040729.1| hypothetical protein AURANDRAFT_32321 [Aureococcus anophagefferens]
 gb|EGB04623.1| hypothetical protein AURANDRAFT_32321 [Aureococcus anophagefferens]
Length=161

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYP--IVEPAHMELAEPSIKDAFNACVQQGA  452
            GV++VDHGS+R+ +N  L    A + E    P  +V PAHMELA PSI++AF+A V QG 
Sbjct  11   GVMVVDHGSKREAANERLITLCAAYAESHAKPDWVVAPAHMELASPSIEEAFDALVAQGC  70

Query  453  RRIIVSPFFL  482
              ++  PFFL
Sbjct  71   DLVVCHPFFL  80



>ref|XP_005643741.1| CbiX-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19197.1| CbiX-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=132

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V++VDHGS+R E+N ML EF  +     +   VE AHMELAEPSI  A + C  +G R+
Sbjct  14   AVVLVDHGSKRAEANEMLEEFATLNLSSRQR--VEIAHMELAEPSIGTAVSRCASEGFRK  71

Query  459  IIVSPFFL  482
            I+++P+FL
Sbjct  72   IVIAPYFL  79



>emb|CBE70093.1| NUDIX hydrolase (modular protein) [Candidatus Methylomirabilis 
oxyfera]
Length=318

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRI  461
            ++IVDHGSRR+ SN +L +   +  E+    IV  AHMEL EP+I+  F+ACV  GA  +
Sbjct  5    LLIVDHGSRREGSNDLLRKVAGLMGEQFGLRIVHYAHMELGEPTIQQGFDACVADGADEV  64

Query  462  IVSPFFL  482
            IV P+FL
Sbjct  65   IVHPYFL  71



>ref|XP_010530527.1| PREDICTED: uncharacterized protein LOC104807109 isoform X3 [Tarenaya 
hassleriana]
Length=190

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 6/90 (7%)
 Frame = +3

Query  153  AIPDFVKVRKFPSKTGYLAPRL-CLAIA-NGGFRGERNCIKVGDGVIIVDHGSRRKESNL  326
            A+P  VK +K  +K       L C A + N GF   RN I  GDG+IIVDHGS R ESNL
Sbjct  43   ALPGSVKFQKLHTKNRQRMCSLSCFATSENVGFF--RNGIGDGDGIIIVDHGSHRHESNL  100

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSI  416
            ML+EFV MF+++T YPIVEPAHM++  PS+
Sbjct  101  MLDEFVKMFKDQTGYPIVEPAHMDI--PSL  128



>ref|WP_007022881.1| hypothetical protein [Neptuniibacter caesariensis]
 gb|EAR61795.1| hypothetical protein MED92_04332 [Neptuniibacter caesariensis]
Length=130

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTK--YPIVEPAHMELAEPSIKDAFNACVQQGA  452
             ++IV HGSRR+ SN  + E +   Q K K  YPI+E + +ELA PSI++A   C+QQG+
Sbjct  3    SLVIVAHGSRRERSNKEVLELIDSLQPKIKDEYPIIESSFLELASPSIEEAIEKCIQQGS  62

Query  453  RRIIVSPFFL  482
              I V P+FL
Sbjct  63   TDIKVLPYFL  72



>ref|WP_034419847.1| hypothetical protein [Clostridiales bacterium DRI-13]
Length=121

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            G++++ HGSRRKE N +L EF    +EK  Y +V  A+ME   P++ +     + +GA R
Sbjct  3    GILVLSHGSRRKEYNELLKEFAVKLKEKHSYSLVTTAYMEFDTPTLAEGVRELINRGAGR  62

Query  459  IIVSPFFL  482
            IIV P FL
Sbjct  63   IIVVPLFL  70



>ref|WP_026174408.1| hypothetical protein [Effusibacillus pohliae]
Length=131

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            G+++V HGS    +N  L +     +E  +YPIV+ A +ELAEP I    + C++QGA R
Sbjct  4    GIVLVAHGSPEPSANRELFQIAEFVREDGQYPIVQAAFLELAEPDIPTGIDLCIEQGAER  63

Query  459  IIVSPFFLF  485
            +IV P+FL 
Sbjct  64   VIVVPYFLL  72



>ref|WP_015246709.1| hypothetical protein [Singulisphaera acidiphila]
 gb|AGA27563.1| hypothetical protein Sinac_3293 [Singulisphaera acidiphila DSM 
18658]
Length=169

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++ HGSR   +N  L++  A F E+ ++PIVEP  +ELA+P I +    CV QGA R
Sbjct  9    AVLLIAHGSRHAPANDDLHQLAARFMERGEHPIVEPCFLELADPDILNGGRRCVAQGATR  68

Query  459  IIVSPFFL  482
            +++ P+FL
Sbjct  69   VLMIPYFL  76



>ref|XP_007508641.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20258.1| predicted protein [Bathycoccus prasinos]
Length=226

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 28/111 (25%)
 Frame = +3

Query  213  RLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQ------------  356
            RL + + +G F  E+       G+++VDHGSR K SN  L  F  MF+            
Sbjct  43   RLRIVVNSGDFNEEKV------GIVLVDHGSRAKSSNEQLERFAEMFEMMYGSTIGGDYN  96

Query  357  --------EKTKYPIVEPAHMELAEPSIKDAFNACVQ-QGARRIIVSPFFL  482
                    ++ KY +  PAHMELA PSI DAF   ++ +  R+I+V+PFFL
Sbjct  97   SDDNNSYSKERKYEVA-PAHMELASPSIADAFRELIETKNCRKIVVAPFFL  146



>ref|WP_041971482.1| sirohydrochlorin cobaltochelatase [Geobacter sp. OR-1]
 dbj|GAM09629.1| sirohydrochlorin ferrochelatase [Geobacter sp. OR-1]
Length=128

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSR  E+N    E  AM ++ T Y IVE ++ E+  P+I+   +ACV QGA R
Sbjct  5    AILLMAHGSRIPEANDAAQEIAAMVRKMTGYDIVEVSYREMHLPNIQQGIDACVAQGAER  64

Query  459  IIVSPFFLFL  488
            I++ P+FLF+
Sbjct  65   ILLMPYFLFI  74



>ref|WP_004513845.1| sirohydrochlorin cobaltochelatase [Geobacter metallireducens]
 gb|EHP85526.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
metallireducens RCH3]
 gb|ABB30719.2| sirohydrochlorin cobaltochelatase [Geobacter metallireducens 
GS-15]
Length=127

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSR  E+N  + E  AM +E T Y IVE +  E   P+I++  +ACV +GARR
Sbjct  4    AILLMAHGSRIAEANNAVREIAAMVKEMTGYDIVEVSFREQHLPNIQEGIDACVAKGARR  63

Query  459  IIVSPFFLFL  488
            +++ P+FLF+
Sbjct  64   VLLMPYFLFV  73



>ref|WP_040592008.1| cobalamin biosynthesis protein CbiX [Schlesneria paludicola]
Length=130

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GV+++ HGSRRKE+N  L     +   + +Y +V+ +++ELA P+I D    CV++GA R
Sbjct  7    GVLLIAHGSRRKEANDDLVRLAELITRRQEYGVVQESYLELAPPTIVDGGRICVERGATR  66

Query  459  IIVSPFFL  482
            +++ P+FL
Sbjct  67   VLMLPYFL  74



>ref|WP_033407066.1| cobalamin biosynthesis protein CbiX [Thiothrix disciformis]
Length=121

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKT--KYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            ++++ HGSRR  SN  + E     Q +   ++  VE A +ELAEPSI DA +ACV QGA 
Sbjct  5    LVLIAHGSRRAASNQEVQELAQRVQAQAGERFAKVESAFLELAEPSIPDAIDACVAQGAT  64

Query  456  RIIVSPFFL  482
             I++ P+FL
Sbjct  65   EIVIVPYFL  73



>ref|WP_044238640.1| cobalamin biosynthesis protein CbiX [Planctomyces maris]
Length=130

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSRR E+N  L +  AM +E+ ++ +VE A++ELAEP+I +    CVQ GA  
Sbjct  8    AILLIAHGSRRDEANQDLVKLAAMLRERCEFGVVEYAYLELAEPAIPEGAARCVQAGAAE  67

Query  459  IIVSPFFL  482
            + + P+FL
Sbjct  68   VFMLPYFL  75



>gb|ADY62006.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Planctomyces 
brasiliensis DSM 5305]
Length=129

