BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP017A06 631 bp,

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801486.1|  PREDICTED: protein unc-50 homolog                  335   5e-113   Nicotiana sylvestris
ref|XP_009629275.1|  PREDICTED: protein unc-50 homolog                  334   2e-112   Nicotiana tomentosiformis
ref|XP_006346362.1|  PREDICTED: protein unc-50 homolog                  332   1e-111   Solanum tuberosum [potatoes]
ref|XP_011092536.1|  PREDICTED: protein unc-50 homolog isoform X1       331   2e-111   Sesamum indicum [beniseed]
ref|XP_004230735.1|  PREDICTED: protein unc-50 homolog                  330   5e-111   Solanum lycopersicum
gb|EYU42697.1|  hypothetical protein MIMGU_mgv1a012334mg                327   1e-109   Erythranthe guttata [common monkey flower]
gb|KJB47362.1|  hypothetical protein B456_008G022900                    323   2e-108   Gossypium raimondii
emb|CDO97222.1|  unnamed protein product                                323   3e-108   Coffea canephora [robusta coffee]
gb|KJB47366.1|  hypothetical protein B456_008G022900                    321   1e-107   Gossypium raimondii
ref|XP_002282581.2|  PREDICTED: protein unc-50 homolog                  319   1e-106   Vitis vinifera
ref|XP_011092537.1|  PREDICTED: protein unc-50 homolog isoform X2       316   5e-106   Sesamum indicum [beniseed]
ref|XP_007042528.1|  UNC-50 family protein isoform 1                    317   8e-106   Theobroma cacao [chocolate]
ref|XP_010271205.1|  PREDICTED: protein unc-50 homolog isoform X1       317   9e-106   Nelumbo nucifera [Indian lotus]
ref|XP_010691673.1|  PREDICTED: protein unc-50 homolog                  316   2e-105   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011001154.1|  PREDICTED: protein unc-50 homolog                  313   3e-104   Populus euphratica
emb|CBI40262.3|  unnamed protein product                                312   5e-104   Vitis vinifera
gb|KJB47365.1|  hypothetical protein B456_008G022900                    311   1e-103   Gossypium raimondii
ref|XP_004136958.1|  PREDICTED: protein unc-50 homolog                  306   1e-101   Cucumis sativus [cucumbers]
gb|AFK38140.1|  unknown                                                 306   2e-101   Lotus japonicus
ref|XP_006487004.1|  PREDICTED: protein unc-50 homolog                  305   3e-101   Citrus sinensis [Valencia orange]
ref|XP_006422931.1|  hypothetical protein CICLE_v10029109mg             305   3e-101   Citrus clementina
ref|XP_006422929.1|  hypothetical protein CICLE_v10029109mg             305   4e-101   Citrus clementina
ref|XP_010530733.1|  PREDICTED: protein unc-50 homolog                  305   5e-101   Tarenaya hassleriana [spider flower]
ref|XP_008356380.1|  PREDICTED: protein unc-50 homolog                  304   9e-101   Malus domestica [apple tree]
ref|XP_006844040.1|  hypothetical protein AMTR_s00006p00238670          303   1e-100   Amborella trichopoda
ref|XP_006379181.1|  UNC-50 family protein                              303   2e-100   Populus trichocarpa [western balsam poplar]
gb|KJB11965.1|  hypothetical protein B456_002G009400                    303   4e-100   Gossypium raimondii
gb|KEH44101.1|  UNC-50 family protein                                   303   4e-100   Medicago truncatula
ref|XP_007042529.1|  UNC-50 family protein isoform 2                    301   6e-100   Theobroma cacao [chocolate]
ref|XP_008454998.1|  PREDICTED: protein unc-50 homolog                  301   1e-99    Cucumis melo [Oriental melon]
gb|AFK46272.1|  unknown                                                 301   2e-99    Medicago truncatula
gb|KJB47364.1|  hypothetical protein B456_008G022900                    298   4e-99    Gossypium raimondii
ref|XP_008236376.1|  PREDICTED: protein unc-50 homolog                  300   6e-99    Prunus mume [ume]
ref|XP_010547978.1|  PREDICTED: protein unc-50 homolog isoform X1       298   2e-98    Tarenaya hassleriana [spider flower]
ref|XP_007201388.1|  hypothetical protein PRUPE_ppa010309mg             298   3e-98    Prunus persica
ref|XP_010057258.1|  PREDICTED: protein unc-50 homolog                  296   7e-98    Eucalyptus grandis [rose gum]
emb|CDY63605.1|  BnaCnng42360D                                          296   1e-97    Brassica napus [oilseed rape]
ref|XP_011467754.1|  PREDICTED: protein unc-50 homolog                  296   1e-97    Fragaria vesca subsp. vesca
ref|XP_009335832.1|  PREDICTED: protein unc-50 homolog                  295   2e-97    Pyrus x bretschneideri [bai li]
ref|XP_007042530.1|  UNC-50 family protein isoform 3                    291   2e-96    Theobroma cacao [chocolate]
ref|XP_010928386.1|  PREDICTED: protein unc-50 homolog isoform X1       293   2e-96    Elaeis guineensis
ref|XP_004496941.1|  PREDICTED: protein unc-50 homolog                  293   2e-96    Cicer arietinum [garbanzo]
ref|NP_001235443.1|  uncharacterized protein LOC100500001               293   3e-96    Glycine max [soybeans]
gb|KHN42364.1|  Protein unc-50 like                                     293   3e-96    Glycine soja [wild soybean]
emb|CDY48219.1|  BnaA07g03880D                                          291   1e-95    Brassica napus [oilseed rape]
ref|XP_009102331.1|  PREDICTED: protein unc-50 homolog                  290   2e-95    Brassica rapa
ref|XP_007143055.1|  hypothetical protein PHAVU_007G039900g             290   3e-95    Phaseolus vulgaris [French bean]
ref|XP_003555962.1|  PREDICTED: protein unc-50 homolog                  290   4e-95    Glycine max [soybeans]
gb|KJB11964.1|  hypothetical protein B456_002G009400                    285   2e-94    Gossypium raimondii
gb|KJB11966.1|  hypothetical protein B456_002G009400                    286   4e-94    Gossypium raimondii
ref|XP_002885951.1|  hypothetical protein ARALYDRAFT_899735             286   1e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_002298750.2|  hypothetical protein POPTR_0001s30740g             284   6e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010488944.1|  PREDICTED: protein unc-50 homolog                  284   7e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010467286.1|  PREDICTED: protein unc-50 homolog                  284   7e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010518032.1|  PREDICTED: protein unc-50 homolog                  284   8e-93    Camelina sativa [gold-of-pleasure]
ref|XP_006409583.1|  hypothetical protein EUTSA_v10022824mg             282   3e-92    Eutrema salsugineum
ref|XP_009396396.1|  PREDICTED: protein unc-50 homolog                  281   5e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011030395.1|  PREDICTED: protein unc-50 homolog                  281   7e-92    Populus euphratica
gb|EPS67574.1|  hypothetical protein M569_07201                         281   8e-92    Genlisea aurea
emb|CDY52420.1|  BnaCnng22410D                                          281   1e-91    Brassica napus [oilseed rape]
ref|XP_009123230.1|  PREDICTED: protein unc-50 homolog                  281   1e-91    Brassica rapa
gb|AAM61449.1|  unknown                                                 276   6e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518676.1|  conserved hypothetical protein                     272   1e-89    
ref|NP_565370.1|  UNC-50 family protein                                 275   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956281.1|  PREDICTED: protein unc-50 homolog                  273   1e-88    Setaria italica
ref|XP_008651375.1|  PREDICTED: uncharacterized protein LOC100280...    273   2e-88    Zea mays [maize]
ref|XP_006660415.1|  PREDICTED: protein unc-50 homolog                  272   4e-88    Oryza brachyantha
ref|XP_008799595.1|  PREDICTED: protein unc-50 homolog isoform X2       271   4e-88    Phoenix dactylifera
ref|XP_002462031.1|  hypothetical protein SORBIDRAFT_02g013040          270   2e-87    Sorghum bicolor [broomcorn]
ref|NP_001062566.1|  Os09g0109500                                       269   4e-87    
ref|XP_003576742.1|  PREDICTED: protein unc-50 homolog                  269   5e-87    Brachypodium distachyon [annual false brome]
gb|ABK21352.1|  unknown                                                 268   8e-87    Picea sitchensis
ref|XP_006296617.1|  hypothetical protein CARUB_v10014338mg             270   8e-87    Capsella rubella
ref|XP_001773436.1|  predicted protein                                  262   3e-84    Physcomitrella patens
gb|ACN35099.1|  unknown                                                 261   8e-84    Zea mays [maize]
gb|KHG13402.1|  Protein unc-50                                          255   8e-82    Gossypium arboreum [tree cotton]
ref|XP_010271213.1|  PREDICTED: protein unc-50 homolog isoform X2       248   2e-79    Nelumbo nucifera [Indian lotus]
ref|XP_001783677.1|  predicted protein                                  248   9e-79    Physcomitrella patens
gb|KHN06766.1|  Protein unc-50 like                                     243   3e-77    Glycine soja [wild soybean]
ref|XP_010547979.1|  PREDICTED: protein unc-50 homolog isoform X2       238   3e-75    Tarenaya hassleriana [spider flower]
ref|XP_010928388.1|  PREDICTED: protein unc-50 homolog isoform X3       236   1e-74    Elaeis guineensis
ref|XP_010928387.1|  PREDICTED: protein unc-50 homolog isoform X2       234   7e-74    Elaeis guineensis
gb|KJB47363.1|  hypothetical protein B456_008G022900                    233   2e-73    Gossypium raimondii
gb|ABK24141.1|  unknown                                                 227   6e-71    Picea sitchensis
tpg|DAA60647.1|  TPA: hypothetical protein ZEAMMB73_532880              223   1e-69    Zea mays [maize]
ref|XP_002963517.1|  hypothetical protein SELMODRAFT_165762             224   2e-69    Selaginella moellendorffii
ref|XP_002981564.1|  hypothetical protein SELMODRAFT_114708             221   2e-68    Selaginella moellendorffii
ref|XP_010096286.1|  hypothetical protein L484_027024                   219   7e-67    Morus notabilis
gb|ADI46868.1|  UNC50f                                                  199   1e-59    Volvox carteri f. nagariensis
ref|XP_008338222.1|  PREDICTED: protein unc-50 homolog                  193   6e-59    Malus domestica [apple tree]