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + ++++ HGSRR+E+N  L +  AM QE     IVE A +++ EP+I     AC+++GA+
Sbjct  11   EAILMIAHGSRRQEANDDLYKLAAMVQESRPEKIVECAFLDVVEPTIPQGMEACIEKGAQ  70

Query  456  RIIVSPFFL  482
            R+++ P+FL
Sbjct  71   RVLMFPYFL  79



>gb|EDL58513.1| Cobalamin (vitamin B12) biosynthesis CbiX protein [Planctomyces 
maris DSM 8797]
Length=134

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSRR E+N  L +  AM +E+ ++ +VE A++ELAEP+I +    CVQ GA  
Sbjct  12   AILLIAHGSRRDEANQDLVKLAAMLRERCEFGVVEYAYLELAEPAIPEGAARCVQAGAAE  71

Query  459  IIVSPFFL  482
            + + P+FL
Sbjct  72   VFMLPYFL  79



>ref|WP_039740278.1| sirohydrochlorin cobaltochelatase [Geobacter pickeringii]
 gb|AJE02421.1| sirohydrochlorin cobaltochelatase [Geobacter pickeringii]
Length=127

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSR  E+N  + E  AM +E T Y IVE +  E   P+I++  +ACV +GA R
Sbjct  4    AILLMAHGSRISEANDAVREIAAMVKEMTGYEIVEISFREQHLPTIQEGVDACVAKGAER  63

Query  459  IIVSPFFLFL  488
            +++ P+FLF+
Sbjct  64   VLLMPYFLFV  73



>gb|KHN12062.1| Sirohydrochlorin ferrochelatase [Glycine soja]
Length=80

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  375  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            +VEP HMELAEPSI+DAF +C++QG   IIV PF LF
Sbjct  5    LVEPTHMELAEPSIRDAFESCIEQGVHHIIVCPFILF  41



>ref|WP_026842098.1| sirohydrochlorin cobaltochelatase [Geobacter bremensis]
Length=127

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  270  VGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQG  449
            +   ++I+ HGSR  E+N  ++E  A+ Q  TK+ IVE +  E   P+I+   +ACV +G
Sbjct  1    MSTALLIMAHGSRIAEANDAVHEIAALVQRMTKFDIVEVSFREQHLPNIQQGVDACVAKG  60

Query  450  ARRIIVSPFFLFL  488
            A+RI++ P+FL++
Sbjct  61   AQRILLVPYFLYM  73



>ref|WP_044742814.1| sirohydrochlorin cobaltochelatase [Anoxybacillus sp. ATCC BAA-2555]
Length=274

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            RRIIV P+FLF
Sbjct  190  RRIIVLPYFLF  200



>ref|XP_007216178.1| hypothetical protein PRUPE_ppa015785mg, partial [Prunus persica]
 gb|EMJ17377.1| hypothetical protein PRUPE_ppa015785mg, partial [Prunus persica]
Length=68

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  327  MLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNAC  437
            ML +FV+M +++T YPIVEPAHMELAEPSI  AFN+C
Sbjct  1    MLWDFVSMLKDRTGYPIVEPAHMELAEPSIHVAFNSC  37



>ref|WP_012531975.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis]
 gb|ACH40539.1| sirohydrochlorin cobaltochelatase [Geobacter bemidjiensis Bem]
Length=127

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++I+ HGSR  E+N  ++E  A+ Q  TK+ IVE +  E   P+I+   +ACV +GA+R
Sbjct  4    ALLIMAHGSRIAEANDAVHEIAALVQRMTKFDIVEVSFREQHLPNIQQGVDACVAKGAQR  63

Query  459  IIVSPFFLFL  488
            I++ P+FL++
Sbjct  64   ILLVPYFLYM  73



>ref|WP_033025433.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. CAMR5420]
 gb|KDE48664.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. CAMR5420]
Length=276

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            RRIIV P+FLF
Sbjct  190  RRIIVLPYFLF  200



>ref|WP_038084991.1| hypothetical protein [Tumebacillus flagellatus]
 gb|KEO84412.1| hypothetical protein EL26_04740 [Tumebacillus flagellatus]
Length=123

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + ++++ HGSR   +N  L+E V   +E+    IVEPA +E   PSI +   ACV+QGA+
Sbjct  3    EALLLIAHGSRVPAANRDLHEMVRRVREQRDGWIVEPAFLEGTSPSIPEGIAACVRQGAK  62

Query  456  RIIVSPFFLF  485
            R+ V PFFL 
Sbjct  63   RVAVIPFFLL  72



>ref|WP_010943630.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens]
 ref|NP_954042.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens PCA]
 gb|AAR36392.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens PCA]
 gb|ADI85755.1| sirohydrochlorin cobaltochelatase [Geobacter sulfurreducens KN400]
Length=127

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSR  E+N  + E  AM +E T + IVE +  E   P I+   +ACV QGA R
Sbjct  4    AILLMAHGSRIPEANDAVREIAAMVKEMTGFEIVEVSFREQHLPDIQQGIDACVAQGAER  63

Query  459  IIVSPFFLFL  488
            +++ P+FLF+
Sbjct  64   VLLMPYFLFV  73



>ref|WP_033020763.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. G1w1]
 gb|KFX32851.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. G1w1]
Length=277

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y +VEPA M +  PS+ DA + C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTDYSLVEPAFMGVTTPSLDDAVHRCLALGA  189

Query  453  RRIIVSPFFLF  485
            +RI++ P+FLF
Sbjct  190  KRIVILPYFLF  200



>ref|WP_019119442.1| hypothetical protein [Brevibacillus massiliensis]
Length=297

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGSR  E NL +  FV    E+   PIVE   +EL  P I    +ACV++GA 
Sbjct  2    DAVLFVGHGSRDPEGNLEVRRFVEAMAEELSVPIVETCFLELERPDIFQGVHACVKRGAT  61

Query  456  RIIVSPFFLF  485
            R++V P  LF
Sbjct  62   RVVVIPMMLF  71



>ref|WP_023634354.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. MAS1]
 gb|ESU71191.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. MAS1]
Length=275

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            RRI+V P+FLF
Sbjct  190  RRIVVLPYFLF  200



>ref|WP_008880154.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Geobacillus]
 gb|EDY06196.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. G11MC16]
 gb|AEV19408.1| Cobalamin (Vitamin B12) biosynthesis CbiX protein [Geobacillus 
thermoleovorans CCB_US3_UF5]
 gb|EQB94495.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. A8]
 dbj|GAJ58833.1| hypothetical protein B23_2046 [Geobacillus thermoleovorans B23]
 gb|KJE26509.1| sirohydrochlorin cobaltochelatase [Geobacillus kaustophilus]
Length=275

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            RRI+V P+FLF
Sbjct  190  RRIVVLPYFLF  200



>ref|WP_015374903.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Geobacillus]
 gb|AGE22366.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. GHH01]
 dbj|GAD13548.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
kaustophilus GBlys]
Length=276

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            RRI+V P+FLF
Sbjct  190  RRIVVLPYFLF  200



>ref|WP_011887477.1| sirohydrochlorin cobaltochelatase [Geobacillus thermodenitrificans]
 gb|ABO67057.1| Cbi protein [Geobacillus thermodenitrificans NG80-2]
Length=275

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            RRI+V P+FLF
Sbjct  190  RRIVVLPYFLF  200



>ref|WP_011735221.1| sirohydrochlorin cobaltochelatase [Pelobacter propionicus]
 gb|ABK98919.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Pelobacter 
propionicus DSM 2379]
Length=127

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRI  461
            ++++ HGSR  E+N    +   M QE + + IVE +  E+ EPSI+   + CV +GA RI
Sbjct  5    ILMMAHGSRIAEANDAARQVAKMVQEMSGFDIVEVSFREMHEPSIQQGIDTCVARGAERI  64

Query  462  IVSPFFLFL  488
            ++ P+FLF+
Sbjct  65   LLMPYFLFM  73



>ref|WP_033843838.1| sirohydrochlorin cobaltochelatase [Geobacillus subterraneus]
Length=279

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y +VEPA M +  PS+ DA + C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTDYSLVEPAFMGVTTPSLDDAVHRCLALGA  189

Query  453  RRIIVSPFFLF  485
            +RI++ P+FLF
Sbjct  190  KRIVILPYFLF  200



>ref|WP_013523816.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Geobacillus]
 gb|ACX79205.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC61]
 gb|ADU94178.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y412MC52]
Length=275