ref|XP_005652231.1|  UNC-50                                             197   6e-59    Coccomyxa subellipsoidea C-169
gb|ADI46908.1|  UNC50m                                                  196   1e-58    Volvox carteri f. nagariensis
emb|CDX98085.1|  BnaA06g08360D                                          189   1e-57    Brassica napus [oilseed rape]
gb|ACU18710.1|  unknown                                                 189   3e-57    Glycine max [soybeans]
dbj|BAK01787.1|  predicted protein                                      191   5e-57    Hordeum vulgare subsp. vulgare [barley]
ref|XP_005716895.1|  unnamed protein product                            191   2e-56    Chondrus crispus [Irish moss]
ref|XP_002503978.1|  unc-50 family protein                              190   4e-56    Micromonas commoda
ref|XP_003054963.1|  unc-50 family protein                              188   9e-56    Micromonas pusilla CCMP1545
dbj|GAM19513.1|  hypothetical protein SAMD00019534_026880               186   2e-54    Acytostelium subglobosum LB1
ref|NP_001146770.1|  uncharacterized protein LOC100280372               181   3e-54    Zea mays [maize]
ref|XP_008799585.1|  PREDICTED: protein unc-50 homolog isoform X1       185   1e-53    
ref|XP_001696427.1|  UNC-50 family protein                              183   1e-53    Chlamydomonas reinhardtii
gb|EFA81996.1|  UNC-50 family protein                                   180   8e-53    Polysphondylium pallidum PN500
gb|EMS49427.1|  hypothetical protein TRIUR3_32733                       180   2e-52    Triticum urartu
ref|XP_003082233.1|  putative UNC50 (ISS)                               177   8e-51    Ostreococcus tauri
ref|XP_005848175.1|  hypothetical protein CHLNCDRAFT_22928              174   4e-50    Chlorella variabilis
gb|KEH44100.1|  UNC-50 family protein                                   171   1e-49    Medicago truncatula
gb|KIZ03662.1|  putative Protein unc-50 like protein                    172   2e-49    Monoraphidium neglectum
ref|XP_629704.1|  UNC-50 family protein                                 172   4e-49    Dictyostelium discoideum AX4
ref|XP_003294507.1|  hypothetical protein DICPUDRAFT_159511             170   3e-48    Dictyostelium purpureum
gb|EXX54778.1|  Gmh1p                                                   169   2e-47    Rhizophagus irregularis DAOM 197198w
ref|XP_005819408.1|  hypothetical protein GUITHDRAFT_121394             160   6e-46    Guillardia theta CCMP2712
ref|XP_001420594.1|  predicted protein                                  159   4e-44    Ostreococcus lucimarinus CCE9901
emb|CDH59652.1|  unc-50-like protein                                    159   6e-44    Lichtheimia corymbifera JMRC:FSU:9682
gb|ESA04707.1|  hypothetical protein GLOINDRAFT_38971                   154   9e-43    Rhizophagus irregularis DAOM 181602
gb|EPB86721.1|  hypothetical protein HMPREF1544_06507                   153   6e-42    Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN07871.1|  UNC-50-like protein                                    154   6e-42    Mucor ambiguus
ref|XP_008612241.1|  hypothetical protein SDRG_08150                    153   2e-41    Saprolegnia diclina VS20
emb|CDS07387.1|  hypothetical protein LRAMOSA01336                      152   2e-41    Lichtheimia ramosa
dbj|GAN10508.1|  UNC-50-like protein                                    152   3e-41    Mucor ambiguus
ref|XP_009537820.1|  hypothetical protein PHYSODRAFT_565867             152   5e-41    Phytophthora sojae
gb|EMS24311.1|  UNC-50-like protein                                     150   7e-41    Rhodotorula toruloides NP11
ref|XP_006676512.1|  hypothetical protein BATDEDRAFT_9454               150   9e-41    Batrachochytrium dendrobatidis JAM81
gb|EPB86813.1|  hypothetical protein HMPREF1544_06429                   149   2e-40    Mucor circinelloides f. circinelloides 1006PhL
gb|ETL47305.1|  hypothetical protein L916_02928                         150   2e-40    Phytophthora parasitica
ref|XP_008916126.1|  hypothetical protein PPTG_19429                    150   2e-40    Phytophthora parasitica INRA-310
emb|CDH60549.1|  unc-50-like protein                                    149   3e-40    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007383729.1|  UNC-50-like protein                                149   5e-40    Punctularia strigosozonata HHB-11173 SS5
ref|XP_002899351.1|  transmembrane protein, putative                    149   6e-40    Phytophthora infestans T30-4
gb|KDO25449.1|  hypothetical protein SPRG_09392                         151   6e-40    Saprolegnia parasitica CBS 223.65
ref|XP_004354055.1|  hypothetical protein ACA1_165790                   147   1e-39    Acanthamoeba castellanii str. Neff
emb|CDS07641.1|  hypothetical protein LRAMOSA01590                      145   2e-39    Lichtheimia ramosa
gb|KIM42215.1|  hypothetical protein M413DRAFT_444663                   146   3e-39    Hebeloma cylindrosporum h7
gb|KIY48492.1|  UNC-50 protein                                          144   3e-38    Fistulina hepatica ATCC 64428
gb|KIL62269.1|  hypothetical protein M378DRAFT_165972                   143   4e-38    Amanita muscaria Koide BX008
emb|CDO71142.1|  hypothetical protein BN946_scf184845.g12               142   8e-38    Trametes cinnabarina
ref|XP_010727867.1|  PREDICTED: protein unc-50 homolog                  142   1e-37    Larimichthys crocea [croceine croaker]
ref|XP_002112386.1|  hypothetical protein TRIADDRAFT_24802              141   1e-37    Trichoplax adhaerens
gb|EPT05753.1|  hypothetical protein FOMPIDRAFT_1111164                 141   2e-37    Fomitopsis pinicola FP-58527 SS1
emb|CCA22710.1|  transmembrane protein putative                         143   3e-37    Albugo laibachii Nc14
emb|CDR40017.1|  CYFA0S04e01750g1_1                                     142   3e-37    Cyberlindnera fabianii
gb|KFH64319.1|  hypothetical protein MVEG_10144                         142   3e-37    Mortierella verticillata NRRL 6337
ref|XP_002611641.1|  hypothetical protein BRAFLDRAFT_63694              140   6e-37    Branchiostoma floridae
ref|XP_007313694.1|  hypothetical protein SERLADRAFT_457222             140   7e-37    Serpula lacrymans var. lacrymans S7.9
ref|XP_007501158.1|  PREDICTED: protein unc-50 homolog isoform X2       140   8e-37    Monodelphis domestica
ref|XP_007370707.1|  UNC-50-like protein                                139   1e-36    Dichomitus squalens LYAD-421 SS1
ref|XP_008045490.1|  UNC-50-like protein                                139   1e-36    Trametes versicolor FP-101664 SS1
gb|KIJ99107.1|  hypothetical protein K443DRAFT_680257                   139   1e-36    Laccaria amethystina LaAM-08-1
ref|XP_011401270.1|  Unc-50-like protein                                138   1e-36    Auxenochlorella protothecoides
gb|KII91286.1|  hypothetical protein PLICRDRAFT_38019                   139   3e-36    Plicaturopsis crispa FD-325 SS-3
ref|XP_001636568.1|  predicted protein                                  139   3e-36    Nematostella vectensis
ref|XP_001838985.2|  hypothetical protein CC1G_05538                    138   3e-36    Coprinopsis cinerea okayama7#130
ref|XP_003218830.1|  PREDICTED: protein unc-50 homolog                  139   3e-36    Anolis carolinensis [Carolina anole]
ref|XP_001884712.1|  predicted protein                                  137   3e-36    Laccaria bicolor S238N-H82
ref|XP_009664646.1|  PREDICTED: protein unc-50 homolog                  138   4e-36    Struthio camelus australis
ref|XP_008978360.1|  PREDICTED: protein unc-50 homolog isoform X2       138   4e-36    Callithrix jacchus [common marmoset]
ref|XP_009552003.1|  hypothetical protein HETIRDRAFT_436750             138   4e-36    Heterobasidion irregulare TC 32-1
ref|NP_956541.1|  protein unc-50 homolog                                138   5e-36    Danio rerio [leopard danio]
ref|XP_008844068.1|  PREDICTED: protein unc-50 homolog                  138   5e-36    Nannospalax galili
ref|XP_007197375.1|  PREDICTED: protein unc-50 homolog                  138   5e-36    Balaenoptera acutorostrata scammoni
gb|KDQ59999.1|  hypothetical protein JAAARDRAFT_592665                  138   6e-36    Jaapia argillacea MUCL 33604
ref|XP_003765692.1|  PREDICTED: protein unc-50 homolog                  140   6e-36    Sarcophilus harrisii
ref|XP_001363404.2|  PREDICTED: protein unc-50 homolog isoform X1       140   6e-36    Monodelphis domestica
gb|EMD34649.1|  hypothetical protein CERSUDRAFT_116823                  137   8e-36    Gelatoporia subvermispora B
ref|XP_007244197.1|  PREDICTED: protein unc-50 homolog                  139   8e-36    Astyanax mexicanus [blind cave fish]
ref|XP_006870815.1|  PREDICTED: protein unc-50 homolog                  137   1e-35    Chrysochloris asiatica
ref|XP_005948786.1|  PREDICTED: protein unc-50 homolog isoform X2       136   1e-35    Haplochromis burtoni
gb|EWM29534.1|  unc-50 family protein                                   137   1e-35    Nannochloropsis gaditana
ref|XP_005855343.1|  unc-50 family protein                              137   1e-35    Nannochloropsis gaditana CCMP526
ref|XP_009982050.1|  PREDICTED: protein unc-50 homolog                  137   2e-35    Tauraco erythrolophus
ref|NP_001290995.1|  unc-50 homolog                                     137   2e-35    Esox lucius
ref|XP_007109671.1|  PREDICTED: protein unc-50 homolog isoform X3       136   2e-35    Physeter catodon
ref|NP_620274.1|  protein unc-50 homolog                                136   2e-35    Rattus norvegicus [brown rat]
ref|XP_007069043.1|  PREDICTED: protein unc-50 homolog                  136   2e-35    Chelonia mydas [green seaturtle]
gb|KDQ22505.1|  hypothetical protein PLEOSDRAFT_1068813                 136   2e-35    Pleurotus ostreatus PC15
ref|XP_009694201.1|  PREDICTED: protein unc-50 homolog                  136   2e-35    Cariama cristata
ref|XP_004686209.1|  PREDICTED: protein unc-50 homolog                  136   2e-35    Condylura cristata
emb|CAB45714.1|  hypothetical protein                                   136   2e-35    Homo sapiens [man]
ref|XP_004369383.1|  PREDICTED: protein unc-50 homolog                  136   3e-35    Trichechus manatus latirostris
ref|XP_006137461.1|  PREDICTED: protein unc-50 homolog isoform X1       136   3e-35    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010350355.1|  PREDICTED: protein unc-50 homolog isoform X2       135   3e-35    Saimiri boliviensis boliviensis
emb|CCI42182.1|  unnamed protein product                                142   3e-35    Albugo candida
ref|XP_009280084.1|  PREDICTED: protein unc-50 homolog isoform X2       135   3e-35    Aptenodytes forsteri
ref|XP_005400780.1|  PREDICTED: protein unc-50 homolog isoform X1       136   3e-35    Chinchilla lanigera
ref|XP_009321854.1|  PREDICTED: protein unc-50 homolog                  136   3e-35    Pygoscelis adeliae
ref|XP_010145856.1|  PREDICTED: protein unc-50 homolog                  136   3e-35    Eurypyga helias
ref|XP_002920011.1|  PREDICTED: protein unc-50 homolog                  135   3e-35    Ailuropoda melanoleuca
ref|NP_001014921.1|  protein unc-50 homolog                             136   3e-35    Bos taurus [bovine]
ref|XP_009865405.1|  PREDICTED: protein unc-50 homolog                  135   4e-35    Apaloderma vittatum
ref|XP_005400781.1|  PREDICTED: protein unc-50 homolog isoform X2       135   4e-35    Chinchilla lanigera
ref|XP_010163802.1|  PREDICTED: protein unc-50 homolog                  135   4e-35    Caprimulgus carolinensis
ref|XP_004315897.1|  PREDICTED: protein unc-50 homolog isoform 2        135   4e-35    Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004277814.1|  PREDICTED: protein unc-50 homolog isoform 2        135   4e-35    Orcinus orca [Orca]
ref|XP_005228739.1|  PREDICTED: protein unc-50 homolog                  135   4e-35    Falco peregrinus [Wanderfalke]
ref|XP_006712467.1|  PREDICTED: protein unc-50 homolog isoform X3       135   4e-35    
ref|XP_005575107.1|  PREDICTED: protein unc-50 homolog isoform X2       134   4e-35    
ref|XP_002811726.1|  PREDICTED: protein unc-50 homolog                  135   4e-35    Pongo abelii [Orang-utan]
ref|XP_006177666.1|  PREDICTED: protein unc-50 homolog                  135   4e-35    Camelus ferus
ref|XP_008530515.1|  PREDICTED: protein unc-50 homolog isoform X2       134   4e-35    Equus przewalskii [Przewalski horse]
ref|XP_011272571.1|  putative membrane protein                          136   5e-35    Wickerhamomyces ciferrii
ref|NP_054763.2|  protein unc-50 homolog                                135   5e-35    Homo sapiens [man]
ref|XP_004277813.1|  PREDICTED: protein unc-50 homolog isoform 1        135   5e-35    
ref|XP_008496291.1|  PREDICTED: protein unc-50 homolog                  135   5e-35    Calypte anna
gb|KIK55005.1|  hypothetical protein GYMLUDRAFT_176255                  135   5e-35    Gymnopus luxurians FD-317 M1
ref|XP_006734278.1|  PREDICTED: protein unc-50 homolog isoform X3       135   5e-35    Leptonychotes weddellii
ref|XP_004704408.1|  PREDICTED: protein unc-50 homolog                  135   5e-35    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003794391.1|  PREDICTED: protein unc-50 homolog                  135   5e-35    Otolemur garnettii
ref|XP_004315896.1|  PREDICTED: protein unc-50 homolog isoform 1        135   5e-35    Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_005502640.1|  PREDICTED: protein unc-50 homolog                  135   5e-35    Columba livia [carrier pigeon]
ref|XP_007957650.1|  PREDICTED: protein unc-50 homolog                  135   5e-35    Orycteropus afer afer
ref|XP_006166648.1|  PREDICTED: protein unc-50 homolog                  135   5e-35    Tupaia chinensis
ref|XP_009635948.1|  PREDICTED: protein unc-50 homolog                  135   5e-35    Egretta garzetta
ref|XP_003124957.1|  PREDICTED: protein unc-50 homolog isoform 2        135   5e-35    Sus scrofa [pigs]
ref|XP_009470844.1|  PREDICTED: protein unc-50 homolog                  135   6e-35    Nipponia nippon
ref|XP_009501868.1|  PREDICTED: protein unc-50 homolog                  135   6e-35    Phalacrocorax carbo [common cormorant]
ref|XP_010135874.1|  PREDICTED: protein unc-50 homolog                  135   6e-35    Buceros rhinoceros silvestris
gb|KFP47788.1|  Protein unc-50                                          135   6e-35    Cathartes aura
gb|EFB24064.1|  hypothetical protein PANDA_008691                       135   6e-35    Ailuropoda melanoleuca
ref|XP_009556227.1|  PREDICTED: protein unc-50 homolog                  135   6e-35    Cuculus canorus
ref|XP_009996985.1|  PREDICTED: protein unc-50 homolog                  135   6e-35    Chaetura pelagica
ref|XP_007109670.1|  PREDICTED: protein unc-50 homolog isoform X2       135   6e-35    Physeter catodon
ref|XP_006712466.1|  PREDICTED: protein unc-50 homolog isoform X2       135   6e-35    Homo sapiens [man]
ref|XP_004575434.1|  PREDICTED: protein unc-50 homolog                  135   6e-35    Maylandia zebra
ref|XP_005750571.1|  PREDICTED: protein unc-50 homolog                  135   6e-35    Pundamilia nyererei
ref|XP_005706262.1|  UNC-50 family protein isoform 1                    134   6e-35    Galdieria sulphuraria
ref|XP_010070908.1|  PREDICTED: protein unc-50 homolog                  135   7e-35    Pterocles gutturalis
ref|XP_006980507.1|  PREDICTED: protein unc-50 homolog                  135   7e-35    Peromyscus maniculatus bairdii
ref|XP_005977165.1|  PREDICTED: protein unc-50 homolog                  135   7e-35    Pantholops hodgsonii
ref|XP_007263761.1|  UNC-50-like protein                                135   7e-35    Fomitiporia mediterranea MF3/22
ref|XP_005263970.1|  PREDICTED: protein unc-50 homolog isoform X1       135   7e-35    
ref|XP_005212372.1|  PREDICTED: protein unc-50 homolog isoform X3       135   7e-35    Bos taurus [bovine]
gb|ELR46035.1|  Protein unc-50-like protein                             135   7e-35    Bos mutus
ref|XP_008322929.1|  PREDICTED: protein unc-50 homolog                  135   7e-35    Cynoglossus semilaevis
ref|XP_006807177.1|  PREDICTED: LOW QUALITY PROTEIN: protein unc-...    135   7e-35    Neolamprologus brichardi [lyretail cichlid]
ref|XP_010310695.1|  PREDICTED: protein unc-50 homolog                  135   8e-35    Balearica regulorum gibbericeps
gb|ACI66574.1|  unc-50 homolog                                          135   8e-35    Salmo salar
ref|XP_010014017.1|  PREDICTED: protein unc-50 homolog                  135   8e-35    Nestor notabilis
ref|XP_009280076.1|  PREDICTED: protein unc-50 homolog isoform X1       135   8e-35    Aptenodytes forsteri
gb|EDL14524.1|  unc-50 homolog (C. elegans), isoform CRA_b              135   8e-35    Mus musculus [mouse]
ref|XP_006203938.1|  PREDICTED: protein unc-50 homolog                  135   8e-35    Vicugna pacos
ref|XP_005075445.1|  PREDICTED: protein unc-50 homolog                  135   8e-35    Mesocricetus auratus [Syrian golden hamster]
ref|NP_001167379.1|  protein unc-50 homolog                             135   8e-35    Salmo salar
ref|XP_006734276.1|  PREDICTED: protein unc-50 homolog isoform X1       135   8e-35    Leptonychotes weddellii
gb|KFZ63733.1|  Protein unc-50                                          135   8e-35    Podiceps cristatus
ref|XP_854439.1|  PREDICTED: protein unc-50 homolog isoform X2          135   8e-35    Canis lupus familiaris [dogs]
ref|XP_005359995.1|  PREDICTED: protein unc-50 homolog                  135   8e-35    Microtus ochrogaster [prairie voles]
ref|XP_004006198.1|  PREDICTED: protein unc-50 homolog                  135   8e-35    Ovis aries [domestic sheep]
ref|NP_080399.1|  protein unc-50 homolog                                135   9e-35    Mus musculus [mouse]
ref|XP_010360424.1|  PREDICTED: protein unc-50 homolog isoform X2       134   9e-35    Rhinopithecus roxellana
ref|XP_007308896.1|  UNC-50-like protein                                134   9e-35    Stereum hirsutum FP-91666 SS1
gb|KFQ83584.1|  Protein unc-50                                          135   9e-35    Phoenicopterus ruber ruber
ref|XP_007615954.1|  PREDICTED: protein unc-50 homolog isoform X3       135   9e-35    Cricetulus griseus [Chinese hamsters]
ref|XP_010118916.1|  PREDICTED: protein unc-50 homolog                  135   9e-35    Chlamydotis macqueenii
ref|XP_004669848.1|  PREDICTED: protein unc-50 homolog                  135   9e-35    Jaculus jaculus
ref|XP_005862265.1|  PREDICTED: protein unc-50 homolog isoform X1       133   9e-35    Myotis brandtii
ref|XP_009078456.1|  PREDICTED: protein unc-50 homolog                  134   9e-35    Acanthisitta chloris
ref|XP_006059966.1|  PREDICTED: protein unc-50 homolog                  134   9e-35    Bubalus bubalis [domestic water buffalo]
ref|XP_003455933.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Oreochromis niloticus
ref|XP_003413641.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Loxodonta africana [African bush elephant]
ref|XP_004474431.1|  PREDICTED: protein unc-50 homolog isoform 3        133   1e-34    
ref|XP_006734277.1|  PREDICTED: protein unc-50 homolog isoform X2       134   1e-34    Leptonychotes weddellii
ref|XP_004400190.1|  PREDICTED: protein unc-50 homolog isoform 1        134   1e-34    Odobenus rosmarus divergens
ref|XP_005811435.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Xiphophorus maculatus
ref|XP_005706263.1|  UNC-50 family protein isoform 2                    134   1e-34    Galdieria sulphuraria
ref|XP_005686328.1|  PREDICTED: protein unc-50 homolog isoform X1       134   1e-34    Capra hircus [domestic goat]
ref|XP_010725972.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Meleagris gallopavo [common turkey]
ref|XP_007466942.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Lipotes vexillifer [baiji]
ref|XP_004752941.1|  PREDICTED: protein unc-50 homolog isoform X1       134   1e-34    Mustela putorius furo [black ferret]
ref|XP_009578261.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Fulmarus glacialis
ref|XP_002710038.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Oryctolagus cuniculus [European rabbit]
ref|XP_005151440.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Melopsittacus undulatus