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            RRI+V P+FLF
Sbjct  190  RRIVVLPYFLF  200



>ref|XP_005703681.1| sirohydrochlorin cobaltochelatase-like protein [Galdieria sulphuraria]
 gb|EME27161.1| sirohydrochlorin cobaltochelatase-like protein [Galdieria sulphuraria]
Length=178

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             +I++DHGS+  E+N  L +  ++  ++     V  AHMELA+P + +AF  CV+  AR 
Sbjct  56   ALILIDHGSKLPEANDQLAKVASLVAKRCPTVFVTFAHMELAKPDLMEAFMRCVENNARS  115

Query  459  IIVSPFFLF  485
            I V PFFLF
Sbjct  116  ITVCPFFLF  124



>ref|WP_041400479.1| cobalamin biosynthesis protein CbiX [Planctomyces brasiliensis]
Length=115

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  288  IVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRIIV  467
            ++ HGSRR+E+N  L +  AM QE     IVE A +++ EP+I     AC+++GA+R+++
Sbjct  1    MIAHGSRRQEANDDLYKLAAMVQESRPEKIVECAFLDVVEPTIPQGMEACIEKGAQRVLM  60

Query  468  SPFFL  482
             P+FL
Sbjct  61   FPYFL  65



>ref|WP_026894565.1| hypothetical protein [Clostridiisalibacter paucivorans]
Length=121

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +3

Query  270  VGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQG  449
            +G G++IV HGSR  ++     + V M +E   Y +V  AHME++EP+I       V+ G
Sbjct  1    MGKGLLIVGHGSRSSDAQKTFEKVVDMVKEMASYEMVAGAHMEISEPNIPMVVGGLVENG  60

Query  450  ARRIIVSPFFLF  485
             + I+V P+FL+
Sbjct  61   IKNILVVPYFLY  72



>ref|WP_040888328.1| cobalamin biosynthesis protein CbiX [Zavarzinella formosa]
Length=122

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSRR E+N  L    +  +E+ +Y  V+PA++EL  P I D    CV+ GA R
Sbjct  5    ALLLIAHGSRRAEANADLEFLASRIRERGEYLHVQPAYLELCPPDIIDGGGICVEAGATR  64

Query  459  IIVSPFFL  482
            +I+ P+FL
Sbjct  65   VILLPYFL  72



>ref|WP_011936979.1| sirohydrochlorin cobaltochelatase [Geobacter uraniireducens]
 gb|ABQ24250.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
uraniireducens Rf4]
Length=127

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSR  E+N  ++E   M ++ T Y IVE +  E   P+I+   +ACV +GA R
Sbjct  4    AILLMAHGSRITEANHAVHEIAGMVKQMTGYDIVEVSFREQHAPNIQKGIDACVARGAER  63

Query  459  IIVSPFFLFL  488
            I++ P+FL++
Sbjct  64   ILLIPYFLYM  73



>ref|WP_015838817.1| sirohydrochlorin cobaltochelatase [Geobacter sp. M21]
 gb|ACT19633.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacter 
sp. M21]
Length=127

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++I+ HGSR  E+N  ++E  A  Q  TK+ IVE +  E   P+I+   +ACV +GA+R
Sbjct  4    ALLIMAHGSRIAEANDAVHEIAARVQRMTKFDIVEVSFREQHLPNIQQGVDACVAKGAQR  63

Query  459  IIVSPFFLFL  488
            I++ P+FL++
Sbjct  64   ILLVPYFLYM  73



>ref|WP_010041782.1| cobalamin biosynthesis protein CbiX [Gemmata obscuriglobus]
Length=124

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++ HGSRR E+N  L    A  + + +YP+V+ +++ELAEP I+     CV  GA  
Sbjct  7    AVLLIAHGSRRPEANADLEFVAASLRARGRYPVVQVSYLELAEPDIETGGAQCVGAGATD  66

Query  459  IIVSPFFL  482
            +++ P+FL
Sbjct  67   VLLLPYFL  74



>ref|WP_025950690.1| sirohydrochlorin cobaltochelatase [Geobacillus thermocatenulatus]
Length=274

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            +RI+V P+FLF
Sbjct  190  KRIVVLPYFLF  200



>ref|WP_033005389.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. WSUCF1]
Length=274

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            +RI+V P+FLF
Sbjct  190  KRIVVLPYFLF  200



>ref|WP_011231294.1| sirohydrochlorin cobaltochelatase [Geobacillus kaustophilus]
 dbj|BAD76089.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
Length=274

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            +RI+V P+FLF
Sbjct  190  KRIVVLPYFLF  200



>ref|WP_033010025.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
 gb|KFL16096.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
 gb|KFX32067.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
Length=274

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            +RI+V P+FLF
Sbjct  190  KRIVVLPYFLF  200



>ref|WP_013145274.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. C56-T3]
 gb|ADI26734.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. C56-T3]
Length=274

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            +RI+V P+FLF
Sbjct  190  KRIVVLPYFLF  200



>ref|WP_031409368.1| sirohydrochlorin cobaltochelatase [Geobacillus vulcani]
Length=278

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTDYALIEPAFMGVTTPSLDDAVRRCLALGA  189

Query  453  RRIIVSPFFLF  485
            +RI++ P+FLF
Sbjct  190  KRIVILPYFLF  200



>ref|WP_033016971.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
Length=274

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  189

Query  453  RRIIVSPFFLF  485
            +RI+V P+FLF
Sbjct  190  KRIVVLPYFLF  200



>ref|WP_039646717.1| sirohydrochlorin cobaltochelatase [Geobacter sp. GSS01]
 gb|KIE43341.1| sirohydrochlorin cobaltochelatase [Geobacter sp. GSS01]
Length=127

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSR  E+N  + E   M +E T + IVE +  E   P+I+   +ACV QGA R
Sbjct  4    AILLMAHGSRIPEANGAVREIAVMVKEMTGFEIVEVSFREQHLPNIQQGIDACVAQGAER  63

Query  459  IIVSPFFLFL  488
            +++ P+FLF+
Sbjct  64   VLLMPYFLFV  73



>gb|EPR28848.1| Sirohydrochlorin cobaltochelatase [Geobacillus sp. WSUCF1]
Length=289

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  145  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLMLGA  204

Query  453  RRIIVSPFFLF  485
            +RI+V P+FLF
Sbjct  205  KRIVVLPYFLF  215



>ref|WP_044737026.1| sirohydrochlorin cobaltochelatase [Geobacillus kaustophilus]
Length=275

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  VI++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA
Sbjct  130  GTAVILLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLTLGA  189

Query  453  RRIIVSPFFLF  485
            +RI++ P+FLF
Sbjct  190  KRIVILPYFLF  200



>ref|WP_020561351.1| hypothetical protein [Thiothrix flexilis]
Length=141

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKT-KYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
             +++V HGSR+++SN  + +     QE++  +  V  A +ELAEPSI D    C+ QGA 
Sbjct  3    SLLVVAHGSRKEQSNNEIRQLAQRLQEQSDSFTRVSCAFLELAEPSIPDGIQTCIDQGAT  62

Query  456  RIIVSPFFL  482
             ++V P+FL
Sbjct  63   EVLVLPYFL  71



>ref|WP_012645135.1| sirohydrochlorin cobaltochelatase [Geobacter daltonii]
 gb|ACM18406.1| sirohydrochlorin cobaltochelatase [Geobacter daltonii FRC-32]
Length=127

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++I+ HGSR  ++N  ++E   M ++ T Y IVE +  E   P+I+   +ACV +GA R
Sbjct  4    AILIMAHGSRIPDANQAVHEIAGMVKKMTGYDIVEVSFREQHAPNIQKGIDACVARGAER  63

Query  459  IIVSPFFLFL  488
            I++ P+FL+L
Sbjct  64   ILLLPYFLYL  73



>ref|WP_028490034.1| cobalamin biosynthesis protein CbiX [Thiothrix lacustris]
Length=138

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKT--KYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            ++IV HGSRR +SN  +    A   E++   Y  V  A +ELAEPSI D    C+ +GA 
Sbjct  4    LLIVAHGSRRTQSNDEIRALAAKVGEQSAETYGYVSSAFLELAEPSIPDGIQQCIDEGAT  63

Query  456  RIIVSPFFL  482
             I + PFFL
Sbjct  64   DITIMPFFL  72



>ref|WP_040099907.1| sirohydrochlorin cobaltochelatase [Geoalkalibacter ferrihydriticus]
 gb|KIH76331.1| sirohydrochlorin cobaltochelatase [Geoalkalibacter ferrihydriticus 
DSM 17813]
Length=135