ref|XP_010574054.1|  PREDICTED: protein unc-50 homolog isoform X2       134   1e-34    Haliaeetus leucocephalus
ref|XP_010574055.1|  PREDICTED: protein unc-50 homolog isoform X3       133   1e-34    Haliaeetus leucocephalus
ref|XP_003471703.1|  PREDICTED: protein unc-50 homolog isoform X1       134   1e-34    Cavia porcellus [guinea pig]
ref|XP_003983960.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    Felis catus [cat]
gb|KDR68357.1|  hypothetical protein GALMADRAFT_1040817                 134   1e-34    Galerina marginata CBS 339.88
emb|CDQ94381.1|  unnamed protein product                                135   1e-34    Oncorhynchus mykiss
ref|XP_007775373.1|  UNC-50-like protein                                134   1e-34    Coniophora puteana RWD-64-598 SS2
ref|XP_008978361.1|  PREDICTED: protein unc-50 homolog isoform X3       134   1e-34    Callithrix jacchus [common marmoset]
ref|XP_006879434.1|  PREDICTED: protein unc-50 homolog                  134   1e-34    
ref|XP_007109669.1|  PREDICTED: protein unc-50 homolog isoform X1       135   1e-34    
emb|CDQ82972.1|  unnamed protein product                                135   1e-34    
ref|XP_005037642.1|  PREDICTED: protein unc-50 homolog isoform X2       133   1e-34    
gb|KIM69493.1|  hypothetical protein SCLCIDRAFT_1207927                 134   2e-34    
ref|XP_010641529.1|  PREDICTED: protein unc-50 homolog                  134   2e-34    
ref|XP_001493222.2|  PREDICTED: protein unc-50 homolog                  134   2e-34    
ref|XP_004615859.1|  PREDICTED: protein unc-50 homolog                  134   2e-34    
ref|XP_004594279.1|  PREDICTED: protein unc-50 homolog                  134   2e-34    
ref|XP_005212368.1|  PREDICTED: protein unc-50 homolog isoform X1       135   2e-34    
ref|XP_002757453.1|  PREDICTED: protein unc-50 homolog isoform X1       134   2e-34    
ref|XP_004633238.1|  PREDICTED: protein unc-50 homolog                  135   2e-34    
ref|NP_001182377.1|  unc-50 homolog                                     134   2e-34    
ref|XP_006773108.1|  PREDICTED: protein unc-50 homolog isoform X2       133   2e-34    
ref|XP_007853030.1|  hypothetical protein Moror_1893                    134   2e-34    
ref|XP_005212369.2|  PREDICTED: protein unc-50 homolog isoform X2       135   2e-34    
ref|XP_005339664.1|  PREDICTED: protein unc-50 homolog isoform X1       134   2e-34    
ref|XP_007521910.1|  PREDICTED: protein unc-50 homolog                  134   2e-34    
ref|XP_009901345.1|  PREDICTED: protein unc-50 homolog                  134   2e-34    
ref|XP_008064240.1|  PREDICTED: protein unc-50 homolog                  134   2e-34    
gb|AAH39078.1|  Unc-50 homolog (C. elegans)                             133   3e-34    
gb|EHH55775.1|  hypothetical protein EGM_05043                          133   3e-34    
ref|XP_010360423.1|  PREDICTED: protein unc-50 homolog isoform X1       133   3e-34    
dbj|BAD96319.1|  unc-50 homolog                                         133   3e-34    
ref|XP_001844230.1|  GMH1                                               133   3e-34    
ref|XP_007868022.1|  UNC-50 protein                                     133   4e-34    
ref|XP_004474429.1|  PREDICTED: protein unc-50 homolog isoform 1        133   4e-34    
ref|XP_005283277.1|  PREDICTED: protein unc-50 homolog                  133   4e-34    
ref|XP_005862266.1|  PREDICTED: protein unc-50 homolog isoform X2       133   4e-34    
ref|XP_005013489.1|  PREDICTED: protein unc-50 homolog                  133   4e-34    
ref|XP_009083646.1|  PREDICTED: protein unc-50 homolog                  133   5e-34    
ref|XP_008932429.1|  PREDICTED: protein unc-50 homolog                  133   5e-34    
ref|XP_002196813.1|  PREDICTED: protein unc-50 homolog                  132   5e-34    
ref|XP_006097790.1|  PREDICTED: protein unc-50 homolog                  132   5e-34    
ref|XP_008279277.1|  PREDICTED: protein unc-50 homolog                  132   6e-34    
ref|XP_005516582.1|  PREDICTED: protein unc-50 homolog                  132   6e-34    
ref|XP_009861515.1|  PREDICTED: protein unc-50 homolog isoform X1       133   7e-34    
ref|XP_005037641.1|  PREDICTED: protein unc-50 homolog isoform X1       132   7e-34    
ref|XP_007889335.1|  PREDICTED: protein unc-50 homolog                  132   7e-34    
ref|XP_004896629.1|  PREDICTED: protein unc-50 homolog isoform X2       132   7e-34    
ref|XP_006773107.1|  PREDICTED: protein unc-50 homolog isoform X1       132   8e-34    
gb|KIY63159.1|  UNC-50 protein                                          132   9e-34    
ref|XP_005789247.1|  hypothetical protein EMIHUDRAFT_98222              134   1e-33    
gb|EHB10596.1|  unc-50-like protein                                     132   1e-33    
gb|KFM58730.1|  hypothetical protein X975_25795                         132   1e-33    
ref|NP_001264682.1|  protein unc-50 homolog                             132   1e-33    
gb|AAP20057.1|  HSD23                                                   132   1e-33    
ref|XP_008937797.1|  PREDICTED: protein unc-50 homolog                  132   1e-33    
ref|XP_004896628.1|  PREDICTED: protein unc-50 homolog isoform X1       132   1e-33    
dbj|GAA97099.1|  hypothetical protein E5Q_03774                         138   1e-33    
ref|XP_005106924.1|  PREDICTED: protein unc-50 homolog                  132   1e-33    
gb|KIO09558.1|  hypothetical protein M404DRAFT_131326                   131   2e-33    
ref|XP_008424885.1|  PREDICTED: protein unc-50 homolog                  131   2e-33    
ref|XP_009055533.1|  hypothetical protein LOTGIDRAFT_153387             131   2e-33    
gb|KIK28273.1|  hypothetical protein PISMIDRAFT_91497                   130   2e-33    
ref|XP_008154732.1|  PREDICTED: protein unc-50 homolog                  132   2e-33    
ref|XP_006010679.1|  PREDICTED: protein unc-50 homolog isoform X3       130   2e-33    
ref|XP_006909479.1|  PREDICTED: protein unc-50 homolog isoform X1       131   2e-33    
ref|XP_007348433.1|  UNC-50-like protein                                131   2e-33    
gb|KJA26840.1|  hypothetical protein HYPSUDRAFT_1032763                 130   3e-33    
ref|XP_007511940.1|  predicted protein                                  131   3e-33    
ref|NP_001135705.1|  unc-50 homolog                                     130   3e-33    
ref|XP_007565419.1|  PREDICTED: protein unc-50 homolog                  130   3e-33    
gb|ETE68935.1|  Protein unc-50-like A                                   130   4e-33    
ref|NP_001085372.1|  protein unc-50 homolog A                           130   4e-33    
ref|XP_003498333.1|  PREDICTED: protein unc-50 homolog isoform X1       130   4e-33    
gb|KDE06096.1|  hypothetical protein MVLG_03515                         131   5e-33    
ref|XP_006010678.1|  PREDICTED: protein unc-50 homolog isoform X2       130   5e-33    
ref|XP_007428815.1|  PREDICTED: protein unc-50 homolog isoform X1       130   6e-33    
ref|XP_006010677.1|  PREDICTED: protein unc-50 homolog isoform X1       130   6e-33    
ref|XP_001664104.1|  AAEL013898-PA                                      130   8e-33    
ref|XP_002180372.1|  predicted protein                                  128   8e-33    
ref|XP_006819262.1|  PREDICTED: protein unc-50 homolog A-like           129   9e-33    
ref|XP_011426963.1|  PREDICTED: protein unc-50 homolog                  129   1e-32    
gb|KIM73995.1|  hypothetical protein PILCRDRAFT_80534                   128   1e-32    
ref|XP_004066662.1|  PREDICTED: protein unc-50 homolog                  129   1e-32    
ref|NP_001088522.1|  protein unc-50 homolog B                           129   1e-32    
ref|XP_009942198.1|  PREDICTED: protein unc-50 homolog                  128   2e-32    
gb|KIJ15121.1|  hypothetical protein PAXINDRAFT_115140                  128   3e-32    
gb|KIO18552.1|  hypothetical protein M407DRAFT_246444                   127   3e-32    
ref|XP_006638943.1|  PREDICTED: protein unc-50 homolog                  127   6e-32    
gb|ELK14782.1|  Protein unc-50 like protein                             130   7e-32    
ref|XP_009837168.1|  hypothetical protein H257_11830                    132   8e-32    
gb|ELU08114.1|  hypothetical protein CAPTEDRAFT_148077                  127   8e-32    
ref|XP_006259401.1|  PREDICTED: protein unc-50 homolog                  127   9e-32    
ref|XP_006026387.1|  PREDICTED: protein unc-50 homolog isoform X3       127   9e-32    
ref|XP_006026386.1|  PREDICTED: protein unc-50 homolog isoform X2       127   9e-32    
ref|XP_006026385.1|  PREDICTED: protein unc-50 homolog isoform X1       127   1e-31    
ref|XP_003028533.1|  hypothetical protein SCHCODRAFT_31421              125   1e-31    
emb|CAF98231.1|  unnamed protein product                                125   1e-31    
ref|XP_002288807.1|  predicted protein                                  125   2e-31    
ref|XP_004343182.1|  hypothetical protein CAOG_07323                    127   2e-31    
gb|KIK81286.1|  hypothetical protein PAXRUDRAFT_832958                  126   2e-31    
ref|XP_008866062.1|  hypothetical protein H310_03819                    131   2e-31    
ref|XP_785090.2|  PREDICTED: protein unc-50 homolog                     126   2e-31    
ref|XP_006463711.1|  hypothetical protein AGABI2DRAFT_194460            125   2e-31    
ref|XP_969730.1|  PREDICTED: protein unc-50 homolog                     125   3e-31    
ref|XP_004362945.1|  UNC-50 family protein                              126   3e-31    
gb|ETN60850.1|  GMH1                                                    125   3e-31    
ref|XP_003328223.2|  hypothetical protein PGTG_09517                    126   3e-31    
gb|KIK36623.1|  hypothetical protein CY34DRAFT_16273                    131   4e-31    
gb|KDQ08806.1|  hypothetical protein BOTBODRAFT_165591                  125   4e-31    
ref|XP_007394249.1|  hypothetical protein PHACADRAFT_118067             124   4e-31    
gb|EJT99298.1|  UNC-50-like protein                                     124   5e-31    
gb|EUC56755.1|  unc-50 family protein                                   123   7e-31    
gb|KEP49339.1|  UNC-50 family protein                                   125   7e-31    
ref|XP_001999876.1|  GI22834                                            125   8e-31    
ref|XP_003704823.1|  PREDICTED: protein unc-50 homolog                  124   8e-31    
gb|KIJ63056.1|  hypothetical protein HYDPIDRAFT_113586                  124   8e-31    
ref|XP_001742979.1|  hypothetical protein                               124   8e-31    
gb|AFR97563.2|  UNC-50 family protein                                   125   9e-31    
gb|KDR17270.1|  Unc-50-like protein                                     124   9e-31    
ref|XP_001359807.1|  GA22025                                            124   1e-30    
ref|XP_002054685.1|  GJ24589                                            124   1e-30    
gb|ACN94714.1|  GA22025                                                 124   1e-30    
ref|XP_002425654.1|  conserved hypothetical protein                     124   1e-30    
emb|CEL62791.1|  Protein unc-50 homolog OS=Homo sapiens GN=UNC50 ...    124   1e-30    
ref|XP_623081.1|  PREDICTED: protein unc-50 homolog                     123   2e-30    
ref|XP_003397597.1|  PREDICTED: protein unc-50 homolog                  123   2e-30    
ref|XP_010216133.1|  PREDICTED: protein unc-50 homolog                  123   2e-30    
ref|XP_005190933.1|  PREDICTED: protein unc-50 homolog                  123   2e-30    
ref|XP_567471.1|  transport-related protein                             124   2e-30    
emb|CCX33783.1|  Similar to Protein GMH1 homolog; acc. no. P87155       123   3e-30    
gb|KGL79450.1|  Protein unc-50                                          122   4e-30    
ref|NP_001040161.1|  unc-50-like protein                                122   4e-30    
gb|KIR49595.1|  UNC-50 family protein                                   123   4e-30    
ref|XP_009965644.1|  PREDICTED: protein unc-50 homolog                  121   4e-30    
ref|XP_009018632.1|  hypothetical protein HELRODRAFT_100226             122   4e-30    
gb|KFQ65675.1|  Protein unc-50                                          121   4e-30    
gb|KIP11852.1|  hypothetical protein PHLGIDRAFT_62907                   121   5e-30    
gb|KIR89096.1|  UNC-50 family protein                                   123   5e-30    
ref|XP_001954246.1|  GF16844                                            122   5e-30    
ref|XP_007002538.1|  hypothetical protein TREMEDRAFT_42665              122   6e-30    
emb|CDW54205.1|  Protein unc-50                                         122   8e-30    
ref|XP_003486254.1|  PREDICTED: protein unc-50 homolog                  122   8e-30    
gb|KHJ42429.1|  UNC-50 family protein                                   122   8e-30    
ref|XP_008203077.1|  PREDICTED: protein unc-50 homolog isoform X1       122   1e-29    
ref|XP_003193893.1|  transport-related protein                          122   1e-29    
emb|CEF67771.1|  Protein unc-50 homolog                                 122   1e-29    
ref|XP_001607727.1|  PREDICTED: protein unc-50 homolog isoform X2       121   1e-29    
gb|KFD46541.1|  hypothetical protein M513_12592                         122   1e-29    
gb|KIR56936.1|  UNC-50 family protein                                   122   1e-29    
gb|EJK64009.1|  hypothetical protein THAOC_15303                        122   1e-29    
gb|KIR35966.1|  UNC-50 family protein                                   121   2e-29    
gb|KFD64074.1|  hypothetical protein M514_12592                         122   2e-29    
gb|KGB75162.1|  hypothetical protein CNBG_1000                          121   2e-29    
gb|ELV11548.1|  Protein unc-50 like protein                             121   2e-29    
ref|XP_011211146.1|  PREDICTED: protein unc-50 homolog                  120   2e-29    
ref|XP_009032750.1|  hypothetical protein AURANDRAFT_60518              126   3e-29    
emb|CCD12196.1|  unnamed protein product                                119   4e-29    
ref|XP_011166375.1|  PREDICTED: protein unc-50 homolog                  120   4e-29    
ref|XP_009488714.1|  PREDICTED: protein unc-50 homolog                  119   4e-29    
emb|CBY20817.1|  unnamed protein product                                120   4e-29    
ref|XP_011345582.1|  PREDICTED: protein unc-50 homolog                  119   6e-29    
ref|XP_312002.3|  AGAP002901-PA                                         119   9e-29    
ref|XP_011264181.1|  PREDICTED: protein unc-50 homolog                  119   1e-28    
dbj|GAM83200.1|  hypothetical protein ANO11243_011860                   119   1e-28    
ref|XP_002435165.1|  conserved hypothetical protein                     118   2e-28    
ref|XP_011150990.1|  PREDICTED: protein unc-50 homolog                  118   2e-28    
ref|XP_011499403.1|  PREDICTED: protein unc-50 homolog                  118   2e-28    
ref|NP_649813.1|  CG9773                                                118   3e-28    
ref|XP_001980934.1|  GG17433                                            118   3e-28    
emb|CBK21170.2|  unnamed protein product                                116   5e-28    
emb|CCC93058.1|  conserved hypothetical protein                         116   6e-28    
ref|XP_007878595.1|  hypothetical protein PFL1_02891                    116   6e-28    
ref|XP_011052890.1|  PREDICTED: protein unc-50 homolog                  117   7e-28    
ref|XP_002069978.1|  GK11280                                            116   9e-28    
gb|KEQ69377.1|  UNC-50 protein                                          115   1e-27    
gb|ESL06549.1|  hypothetical protein TRSC58_05775                       115   1e-27    
ref|XP_003369441.1|  protein unc-50                                     116   1e-27    
ref|XP_008552750.1|  PREDICTED: protein unc-50 homolog                  115   2e-27    
ref|XP_003697749.1|  PREDICTED: protein unc-50 homolog                  115   3e-27    
ref|XP_011185523.1|  PREDICTED: protein unc-50 homolog                  115   3e-27    
emb|CDK26325.1|  unnamed protein product                                115   4e-27    
ref|XP_008477323.1|  PREDICTED: protein unc-50 homolog                  114   4e-27    
ref|XP_004519584.1|  PREDICTED: protein unc-50 homolog                  114   5e-27    
ref|XP_504552.1|  YALI0E29447p                                          114   6e-27    
dbj|BAM18657.1|  similar to CG9773                                      114   6e-27    
gb|EYC38337.1|  hypothetical protein Y032_0724g1852                     114   6e-27    
gb|EYC38336.1|  hypothetical protein Y032_0724g1852                     114   6e-27    
gb|EYC38338.1|  hypothetical protein Y032_0724g1852                     114   6e-27    
gb|KEQ93605.1|  hypothetical protein AUEXF2481DRAFT_99411               113   7e-27    
gb|EJY85679.1|  hypothetical protein OXYTRI_16336                       114   7e-27    
gb|EKF31770.1|  hypothetical protein MOQ_004390                         113   7e-27    
gb|ERG78881.1|  protein unc-50                                          115   9e-27    
ref|XP_001989849.1|  GH19021                                            113   1e-26    
gb|KHN71992.1|  Protein unc-50                                          114   1e-26    
gb|EFX87144.1|  hypothetical protein DAPPUDRAFT_221851                  113   2e-26    
gb|ESS71077.1|  hypothetical protein TCDM_00100                         112   2e-26    
gb|KDD76873.1|  UNC-50 family protein                                   111   3e-26    
gb|EKG03198.1|  hypothetical protein TCSYLVIO_005765                    112   4e-26    
gb|ERE92693.1|  putative protein unc-50 like protein                    111   4e-26    
ref|XP_002156660.1|  PREDICTED: protein unc-50 homolog                  111   5e-26    
ref|XP_011307647.1|  PREDICTED: protein unc-50 homolog                  111   6e-26    
gb|KEQ82785.1|  UNC-50 family protein                                   112   6e-26    
gb|KEQ67417.1|  UNC-50 protein                                          110   6e-26    
ref|XP_821661.1|  hypothetical protein                                  110   1e-25    
gb|EPY86251.1|  protein unc-50-like protein                             109   1e-25    
gb|KIV96775.1|  hypothetical protein PV10_00596                         110   1e-25    
ref|XP_001646360.1|  hypothetical protein Kpol_2001p2                   109   2e-25    
ref|XP_004182100.1|  hypothetical protein TBLA_0H02970                  109   3e-25    
ref|XP_007581212.1|  putative integral membrane protein                 110   3e-25    
emb|CDH10443.1|  related to Protein GMH1                                108   4e-25    
gb|EME40296.1|  hypothetical protein DOTSEDRAFT_159076                  108   5e-25    
ref|XP_009309648.1|  unc-50 related protein                             108   5e-25    
gb|EMF08935.1|  UNC-50 protein                                          108   5e-25    
emb|CCA69448.1|  related to GMH1-Golgi membrane protein of unknow...    108   6e-25    
emb|CDF89204.1|  ZYBA0S03-11628g1_1                                     108   7e-25    
gb|EFW16819.1|  integral membrane protein                               109   7e-25    
gb|EKG10808.1|  UNC-50 domain-containing protein                        108   7e-25    
emb|CAP21176.2|  Protein CBR-UNC-50                                     108   2e-24    
ref|XP_003110942.1|  CRE-UNC-50 protein                                 108   2e-24    
gb|EGT34681.1|  CBN-UNC-50 protein                                      107   2e-24    
ref|XP_002641312.1|  C. briggsae CBR-UNC-50 protein                     108   3e-24    
ref|XP_002497785.1|  ZYRO0F13442p                                       106   3e-24    
ref|NP_001156115.1|  protein unc-50 homolog                             107   3e-24    
gb|ESW97300.1|  Protein GMH1                                            107   3e-24    
ref|XP_003748488.1|  PREDICTED: protein unc-50 homolog A-like           106   3e-24    
emb|CBH14586.1|  unc-50 related protein homolog                         106   3e-24    
gb|ADD38426.1|  Protein unc-50 homolog                                  107   3e-24    
ref|XP_009182994.1|  PREDICTED: protein unc-50 homolog                  106   3e-24    