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++++ HGSR   +N  L+   AM +E T + IVE +  E   P+I+   +ACV QGA+R
Sbjct  4    AILLMGHGSRIPAANEALHAIAAMVRECTGFEIVEVSFREQHAPNIQKGIDACVAQGAQR  63

Query  459  IIVSPFFLF  485
            +++ P+FLF
Sbjct  64   VLLYPYFLF  72



>ref|WP_010870484.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus jannaschii]
 ref|NP_247965.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus jannaschii 
DSM 2661]
 sp|Q58380.1|CBIX_METJA RecName: Full=Sirohydrochlorin cobaltochelatase; AltName: Full=CbiXS 
[Methanocaldococcus jannaschii DSM 2661]
 gb|AAB98975.1| conserved hypothetical protein [Methanocaldococcus jannaschii 
DSM 2661]
Length=143

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR   S  +L +     +E+  +PIVE   ME +EP+I  A    ++QGA+
Sbjct  2    EALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGAK  61

Query  456  RIIVSPFFL  482
            RIIV P FL
Sbjct  62   RIIVVPVFL  70



>ref|WP_043904546.1| sirohydrochlorin cobaltochelatase [Geobacillus stearothermophilus]
 gb|EZP77428.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
stearothermophilus NUB3621]
Length=276

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  GDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
            G  V+++  G    ++N  L +   +F E+T Y +VEPA M +  PS++D    CV+ GA
Sbjct  130  GTAVVLLGRGGSDPDANSDLYKISRLFWEQTNYFLVEPAFMGVTTPSLEDGVERCVKLGA  189

Query  453  RRIIVSPFFLF  485
            R+++V P+FLF
Sbjct  190  RKVVVLPYFLF  200



>ref|WP_026604006.1| cobalamin biosynthesis protein CbiX [Methylomonas sp. 11b]
Length=121

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQ-EKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            +++V HGSRR++SNL + E +   +   T++  ++ A +E+AEP+I+      + QGAR+
Sbjct  4    LLVVAHGSRREDSNLEIRELIEKLRLMTTRFAAIDCAFLEIAEPTIEQGLRQQIAQGARQ  63

Query  459  IIVSPFFL  482
            I+V P+FL
Sbjct  64   IVVMPYFL  71



>ref|WP_020485404.1| hypothetical protein [Methylomonas sp. MK1]
Length=121

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQ-EKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            +++V HGSRR+ SNL + E +   +   T++  ++ A +E+AEP+I+      + QGAR+
Sbjct  4    LLVVAHGSRREASNLEIRELIKQLRLTATRFAAIDCAFLEIAEPTIEQGLRQQIAQGARQ  63

Query  459  IIVSPFFL  482
            I+V P+FL
Sbjct  64   IVVMPYFL  71



>ref|WP_035741568.1| cobalamin biosynthesis protein CbiX, partial [Frankia sp. BMG5.12]
Length=123

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEF---VAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQG  449
            G++++ HGSRR E+N M+ E    +A   +  ++  VEPA ++LA P I   + A V  G
Sbjct  3    GLLVIGHGSRRDEANAMVVELSRALAPCVDLPEWDAVEPAFLDLAHPDIAQGYAALVDAG  62

Query  450  ARRIIVSPFFLF  485
               II  PFFLF
Sbjct  63   CSEIIAHPFFLF  74



>ref|WP_036272023.1| cobalamin biosynthesis protein CbiX [Methylomonas denitrificans]
 gb|KHD33418.1| cobalamin biosynthesis protein CbiX [Methylomonas denitrificans]
Length=120

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQ-EKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            +++V HGSRR++SNL +++ +   +   T++  ++ A +E+AEP+I       + QGAR+
Sbjct  3    LLVVAHGSRREDSNLEIHQLIEQLRLTTTRFAAIDCAFLEIAEPNIAQGLRQQIAQGARQ  62

Query  459  IIVSPFFL  482
            I+V P+FL
Sbjct  63   IVVMPYFL  70



>ref|WP_003250807.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Geobacillus]
 gb|ADP74834.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. Y4.1MC1]
 gb|AEH48112.1| Sirohydrochlorin ferrochelatase [Geobacillus thermoglucosidasius 
C56-YS93]
 gb|EID44175.1| sirohydrochlorin cobaltochelatase [Geobacillus thermoglucosidans 
TNO-09.020]
Length=277

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  G    ++N  L +   +F E+T Y +VEPA M +  PS+ DA   CV+ GAR+
Sbjct  132  AVVLLGRGGSDPDANSDLYKISRLFWEQTNYFLVEPAFMGVTAPSLDDAVERCVKLGARK  191

Query  459  IIVSPFFLF  485
            ++V P+FLF
Sbjct  192  VVVLPYFLF  200


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPI-VEPAHMELAEPSIKDAFNACVQQGAR  455
             V+ V HGSR  E N  + +FV   +   K  I VE + +E   P+I++  + CV  GAR
Sbjct  3    AVLFVGHGSRDPEGNDQVRQFVEQLKPNIKASIHVETSFLEFGRPTIREGIDRCVSAGAR  62

Query  456  RIIVSPFFLF  485
             IIV P  L 
Sbjct  63   EIIVIPMILL  72



>ref|WP_042384847.1| sirohydrochlorin cobaltochelatase [Geobacillus thermoglucosidasius]
 dbj|GAJ44148.1| sirohydrochlorin cobaltochelatase [Geobacillus thermoglucosidasius 
NBRC 107763]
Length=278

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  G    ++N  L +   +F E+T Y +VEPA M +  PS+ DA   CV+ GAR+
Sbjct  132  AVVLLGRGGSDPDANSDLYKISRLFWEQTNYFLVEPAFMGVTAPSLDDAVERCVKLGARK  191

Query  459  IIVSPFFLF  485
            ++V P+FLF
Sbjct  192  VVVLPYFLF  200


 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPI-VEPAHMELAEPSIKDAFNACVQQGAR  455
             V+ V HGSR  E N  + +FV   +   K  I VE + +E   P+I++  + CV  GAR
Sbjct  3    AVLFVGHGSRDPEGNDQVRQFVEQLKPNIKASIHVETSFLEFGRPTIREGIDRCVSAGAR  62

Query  456  RIIVSPFFLF  485
             IIV P  L 
Sbjct  63   EIIVIPMILL  72



>ref|WP_015732608.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus vulcanius]
 ref|YP_003246869.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus vulcanius 
M7]
 gb|ACX72387.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Methanocaldococcus 
vulcanius M7]
Length=141

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR   S  +L       +EK  +PIVE   ME  EP+I +A    + QGA+
Sbjct  2    EALVLVGHGSRLPYSKELLVNLAEKIKEKNLFPIVEIGMMEFNEPTIPEAVKKAIDQGAK  61

Query  456  RIIVSPFFL  482
            +IIV P FL
Sbjct  62   KIIVVPVFL  70



>ref|WP_036581629.1| sirohydrochlorin cobaltochelatase, partial [Paenibacillus darwinianus]
Length=297

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRI  461
            +++V HGSR  E N  L EF    +E+ +  ++E   +ELA P I+    ACV QGA R+
Sbjct  4    ILLVGHGSRDPEGNAELLEFADRVRERAQGVVIETCFLELARPDIQQGIAACVSQGAERV  63

Query  462  IVSPFFLF  485
            ++ P  LF
Sbjct  64   VLVPIILF  71



>gb|EXX87131.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
 gb|EXX88821.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
 gb|EXX89714.1| sirohydrochlorin cobaltochelatase [Paenibacillus darwinianus]
Length=305

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRI  461
            +++V HGSR  E N  L EF    +E+ +  ++E   +ELA P I+    ACV QGA R+
Sbjct  4    ILLVGHGSRDPEGNAELLEFADRVRERAQGVVIETCFLELARPDIQQGIAACVSQGAERV  63

Query  462  IVSPFFLF  485
            ++ P  LF
Sbjct  64   VLVPIILF  71



>dbj|BAL52372.1| cobalamin (vitamin B12) biosynthesis CbiX protein [uncultured 
planctomycete]
Length=147

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  267  KVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQ  446
            ++   ++++ HGSRR E+N  L    A  QE+     VE A++E+AEP+I      C++ 
Sbjct  8    QMATAILLIAHGSRRAEANAELEWVAARLQERLPGFFVEHAYLEIAEPTIAQGIARCLEH  67