>ref|XP_009801486.1| PREDICTED: protein unc-50 homolog [Nicotiana sylvestris]
Length=251

 Score =   335 bits (860),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 164/174 (94%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S KGRTSSH RPNSV PQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTS-KGRTSSHVRPNSVLPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLL  +TLAYC AYDHSAGH VFVVISVLLFHF++TGA L+
Sbjct  60   KQTKNQWARDDPAFIVICSLLLVVATLAYCVAYDHSAGHAVFVVISVLLFHFVLTGATLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTNNYLREE P+SH VEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  120  TCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  173



>ref|XP_009629275.1| PREDICTED: protein unc-50 homolog [Nicotiana tomentosiformis]
Length=251

 Score =   334 bits (856),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S KGRTSSH RPNSV PQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTS-KGRTSSHVRPNSVLPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLL  +TLA+C AYDHSAGH VFVVISVLLFHF++TGA L+
Sbjct  60   KQTKNQWARDDPAFIVICSLLLVVATLAFCVAYDHSAGHAVFVVISVLLFHFVLTGATLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTNNYLREE P+SH VEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  120  TCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  173



>ref|XP_006346362.1| PREDICTED: protein unc-50 homolog [Solanum tuberosum]
Length=253

 Score =   332 bits (851),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 164/175 (94%), Gaps = 1/175 (1%)
 Frame = +1

Query  109  MLPTSSLK-GRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPT+S   GRTSSH RPNSV PQYLR+I+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1    MLPTTSKGLGRTSSHVRPNSVLPQYLRKIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAFIVIC+LLL  +TLAYCAAYDHSAGH VFVVISVLLFHF++TGA L
Sbjct  61   HKQTKNQWARDDPAFIVICTLLLVIATLAYCAAYDHSAGHAVFVVISVLLFHFILTGATL  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +TCCWFLTNNYLREE P+SH VEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  ATCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  175



>ref|XP_011092536.1| PREDICTED: protein unc-50 homolog isoform X1 [Sesamum indicum]
Length=253

 Score =   331 bits (849),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 163/175 (93%), Gaps = 1/175 (1%)
 Frame = +1

Query  109  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPTSS  K R   HARPNS+FP YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1    MLPTSSSAKVRPGPHARPNSLFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLL+ S +AYCAAYDHSAGH VFVVISVLLFHFL++GA+L
Sbjct  61   HKQTKNQWARDDPAFVVICSLLLSVSAMAYCAAYDHSAGHAVFVVISVLLFHFLLSGAIL  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +TCCWF TNNYLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  ATCCWFFTNNYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  175



>ref|XP_004230735.1| PREDICTED: protein unc-50 homolog [Solanum lycopersicum]
Length=253

 Score =   330 bits (846),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 163/175 (93%), Gaps = 1/175 (1%)
 Frame = +1

Query  109  MLPTSSLK-GRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPT+S   GRTSSH RPNSV PQYLR+I+KWQQMDIEYTFWQM HLCTSPKVVYQHTKY
Sbjct  1    MLPTTSKGLGRTSSHVRPNSVLPQYLRKIIKWQQMDIEYTFWQMFHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAFIVIC+LLL  +TLAYCAAYDHSAGH VFVVISVLLFHF++TGA L
Sbjct  61   HKQTKNQWARDDPAFIVICTLLLVIATLAYCAAYDHSAGHAVFVVISVLLFHFILTGATL  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +TCCWFLTNNYLREE P+SH VEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  ATCCWFLTNNYLREEAPSSHAVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  175



>gb|EYU42697.1| hypothetical protein MIMGU_mgv1a012334mg [Erythranthe guttata]
Length=253

 Score =   327 bits (837),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 160/175 (91%), Gaps = 1/175 (1%)
 Frame = +1

Query  109  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPTSS  K R+ SH RPNS  P YLRRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKY
Sbjct  1    MLPTSSSAKARSGSHTRPNSFLPHYLRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLL  ST+AYCAAYDH AGH +FVVISVLLFHFL+ GA+L
Sbjct  61   HKQTKNQWARDDPAFVVICSLLLIVSTIAYCAAYDHGAGHAIFVVISVLLFHFLLIGAIL  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +TCCWF TNNYLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  ATCCWFFTNNYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  175



>gb|KJB47362.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=252

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+TG  L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVLLFHFLLTGVFLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYF+SP
Sbjct  121  TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFVSP  174



>emb|CDO97222.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   323 bits (829),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 164/186 (88%), Gaps = 13/186 (7%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S KGRTSS+ARPNS FP YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTS-KGRTSSNARPNSPFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLL  ST AYCAAYDHS GH V+VV+SVLLFH L+TGA+L+
Sbjct  60   KQTKNQWARDDPAFVVICSLLLVVSTSAYCAAYDHSVGHAVYVVMSVLLFHLLMTGAILA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEW------------LYAFDVHCNSFFPMFILLYVV  612
            TCCWFLTNNYLREE PNSHVVEQRVEW            LYAFDVHCNSFFPMF+LLYV+
Sbjct  120  TCCWFLTNNYLREEVPNSHVVEQRVEWQVLTFPLSLLAVLYAFDVHCNSFFPMFVLLYVI  179

Query  613  HYFLSP  630
            HYFLSP
Sbjct  180  HYFLSP  185



>gb|KJB47366.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=249

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+TG  L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVLLFHFLLTGVFLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYF+SP
Sbjct  121  TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFVSP  174



>ref|XP_002282581.2| PREDICTED: protein unc-50 homolog [Vitis vinifera]
 ref|XP_010647895.1| PREDICTED: protein unc-50 homolog [Vitis vinifera]
 ref|XP_010647896.1| PREDICTED: protein unc-50 homolog [Vitis vinifera]
Length=251

 Score =   319 bits (817),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGR+ S++RPN +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRSPSNSRPNPMFLQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLL  +T AYCAAYDHS+ H VFVVISVLLFHFLITG  L+
Sbjct  60   KQTKNQWARDDPAFVVICSLLLVVATSAYCAAYDHSSAHAVFVVISVLLFHFLITGIFLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  120  TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  173



>ref|XP_011092537.1| PREDICTED: protein unc-50 homolog isoform X2 [Sesamum indicum]
Length=212

 Score =   316 bits (810),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = +1

Query  109  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPTSS  K R   HARPNS+FP YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1    MLPTSSSAKVRPGPHARPNSLFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLL+ S +AYCAAYDHSAGH VFVVISVLLFHFL++GA+L
Sbjct  61   HKQTKNQWARDDPAFVVICSLLLSVSAMAYCAAYDHSAGHAVFVVISVLLFHFLLSGAIL  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
            +TCCWF TNNYLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+ +
Sbjct  121  ATCCWFFTNNYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVLPF  171



>ref|XP_007042528.1| UNC-50 family protein isoform 1 [Theobroma cacao]
 gb|EOX98359.1| UNC-50 family protein isoform 1 [Theobroma cacao]
Length=252

 Score =   317 bits (812),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    +SS +RPN +FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1    MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+ G  L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVFVVISVLLFHFLLAGVFLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCW LTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  121  TCCWSLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  174



>ref|XP_010271205.1| PREDICTED: protein unc-50 homolog isoform X1 [Nelumbo nucifera]
Length=248

 Score =   317 bits (811),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGRT S+ R N VFPQYLRRIVKW+QMDIEYTFWQM HLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRTHSNVRQNPVFPQYLRRIVKWEQMDIEYTFWQMFHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLL  +T AYCAAYDHS  H +F VISVL+FHFL+TG VL+
Sbjct  60   KQTKNQWARDDPAFVVICSLLLVVATSAYCAAYDHSMAHAIFTVISVLIFHFLVTGVVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP+FI+LYV+HYFLSP
Sbjct  120  TCCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPLFIMLYVIHYFLSP  173



>ref|XP_010691673.1| PREDICTED: protein unc-50 homolog [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPTSS    +S+  +PN VFP YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTSSKGRSSSTSRQPNPVFPHYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICS LLA STLAYCAAYDHS GH ++VV+SVLLFHF+ITGAVL+
Sbjct  61   KQTKNQWARDDPAFIVICSFLLAVSTLAYCAAYDHSTGHAIYVVLSVLLFHFIITGAVLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTNNYLREE PNS+VVEQRVEWLYAFDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNNYLREEAPNSYVVEQRVEWLYAFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_011001154.1| PREDICTED: protein unc-50 homolog [Populus euphratica]
Length=247

 Score =   313 bits (801),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 5/174 (3%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S +GR SS    +S FP YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTS-RGRASS----SSTFPHYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYH  55

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLL  + LAYCAAYDHSAGH VFVVISVL FHFLI+GA L+
Sbjct  56   KQTKNQWARDDPAFVVICSLLLVVAALAYCAAYDHSAGHAVFVVISVLFFHFLISGAGLA  115

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  116  TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  169



>emb|CBI40262.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   312 bits (800),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 160/181 (88%), Gaps = 8/181 (4%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGR+ S++RPN +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRSPSNSRPNPMFLQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLL  +T AYCAAYDHS+ H VFVVISVLLFHFLITG  L+
Sbjct  60   KQTKNQWARDDPAFVVICSLLLVVATSAYCAAYDHSSAHAVFVVISVLLFHFLITGIFLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEW-------LYAFDVHCNSFFPMFILLYVVHYFLS  627
            TCCWFLTN YLREE PNSHVVEQRVEW       LYAFDVHCNSFFPMF+LLYV+HYFLS
Sbjct  120  TCCWFLTNAYLREEAPNSHVVEQRVEWQDSSASVLYAFDVHCNSFFPMFVLLYVIHYFLS  179

Query  628  P  630
            P
Sbjct  180  P  180



>gb|KJB47365.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=257

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 160/186 (86%), Gaps = 12/186 (6%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV-------  267
            MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVV       
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVSIVHMNY  60

Query  268  -----YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVL  432
                 YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVL
Sbjct  61   YGGCSYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVL  120

Query  433  LFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVV  612
            LFHFL+TG  L+TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+
Sbjct  121  LFHFLLTGVFLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVI  180

Query  613  HYFLSP  630
            HYF+SP
Sbjct  181  HYFVSP  186



>ref|XP_004136958.1| PREDICTED: protein unc-50 homolog [Cucumis sativus]
 ref|XP_004166960.1| PREDICTED: protein unc-50 homolog [Cucumis sativus]
 gb|KGN43880.1| hypothetical protein Csa_7G071690 [Cucumis sativus]
Length=252

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N ++ QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTASRGRSSSSTSRANPMYLQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLLA +TLAYCAAYDHSA H  FVVISVLLFH LITGA+L+
Sbjct  61   KQTKNQWARDDPAFIVICSLLLAVATLAYCAAYDHSAAHASFVVISVLLFHLLITGAILA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCW LTN YLREETP SHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYF+SP
Sbjct  121  TCCWLLTNAYLREETPGSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFISP  174



>gb|AFK38140.1| unknown [Lotus japonicus]
Length=252

 Score =   306 bits (783),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = +1

Query  109  MLPTSSLKGR-TSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPT+S KGR +SS +RPNS    YLR+I+KWQQMDIEYTFWQM HLCT+PKVVYQHTKY
Sbjct  1    MLPTAS-KGRASSSTSRPNSTLLPYLRKIIKWQQMDIEYTFWQMFHLCTAPKVVYQHTKY  59

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  H VFVV SVLLFHFL+TG  L
Sbjct  60   HKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSIAHAVFVVFSVLLFHFLLTGVFL  119

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +T CWFLTN+YLREE PNS+VVEQRVEW+YAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  120  ATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSP  174



>ref|XP_006487004.1| PREDICTED: protein unc-50 homolog [Citrus sinensis]
Length=253

 Score =   305 bits (782),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPTS  KGR+SS A R N +FPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1    MLPTSVSKGRSSSSASRTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLL+ +T+AYCAAYDHSA H +FVVISVLLFHFLITGA+L
Sbjct  61   HKQTKNQWARDDPAFVVICSLLLSVATIAYCAAYDHSATHAIFVVISVLLFHFLITGAML  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +T CWFLTN+YLRE++PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  121  ATFCWFLTNSYLREDSPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  175



>ref|XP_006422931.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36171.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
Length=254

 Score =   305 bits (782),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPTS  KGR+SS A R N +FPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1    MLPTSVSKGRSSSSASRTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLL+ +T+AYCAAYDHSA H +FVVISVLLFHFLITGA+L
Sbjct  61   HKQTKNQWARDDPAFVVICSLLLSVATIAYCAAYDHSATHAIFVVISVLLFHFLITGAML  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +T CWFLTN+YLRE++PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  121  ATFCWFLTNSYLREDSPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  175