Query  447  GARRIIVSPFFL  482
            G   +I+ P+FL
Sbjct  68   GVSSVILVPYFL  79



>ref|XP_002184254.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44432.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=317

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 4/78 (5%)
 Frame = +3

Query  255  RNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKT--KYPIVEPAHMELAEPSIKDAF  428
            RN  K+G  V+++DHGSR++ SN  L+     +QE       IV  AHME+A PSI D  
Sbjct  184  RNSRKLG--VLLIDHGSRKESSNKRLHALAERYQETVADSNTIVTAAHMEIATPSIADGI  241

Query  429  NACVQQGARRIIVSPFFL  482
             + ++ G   II  P+FL
Sbjct  242  VSLLEAGVDEIICHPYFL  259



>gb|AIJ06099.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus sp. JH146]
Length=148

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR   S  +L +     +EK  +PIVE   ME  EP+I  A    ++QGA+
Sbjct  2    EALVLVGHGSRLPYSKELLVKLAEKVKEKNIFPIVEIGLMEFNEPTIPQAVKKAIEQGAK  61

Query  456  RIIVSPFFL  482
            +IIV P FL
Sbjct  62   KIIVVPVFL  70



>ref|WP_019395087.1| MULTISPECIES: hypothetical protein [Bacillus]
Length=258

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + V+ + HG+R ++  +   +F+   +EK   PI E   +ELAEP+I++AF  C++QGA 
Sbjct  2    EAVLYICHGTRIRDGQIGARQFIERCKEKVNVPIQEACFLELAEPTIEEAFARCIRQGAT  61

Query  456  RIIVSPFFLF  485
            +I+  P  L 
Sbjct  62   KIVAVPILLL  71



>ref|WP_013277760.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Acetohalobium 
arabaticum]
 gb|ADL12314.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Acetohalobium 
arabaticum DSM 5501]
Length=120

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GV+++ HGSR +++  + NE V M ++K  Y +V+ A MELAEPS++   +    +   +
Sbjct  4    GVVVLGHGSRAEDARSVFNEIVEMIEDKVDYEVVKGASMELAEPSLEQVVDQIADE-VDK  62

Query  459  IIVSPFFLF  485
            I + P FLF
Sbjct  63   ISIVPLFLF  71



>ref|WP_029518590.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=361

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI D    CV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFTQAVADRVPDMCVETCFLELARPSIADGMQTCVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 46/91 (51%), Gaps = 3/91 (3%)
 Frame = +3

Query  222  LAIANGGFRGERNCIKVGD---GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAH  392
            +A+  G        ++V D    V+++  GS   ++N    +   M  EK  Y  VE + 
Sbjct  122  VAVPAGMNSAVEASVEVSDEETAVLVLGRGSSDPDANSDFFKITRMLWEKLPYTWVESSF  181

Query  393  MELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
            + + +PS  D    CV+ GA++IIV P+FLF
Sbjct  182  IGVTQPSFPDGLERCVRLGAKKIIVLPYFLF  212



>ref|WP_015791410.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus fervens]
 ref|YP_003128173.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus fervens 
AG86]
 gb|ACV24673.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Methanocaldococcus 
fervens AG86]
Length=147

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR   S  +L +     +EK  +PIVE   ME  EP+I  A    ++QGA+
Sbjct  2    EALVLVGHGSRLPYSKELLVKLAEKVKEKNIFPIVEIGLMEFNEPTIPQAVKKAIEQGAK  61

Query  456  RIIVSPFFL  482
            ++IV P FL
Sbjct  62   KVIVVPVFL  70



>ref|WP_039271661.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
 gb|KEO78732.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=351

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI D    CV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRVPDMCVETCFLELARPSIADGMQTCVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  E+  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEQLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_015863807.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. WCH70]
 gb|ACS24348.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Geobacillus 
sp. WCH70]
Length=277

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  G    ++N  L +   +F E+T Y +VEPA M +  PS++D    CV+ GAR+
Sbjct  132  AVVLLGRGGSDPDANSDLYKISRLFWEQTNYFLVEPAFMGVTTPSLEDGVERCVKLGARK  191

Query  459  IIVSPFFLF  485
            ++V P+FLF
Sbjct  192  VVVLPYFLF  200



>ref|WP_017434177.1| sirohydrochlorin cobaltochelatase [Geobacillus caldoxylosilyticus]
Length=275

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  G    ++N  L +   +F E+T Y +VEPA M +  PS++D    CV+ GAR+
Sbjct  132  AVVLLGRGGSDPDANSDLYKISRLFWEQTNYFLVEPAFMGVTTPSLEDGVERCVKLGARK  191

Query  459  IIVSPFFLF  485
            ++V P+FLF
Sbjct  192  VVVLPYFLF  200


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPI-VEPAHMELAEPSIKDAFNACVQQGAR  455
             V+ V HGSR  E N  + +FV   +   K  I VE + +E   P+I+   + CV  GAR
Sbjct  3    AVLFVGHGSRDPEGNNQVRQFVEQLKPSIKTSIHVETSFLEFGLPTIRGGIDRCVAAGAR  62

Query  456  RIIVSPFFLF  485
             IIV P  L 
Sbjct  63   EIIVIPMILL  72



>ref|WP_025719598.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=353

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI D    CV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRVPDMCVETCFLELARPSIADGMKTCVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  E+  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEQLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_004591394.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus villosus]
 gb|ENN96173.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus villosus 
KIN24-T80]
Length=123

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +I+V HGSR   S  ++ +     +E+  +PIVE   ME  EP+I  A    ++ GA+
Sbjct  2    EALILVGHGSRYPYSKELMEKIAEKIRERNLFPIVEIGMMEFNEPTIPQALKKVIEMGAK  61

Query  456  RIIVSPFFL  482
            RIIV P FL
Sbjct  62   RIIVVPVFL  70



>ref|WP_043882384.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=385

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI D    CV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRVPDMYVETCFLELARPSIADGMQTCVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  E+  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEQLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_025678200.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=343

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  +E + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWIESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_043107510.1| cobalamin biosynthesis protein CbiX [endosymbiont of unidentified 
scaly snail isolate Monju]
 dbj|BAN68768.1| cobalamin biosynthesis CbiX protein [endosymbiont of unidentified 
scaly snail isolate Monju]
Length=127

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKT--KYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            ++IV HGSRR  SN  + +  A   E    ++  V+ A +ELAEPSI D   AC+  GA 
Sbjct  4    LLIVAHGSRRVSSNDEVRDLAARVGELAGGRFDRVQAAFLELAEPSIPDGIQACIDAGAD  63

Query  456  RIIVSPFFL  482
             ++V P+FL
Sbjct  64   EVVVMPYFL  72



>ref|WP_020959933.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. JF8]
 gb|AGT32126.1| sirohydrochlorin cobaltochelatase [Geobacillus sp. JF8]
Length=276

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  G    ++N  L +   +F E+T Y ++EPA M +  PS+ DA   C+  GA+R
Sbjct  132  AVVLLGRGGSDPDANSDLYKIARLFWEQTGYALIEPAFMGVTTPSLDDAVRRCLALGAKR  191

Query  459  IIVSPFFLF  485
            I+V P+FLF
Sbjct  192  IVVLPYFLF  200



>ref|WP_040102666.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
 gb|AJE52004.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=353

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  +E + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWIESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>gb|ADM72307.1| Sirohydrochlorin cobaltochelatase (CbiXL) [Paenibacillus polymyxa 
E681]
Length=398

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI D    CV++GA 
Sbjct  15   DAILLVGHGSRDPEGNQELLEFAQAVADRVPDMYVETCFLELARPSIADGMQTCVEKGAT  74

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  75   RVVLIPIILF  84


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  E+  Y  VE + + + +PS  D    CV+ GA++
Sbjct  157  AVLVLGRGSSDPDANSDFFKITRMLWEQLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  216

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  217  IIVLPYFLF  225



>ref|WP_040209287.1| MULTISPECIES: cobalamin biosynthesis protein CbiX [Bacillus]
Length=240

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             ++ + HG+R K+    +  FV    E+   PI E + +EL EPSI + F  CVQ+GA  
Sbjct  3    AILYIGHGTRSKKGANEVKAFVGKVMEQVDVPIQEVSFLELTEPSIAEGFRKCVQKGATE  62

Query  459  IIVSPFFLF  485
            I V P FL 
Sbjct  63   ITVVPLFLL  71



>ref|WP_017980990.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus villosus]
Length=135

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +I+V HGSR   S  ++ +     +E+  +PIVE   ME  EP+I  A    ++ GA+
Sbjct  2    EALILVGHGSRYPYSKELMEKIAEKIRERNLFPIVEIGMMEFNEPTIPQALKKVIEMGAK  61

Query  456  RIIVSPFFL  482
            RIIV P FL
Sbjct  62   RIIVVPVFL  70



>ref|WP_016324845.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
 emb|CCI71515.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa M1]
Length=358

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  +E + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWIESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_013373524.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
 gb|ADO58988.1| Sirohydrochlorin cobaltochelatase (CbiXL) [Paenibacillus polymyxa 
SC2]
Length=358

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADQAPGTCVETCFLELARPSIAEGVQACVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  +E + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWIESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_041644405.1| hypothetical protein [Mahella australiensis]
Length=135

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            DG++I+ HGSR  E++ +L       + K  Y  V  A ++   P I++A NA V +G +
Sbjct  7    DGILILAHGSRASEASYVLQSITDKVKSKWSYCPVYTASLQFEHPDIEEAVNAMVGKGIK  66

Query  456  RIIVSPFFLF  485
            RI++ P FLF
Sbjct  67   RIVLVPLFLF  76



>gb|AEE96420.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Mahella australiensis 
50-1 BON]
Length=138

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            DG++I+ HGSR  E++ +L       + K  Y  V  A ++   P I++A NA V +G +
Sbjct  10   DGILILAHGSRASEASYVLQSITDKVKSKWSYCPVYTASLQFEHPDIEEAVNAMVGKGIK  69

Query  456  RIIVSPFFLF  485
            RI++ P FLF
Sbjct  70   RIVLVPLFLF  79



>ref|WP_042407897.1| sirohydrochlorin cobaltochelatase [Geobacillus caldoxylosilyticus]
 dbj|GAJ39165.1| sirohydrochlorin cobaltochelatase [Geobacillus caldoxylosilyticus 
NBRC 107762]
Length=275

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  G    ++N  L +   +F E+T Y +VEPA M +  PS++D    CV+ GAR+
Sbjct  132  AVVLLGRGGSDPDANSDLYKISRLFWEQTNYFLVEPAFMGVTTPSLEDGVERCVKLGARK  191

Query  459  IIVSPFFLF  485
            ++V P+FLF
Sbjct  192  VVVLPYFLF  200


 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPI-VEPAHMELAEPSIKDAFNACVQQGAR  455
             V+ V HGSR  E N  + +FV   +   +  + VE + +E   P+I++  + CV  GAR
Sbjct  3    AVLFVGHGSRDPEGNDQIRQFVEQLKPHIEASLHVETSFLEFGLPTIREGIDHCVDAGAR  62

Query  456  RIIVSPFFLF  485
             IIV P  L 
Sbjct  63   EIIVIPMILL  72



>ref|WP_008637213.1| MULTISPECIES: sirohydrochlorin ferrochelatase [Bacillaceae]
 gb|ELK46124.1| sirohydrochlorin ferrochelatase [Halobacillus sp. BAB-2008]
Length=246

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGSR+KE+     +F++  QE+   P+ E   +ELAEP I++  +  V++GA 
Sbjct  2    DAVLYVSHGSRKKEATEQALDFLSKVQEEIGIPLFERCFLELAEPDIEEGIHRLVKKGAT  61

Query  456  RIIVSPFFLF  485
            RI V P  L 
Sbjct  62   RIAVLPVLLL  71



>ref|WP_042346195.1| hypothetical protein [Bacillus sp. G2(2012b)]
Length=240

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQ-EKTKYPIVEPAHMELAEPSIKDAFNACVQQGA  452
              V+ + HGSRRK S      F+   Q E ++ PIVE   +ELA P+I+D F +C++QGA
Sbjct  2    QAVLFICHGSRRKVSCAEAIAFMKECQNEFSQIPIVEYGFLELATPTIEDGFESCIKQGA  61

Query  453  RRIIVSPFFLF  485
             +I V PF L 
Sbjct  62   TKIAVVPFLLL  72



>ref|WP_012980610.1| sirohydrochlorin cobaltochelatase [Methanocaldococcus sp. FS406-22]
 ref|YP_003458437.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Methanocaldococcus 
sp. FS406-22]
 gb|ADC69701.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Methanocaldococcus 
sp. FS406-22]
Length=147

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR   S  +L +     +E+  +PIVE   ME  EP+I  A    ++QGA+
Sbjct  2    EALVLVGHGSRLPYSKELLVKLAEKVKERNIFPIVEIGLMEFNEPTIPQAVKKAIEQGAK  61

Query  456  RIIVSPFFL  482
            +IIV P FL
Sbjct  62   KIIVVPVFL  70



>ref|WP_004891937.1| sirohydrochlorin cobaltochelatase [Anoxybacillus flavithermus]
 gb|ELK21113.1| sirohydrochlorin cobaltochelatase [Anoxybacillus flavithermus 
TNO-09.006]
Length=277

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             +I++  G    ++N  L +   +F E+ K  IVEPA M +  PS+ +A + C++ GA+R
Sbjct  129  AIILLGRGGSDPDANSDLYKIARLFWERNKQTIVEPAFMGVTNPSLDEAIDRCIKLGAKR  188

Query  459  IIVSPFFLF  485
            I++ P+FLF
Sbjct  189  IVILPYFLF  197



>ref|WP_028309103.1| hypothetical protein [Desulfitibacter alkalitolerans]
Length=124

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            +GVI++ HGSRR+E+N  + +   M QE  K  + E A +    P + DA    +++G  
Sbjct  3    EGVILLGHGSRREEANEEIRQMARMIQETDKDGLYEVAFLSFGHPHLADAAETLIEKGCE  62

Query  456  RIIVSPFFL  482
            +IIV P FL
Sbjct  63   KIIVMPMFL  71



>ref|WP_028400402.1| sirohydrochlorin ferrochelatase [Bacillus panaciterrae]
Length=252

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
              V+ V HGSR KE+      FV    EK   PI E   +ELAEPSI + F ACV++GA 
Sbjct  2    QAVLYVCHGSRVKEACEQARFFVTQCMEKVDAPIQEVCFLELAEPSIAEGFAACVEKGAT  61

Query  456  RIIVSPFFLF  485
             I V P  L 
Sbjct  62   HIAVVPVLLL  71



>ref|WP_040979252.1| cobalamin biosynthesis protein CbiX, partial [Oceanobacillus 
sp. S5]
Length=234

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D VI + HGSRR+E N     F+    E+   P  E A +EL  P+I +A    + QGA+
Sbjct  3    DAVIYIGHGSRREEGNAQFKRFIESVMEEVACPKQEIAFLELTNPTIAEALENLIAQGAK  62

Query  456  RIIVSPFFLF  485
            R ++ P  LF
Sbjct  63   RFLIVPVLLF  72



>ref|WP_007044825.1| sirohydrochlorin cobaltochelatase [Methanotorris formicicus]
 gb|EHP85320.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Methanotorris 
formicicus Mc-S-70]
Length=144

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR   S  ++ +     + K  YPIVE   ME  EP+I  A    ++QGA+
Sbjct  2    EALVLVGHGSRLPYSKEIVEKIAEKIKAKNIYPIVEVGMMEFNEPTIPQAVKKAIEQGAK  61

Query  456  RIIVSPFFL  482
            +IIV P FL
Sbjct  62   KIIVVPVFL  70



>ref|WP_003352908.1| hypothetical protein [Bacillus smithii]
 gb|EHL79119.1| hypothetical protein HMPREF1015_01417 [Bacillus smithii 7_3_47FAA]
Length=253

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+ + HGSR K+      EFV   Q++   PI E A +ELA P+IKDAF  C+++GA  
Sbjct  3    AVLYICHGSRVKKGCEQAIEFVRQVQKEISIPIQEIAFLELARPTIKDAFLRCIEKGADE  62

Query  459  IIVSPFFLF  485
            + + P  LF
Sbjct  63   VYIIPILLF  71


 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +3

Query  264  IKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQ  443
            IK   GV++V  GS+ K+  L  NE    F++KT+Y  V+ +++  A PS ++A    V 
Sbjct  123  IKDHAGVLLVARGSKDKDMQLDFNELARRFKQKTEYFYVKTSYLTGASPSFEEALEEMVN  182

Query  444  QGA-RRIIVSPFFLF  485
            +   ++I V P+ LF
Sbjct  183  ESQLKQIFVLPYLLF  197



>gb|KHF24626.1| hypothetical protein JV46_05650 [Solemya velum gill symbiont]
Length=120

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKT--KYPIVEPAHMELAEPSIKDAFNACVQQGA  452
             +++V HGSRR+ SN  + E VA   +     + +V  A +ELAEPSI DA    + QGA
Sbjct  3    ALVVVAHGSRREASNDEVRELVARLDDSAGGTFSVVCAAFLELAEPSIPDAIVNVIDQGA  62

Query  453  RRIIVSPFFL  482
              + V P+FL
Sbjct  63   GHVTVLPYFL  72



>ref|WP_027319687.1| cobalamin biosynthesis protein CbiX [Bacillus sp. URHB0009]
Length=241

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            G++ + HG+R K+       F+   +E+   PI E + +EL EPSI++ F AC ++GA  
Sbjct  3    GILFIGHGTRSKKGAEEARLFIERVKERIDAPIQELSFLELTEPSIEEGFRACAEKGATE  62

Query  459  IIVSPFFLF  485
            I V P FL 
Sbjct  63   ITVVPLFLL  71



>ref|WP_043116871.1| cobalamin biosynthesis protein CbiX [Solemya velum gill symbiont]
Length=121

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKT--KYPIVEPAHMELAEPSIKDAFNACVQQGA  452
             +++V HGSRR+ SN  + E VA   +     + +V  A +ELAEPSI DA    + QGA
Sbjct  4    ALVVVAHGSRREASNDEVRELVARLDDSAGGTFSVVCAAFLELAEPSIPDAIVNVIDQGA  63

Query  453  RRIIVSPFFL  482
              + V P+FL
Sbjct  64   GHVTVLPYFL  73



>ref|WP_009673137.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Paenibacillus]
 gb|EGL18475.1| sirohydrochlorin cobaltochelatase [Paenibacillus sp. HGF7]
 gb|EPD89711.1| hypothetical protein HMPREF1207_01560 [Paenibacillus sp. HGH0039]
Length=392

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGSR  E N  +  FV+   E  +  I+E   +EL +P+I      CV +GA 
Sbjct  2    DAVLFVGHGSRDAEGNSEVRAFVSRLAETMEQAIIETCFLELEKPTISQGIQTCVNRGAT  61

Query  456  RIIVSPFFLF  485
            RI V P  LF
Sbjct  62   RIAVVPIILF  71


 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRI  461
            V++V  GS   ++N  L +   +  EK + P VE A + +  P +++    C++ GA+++
Sbjct  132  VLVVGRGSSDPDANSELFKISRLLWEKLQVPWVETAFIGVTAPLLENGIERCLRLGAKKV  191

Query  462  IVSPFFLF  485
            IV P+FLF
Sbjct  192  IVLPYFLF  199



>ref|WP_014278563.1| sirohydrochlorin cobaltochelatase [Paenibacillus terrae]
 gb|AET57812.1| sirohydrochlorin cobaltochelatase [Paenibacillus terrae HPL-003]
Length=363

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV+QGA 
Sbjct  2    NAILLVGHGSRDPEGNRELLEFAQAVADRVPDMCVETCFLELARPSIAEGVQACVEQGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  E+  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEQLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_013798434.1| sirohydrochlorin cobaltochelatase [Methanotorris igneus]
 ref|YP_004483890.1| Sirohydrochlorin cobaltochelatase [Methanotorris igneus Kol 5]
 gb|AEF95825.1| Sirohydrochlorin cobaltochelatase [Methanotorris igneus Kol 5]
Length=145

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR   S  ++ +     + K  YPIVE   ME  EP+I  A    ++QGA+
Sbjct  2    EALVLVGHGSRLPYSKEVVEKIAEKIRAKNIYPIVEVGMMEFNEPTIPQAVKKAIEQGAK  61

Query  456  RIIVSPFFL  482
            +IIV P FL
Sbjct  62   KIIVVPVFL  70



>ref|WP_014704010.1| cobalamin biosynthesis protein CbiX [Methylophaga frappieri]
 gb|AFJ02590.1| Sirohydrochlorin cobaltochelatase [Methylophaga frappieri]
Length=121

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 8/73 (11%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQE-----KTKYPIVEPAHMELAEPSIKDAFNACVQ  443
             ++IV HGSRR +SN   +E +A+ +      + +Y +V  A +ELAEPSI      C +
Sbjct  3    ALLIVAHGSRRNQSN---HEVMALAESLAAKCQHQYSLVMAAFLELAEPSIPTGIRVCAE  59

Query  444  QGARRIIVSPFFL  482
            QGA  +++ P+FL
Sbjct  60   QGAAEVVILPYFL  72



>ref|NP_001046609.1| Os02g0296800 [Oryza sativa Japonica Group]
 dbj|BAF08523.1| Os02g0296800 [Oryza sativa Japonica Group]
 dbj|BAG89217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=123

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  375  IVEPAHMELAEPSIKDAFNACVQQGARRIIVSPFFL  482
            IV+    ELAEP+IKDAF  CVQQGA R+IVSP+FL
Sbjct  15   IVDECVQELAEPTIKDAFGKCVQQGASRVIVSPYFL  50



>ref|WP_035300781.1| sirohydrochlorin cobaltochelatase [Brevibacillus thermoruber]
Length=332

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA    +   PI+E   +E   P +    NACV++GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEVRQFVASLAPELDVPIIETCFLEFERPDVLQGLNACVKRGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



>ref|WP_025908099.1| sirohydrochlorin ferrochelatase [Bacillus flexus]
Length=255

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ + HGSR K+      EF+   + K   PI E   +ELAEP+I+  F  CV+QGA 
Sbjct  2    DAVLYICHGSRVKKGCDQAIEFIERSKSKIDVPIQEVCFLELAEPTIEQGFKRCVEQGAT  61

Query  456  RIIVSPFFLF  485
            RI + P  L 
Sbjct  62   RIAIVPILLL  71



>ref|WP_007715908.1| sirohydrochlorin cobaltochelatase [Brevibacillus sp. BC25]
 gb|EJL32729.1| hypothetical protein PMI05_00121 [Brevibacillus sp. BC25]
Length=313

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA        PI+E   +E A P +    N CV +GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEIRQFVATLTPDLDVPIIETCFLEFARPDMLQGLNTCVAKGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



>ref|WP_004030768.1| sirohydrochlorin cobaltochelatase [Methanobacterium formicicum]
 gb|EKF85876.1| cobalamin (vitamin b12) biosynthesis cbix protein [Methanobacterium 
formicicum DSM 3637]
Length=142

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            G++++ HGS   +SN ++ +  AM++E + YP VE   M + +PSI  A N    +G  R
Sbjct  12   GILLIGHGSSLSQSNDVIYKLSAMYKETSPYP-VEVGFMNIEKPSIPTALNTLAGKGVDR  70

Query  459  IIVSPFFL  482
            II +P FL
Sbjct  71   IIAAPIFL  78



>ref|WP_003395469.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Anoxybacillus 
flavithermus]
 gb|EMT46714.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Anoxybacillus 
flavithermus AK1]
Length=274

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             +I++  G    ++N  L +   +F E+ K  IVEPA M +  PS+ +A + CV+ GA++
Sbjct  129  AIILLGRGGSDPDANSDLYKIARLFWERNKQTIVEPAFMGVTNPSLDEAVDRCVKLGAKK  188

Query  459  IIVSPFFLF  485
            I++ P+FLF
Sbjct  189  IVILPYFLF  197



>ref|WP_019688872.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=359

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV +GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVDKGAT  61

Query  456  RIIVSPFFLF  485
            R++  P  LF
Sbjct  62   RVVFIPIILF  71


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_023990791.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Paenibacillus]
 ref|YP_009097224.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa CR1]
 gb|AIW42084.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa CR1]
Length=355

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +    CV++GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRVPDMCVETCFLELARPSIAEGMQTCVEKGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLIPIILF  71


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  E+  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEQLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_034124136.1| cobalamin biosynthesis protein CbiX [Peptococcaceae bacterium 
BICA1-7]
Length=121

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            G+I++ HGSR  E+ + + E + M + K+ Y  V  A ++  +P +  A    V  G  R
Sbjct  4    GIILLSHGSRSPEAQVTVQELLEMIKIKSNYDFVTGAALQFNQPDLPAALAETVSAGMER  63

Query  459  IIVSPFFLFL  488
            IIV+P FL++
Sbjct  64   IIVAPIFLYM  73



>ref|WP_017428597.1| MULTISPECIES: sirohydrochlorin cobaltochelatase [Paenibacillus]
Length=355

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV +GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVDKGAT  61

Query  456  RIIVSPFFLF  485
            R++  P  LF
Sbjct  62   RVVFIPIILF  71


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_017247390.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis]
Length=312

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA        PI+E   +E A P +    N CV +GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEIRQFVATLTPDLDVPIIETCFLEFARPDMLQGLNTCVARGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



>ref|WP_044786211.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
 gb|KJD40418.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=357

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV +GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVDKGAT  61

Query  456  RIIVSPFFLF  485
            R++  P  LF
Sbjct  62   RVVFIPIILF  71


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_016822797.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=363

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV +GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVDKGAT  61

Query  456  RIIVSPFFLF  485
            R++  P  LF
Sbjct  62   RVVFIPIILF  71


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_031462386.1| sirohydrochlorin cobaltochelatase [Paenibacillus polymyxa]
Length=361

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D +++V HGSR  E N  L EF     ++     VE   +ELA PSI +   ACV +GA 
Sbjct  2    DAILLVGHGSRDPEGNQELLEFAQAVADRAPGTCVETCFLELARPSIAEGVQACVDKGAT  61

Query  456  RIIVSPFFLF  485
            R++  P  LF
Sbjct  62   RVVFIPIILF  71


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
             V+++  GS   ++N    +   M  EK  Y  VE + + + +PS  D    CV+ GA++
Sbjct  144  AVLVLGRGSSDPDANSDFFKITRMLWEKLSYTWVESSFIGVTQPSFPDGLERCVRLGAKK  203

Query  459  IIVSPFFLF  485
            IIV P+FLF
Sbjct  204  IIVLPYFLF  212



>ref|WP_012684974.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis]
 dbj|BAH42223.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis NBRC 
100599]
Length=312

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA        PI+E   +E A P +    N CV +GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEIRQFVATLTPDLDVPIIETCFLEFARPDMLQGLNTCVARGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



>ref|WP_028552448.1| sirohydrochlorin cobaltochelatase [Paenibacillus sp. UNC451MF]
Length=349

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + V+ V HGS+  E N  + EFV     K   PIVE   +E   P+I      CVQQGA 
Sbjct  2    NAVLFVGHGSKDAEGNEEVREFVRSIASKMDQPIVETCFLEFERPTIAQGIEQCVQQGAT  61

Query  456  RIIVSPFFLF  485
            +I V P  LF
Sbjct  62   QIAVVPITLF  71


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +3

Query  204  LAPRLCLAIANGGFRGERNCIKVGDGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVE  383
            LA RL  A    G   E    +    V++V  GS   ++N  L +   +F EK K   VE
Sbjct  112  LASRLEAAGTGSGTAAESELEQTA--VLVVGRGSSDADANSDLFKISRLFWEKLKVKWVE  169

Query  384  PAHMELAEPSIKDAFNACVQQGARRIIVSPFFLF  485
             A + +  P + +    C++ GAR+I++ P+FLF
Sbjct  170  TAFIGVTAPLVDEGIERCIKLGARKIVILPYFLF  203



>ref|WP_025715977.1| sirohydrochlorin cobaltochelatase [Paenibacillus sp. 1-18]
Length=361

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            + +++V HGSR  E N  L EF     ++     VE   +EL  PSI D   ACV++GA 
Sbjct  2    NAILLVGHGSRDPEGNEELLEFAQAVADRVPGTCVETCFLELTRPSIADGVQACVKRGAT  61

Query  456  RIIVSPFFLF  485
            R+++ P  LF
Sbjct  62   RVVLVPIILF  71


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +3

Query  282  VIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARRI  461
            V+++  GS   ++N    +   M  EK  Y  VE + + + +PS  D    CV+ GA++I
Sbjct  145  VLVLGRGSSDPDANSDFFKMSRMLWEKLPYTWVESSFIGVTQPSFSDGLERCVRLGAKKI  204

Query  462  IVSPFFLF  485
            IV P+FLF
Sbjct  205  IVLPYFLF  212



>ref|WP_016741767.1| sirohydrochlorin cobaltochelatase [Brevibacillus brevis]
Length=319

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA        PI+E   +E A P +    N CV +GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEIRQFVATLTPDLDVPIIETCFLEFARPDMLQGLNTCVARGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



>ref|WP_015326928.1| hypothetical protein [Halobacteroides halobius]
 gb|AGB41206.1| hypothetical protein Halha_1260 [Halobacteroides halobius DSM 
5150]
Length=119

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGARR  458
            GVI++ HGSR   +   L+   +  +++  YPI E A++EL +P+  DA    + QG  +
Sbjct  4    GVILLGHGSRSTAAQQELSTLSSQLKKEISYPI-EEANLELTKPNFWDAAKKLINQGINK  62

Query  459  IIVSPFFLF  485
            II+ P FLF
Sbjct  63   IIIVPLFLF  71



>ref|WP_002708045.1| cobalamin biosynthesis protein CbiX [Thiothrix nivea]
 gb|EIJ34103.1| cobalamin (vitamin B12) biosynthesis CbiX protein [Thiothrix 
nivea DSM 5205]
Length=137

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 2/71 (3%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFV--AMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQG  449
              ++I+ HGSRR ESN  +         Q    Y  V  A +ELAEPSI +    C+ QG
Sbjct  2    QALLIIAHGSRRPESNDEIRALARKVAAQSGDTYSHVSSAFLELAEPSIPNGIQQCINQG  61

Query  450  ARRIIVSPFFL  482
            A  + + PFFL
Sbjct  62   ATSVTIMPFFL  72



>ref|WP_014706051.1| cobalamin biosynthesis protein CbiX [Methylophaga nitratireducenticrescens]
 gb|AFI83676.1| Sirohydrochlorin cobaltochelatase [Methylophaga nitratireducenticrescens]
Length=122

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 8/73 (11%)
 Frame = +3

Query  279  GVIIVDHGSRRKESNLMLNEFVAMFQE-KTK----YPIVEPAHMELAEPSIKDAFNACVQ  443
             ++++ HGSRR+ SN   +E +A+ ++ KT+    Y IV+ A +ELA+  I D    CV+
Sbjct  3    ALLLIAHGSRRQRSN---DEVIALAEKLKTECAEHYDIVQAAFLELADTLIADGIENCVR  59

Query  444  QGARRIIVSPFFL  482
             GAR+I V P+FL
Sbjct  60   DGARQITVLPYFL  72



>ref|WP_042233528.1| sirohydrochlorin cobaltochelatase [Paenibacillus chitinolyticus]
Length=398

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGSR  E N  +  FV+   E  +  I+E   +EL +P+I      CV +GA 
Sbjct  2    DAVLFVGHGSRDAEGNSEVRAFVSRLAETMEQGIIETCFLELEKPTISQGIQTCVNRGAT  61

Query  456  RIIVSPFFLF  485
            RI V P  LF
Sbjct  62   RIAVVPIILF  71



>ref|WP_005831998.1| sirohydrochlorin cobaltochelatase [Brevibacillus agri]
 gb|ELK41305.1| sirohydrochlorin cobaltochelatase [Brevibacillus agri BAB-2500]
Length=313

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA    +   PI+E   +E A P +    N CV +GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEIRQFVASLAPELDVPIIETCFLEFARPDMLQGLNTCVARGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



>ref|WP_007785817.1| sirohydrochlorin cobaltochelatase [Brevibacillus sp. CF112]
 gb|EJL40613.1| hypothetical protein PMI08_04335 [Brevibacillus sp. CF112]
Length=333

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA    +   PI+E   +E A P +    N CV +GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEIRQFVASLAPELDVPIIETCFLEFARPDMLQGLNTCVARGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



>ref|WP_025847508.1| sirohydrochlorin cobaltochelatase [Brevibacillus agri]
Length=331

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +3

Query  276  DGVIIVDHGSRRKESNLMLNEFVAMFQEKTKYPIVEPAHMELAEPSIKDAFNACVQQGAR  455
            D V+ V HGS+  E N  + +FVA    +   PI+E   +E A P +    N CV +GA 
Sbjct  2    DAVLFVGHGSKDPEGNEEIRQFVASLAPELDVPIIETCFLEFARPDMLQGLNTCVARGAT  61

Query  456  RIIVSPFFLF  485
            R+ V P  LF
Sbjct  62   RVAVIPIILF  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960