>ref|XP_006422929.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 ref|XP_006422930.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36169.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36170.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|KDO59817.1| hypothetical protein CISIN_1g025409mg [Citrus sinensis]
Length=253

 Score =   305 bits (781),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPTS  KGR+SS A R N +FPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1    MLPTSVSKGRSSSSASRTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLL+ +T+AYCAAYDHSA H +FVVISVLLFHFLITGA+L
Sbjct  61   HKQTKNQWARDDPAFVVICSLLLSVATIAYCAAYDHSATHAIFVVISVLLFHFLITGAML  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +T CWFLTN+YLRE++PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  121  ATFCWFLTNSYLREDSPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  175



>ref|XP_010530733.1| PREDICTED: protein unc-50 homolog [Tarenaya hassleriana]
Length=252

 Score =   305 bits (780),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S     SS +R N +F QY RRIVKWQQMDIEYTFWQM HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSQSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMFHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICS+LLA +T+AYCAAYDHS  H +FVV SVLLFHFLITGA+++
Sbjct  61   KQTKNQWARDDPAFVVICSMLLAVATIAYCAAYDHSFSHALFVVFSVLLFHFLITGAIIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_008356380.1| PREDICTED: protein unc-50 homolog [Malus domestica]
Length=254

 Score =   304 bits (779),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRGRSSSSASRMNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHSA H VFVVISVLLFHFL  G +L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSAAHAVFVVISVLLFHFLFLGMLLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  TFCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  174



>ref|XP_006844040.1| hypothetical protein AMTR_s00006p00238670 [Amborella trichopoda]
 gb|ERN05715.1| hypothetical protein AMTR_s00006p00238670 [Amborella trichopoda]
Length=248

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S +GR  S  R NS+FP YLRR++KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTAS-RGRPPSTMRANSIFPHYLRRVIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVI SLLL  +T AYCAAYD +  H +F VISV+LFHF+I GA+L+
Sbjct  60   KQTKNQWARDDPAFIVILSLLLIVATSAYCAAYDKTITHAIFTVISVVLFHFIIIGAILA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLREETPNSH VEQRVEWLYAFDVHCNSFFP+F+ LYV+HYF+SP
Sbjct  120  TCCWFLTNTYLREETPNSHAVEQRVEWLYAFDVHCNSFFPVFVALYVIHYFISP  173



>ref|XP_006379181.1| UNC-50 family protein [Populus trichocarpa]
 gb|ERP56978.1| UNC-50 family protein [Populus trichocarpa]
Length=254

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  169  FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSL  348
            FPQYLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VICSL
Sbjct  23   FPQYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVICSL  82

Query  349  LLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHV  528
            LL  + LAYCAAYDHSAGH VFVVISVL FHFLI+GA L+TCCWFLTN YLREE PNSHV
Sbjct  83   LLVVAALAYCAAYDHSAGHAVFVVISVLFFHFLISGAGLATCCWFLTNAYLREEAPNSHV  142

Query  529  VEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            VEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  143  VEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  176



>gb|KJB11965.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
 gb|KJB11967.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=252

 Score =   303 bits (775),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    + S +RPN++FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PK+VYQHTKYH
Sbjct  1    MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKIVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
             QTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H V VVI+V LFHFL+ G +L+
Sbjct  61   NQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVSVVITVSLFHFLLAGILLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLR+E PN+ VVEQRVEWLYAFD+HCNSFFPMF++LYV+HYFLSP
Sbjct  121  TCCWFLTNAYLRKEAPNTCVVEQRVEWLYAFDLHCNSFFPMFVMLYVIHYFLSP  174



>gb|KEH44101.1| UNC-50 family protein [Medicago truncatula]
Length=257

 Score =   303 bits (775),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 160/180 (89%), Gaps = 7/180 (4%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  270
            MLPT S KGR+SS +      RPNS    YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVY
Sbjct  1    MLPTVS-KGRSSSSSSSSSSSRPNSTLLPYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVY  59

Query  271  QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLI  450
            QHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS+GH +FVV SVLLFHFL+
Sbjct  60   QHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSSGHALFVVFSVLLFHFLL  119

Query  451  TGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TG  L+T CWFLTN+YLREE PNS+VVEQRVEW+YAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  120  TGIFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSP  179



>ref|XP_007042529.1| UNC-50 family protein isoform 2, partial [Theobroma cacao]
 gb|EOX98360.1| UNC-50 family protein isoform 2, partial [Theobroma cacao]
Length=231

 Score =   301 bits (771),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    +SS +RPN +FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1    MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+ G  L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVFVVISVLLFHFLLAGVFLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLY  606
            TCCW LTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LY
Sbjct  121  TCCWSLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLY  166



>ref|XP_008454998.1| PREDICTED: protein unc-50 homolog [Cucumis melo]
Length=252

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N ++ QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTASRGRSSSSTSRTNPMYLQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHSA H  FVVISVL+FH LITGA+L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSAAHASFVVISVLIFHLLITGAILA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCW LTN YLREETP SHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYF+SP
Sbjct  121  TCCWLLTNAYLREETPGSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFISP  174



>gb|AFK46272.1| unknown [Medicago truncatula]
Length=257

 Score =   301 bits (770),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 160/180 (89%), Gaps = 7/180 (4%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  270
            MLPT S KGR+SS +      RPNS    YLRRI+KWQQMD+EYTFWQMLHLCTSPKVVY
Sbjct  1    MLPTVS-KGRSSSSSSSSSSSRPNSTLLPYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVY  59

Query  271  QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLI  450
            QHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS+GH +FVV SVLLFHFL+
Sbjct  60   QHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSSGHALFVVFSVLLFHFLL  119

Query  451  TGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TG  L+T CWFLTN+YLREE PNS+VV+QRVEW+YAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  120  TGIFLATFCWFLTNSYLREEAPNSYVVKQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSP  179



>gb|KJB47364.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=191

 Score =   298 bits (762),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 152/178 (85%), Gaps = 12/178 (7%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV-------  267
            MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVV       
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVSIVHMNY  60

Query  268  -----YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVL  432
                 YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVL
Sbjct  61   YGGCSYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVL  120

Query  433  LFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLY  606
            LFHFL+TG  L+TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LY
Sbjct  121  LFHFLLTGVFLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLY  178



>ref|XP_008236376.1| PREDICTED: protein unc-50 homolog [Prunus mume]
Length=254

 Score =   300 bits (767),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRGRSSSSTSRTNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL  G +L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATMAYCAAYDHSAAHAVFVVISVLLFHFLFIGMLLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEW+YAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  121  TFCWFLTNSYLREEAPNSHVVEQRVEWMYAFDVHCNSFFPMFVMLYVIHYFLSP  174



>ref|XP_010547978.1| PREDICTED: protein unc-50 homolog isoform X1 [Tarenaya hassleriana]
Length=252

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYC AYDHS  H +FVV SVLL HF   GA ++
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATIAYCVAYDHSVSHALFVVFSVLLLHFFTIGATVA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREETPNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNSYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_007201388.1| hypothetical protein PRUPE_ppa010309mg [Prunus persica]
 gb|EMJ02587.1| hypothetical protein PRUPE_ppa010309mg [Prunus persica]
Length=254

 Score =   298 bits (762),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRGRSSSSTSRTNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLF FL  G +L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATMAYCAAYDHSAAHAVFVVISVLLFQFLFIGMLLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEW+YAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  121  TFCWFLTNSYLREEAPNSHVVEQRVEWMYAFDVHCNSFFPMFVMLYVIHYFLSP  174



>ref|XP_010057258.1| PREDICTED: protein unc-50 homolog [Eucalyptus grandis]
 gb|KCW74300.1| hypothetical protein EUGRSUZ_E02959 [Eucalyptus grandis]
Length=252

 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N++F QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTASKGRSSSSASRSNNMFSQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI +LLL  +  AYCAAYDHS  H V+V+ISVLLFHFL+TGA+LS
Sbjct  61   KQTKNQWARDDPAFVVISTLLLVVAVSAYCAAYDHSIAHAVYVIISVLLFHFLVTGALLS  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  TFCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  174



>emb|CDY63605.1| BnaCnng42360D [Brassica napus]
Length=252

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLL  +TLAYCA YDHS  H V VVISV L HFLITGA+++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLILATLAYCATYDHSGSHAVVVVISVFLTHFLITGALIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREE PNSHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_011467754.1| PREDICTED: protein unc-50 homolog [Fragaria vesca subsp. vesca]
Length=253

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +1

Query  160  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  339
            N +F QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VI
Sbjct  19   NPLFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVI  78

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN  519
            CSLLL  +TLAYCAAYDHSA H VFVVISVLLFHFL  G +L+T CWFLTN+YLREE PN
Sbjct  79   CSLLLTVATLAYCAAYDHSAAHAVFVVISVLLFHFLFIGMLLATFCWFLTNSYLREEAPN  138

Query  520  SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            SHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  139  SHVVEQRVEWLYAFDVHCNSFFPMFVMLYVLHYFLSP  175



>ref|XP_009335832.1| PREDICTED: protein unc-50 homolog [Pyrus x bretschneideri]
Length=254

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +  QYLRRI+KWQQMD+EYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRGRSSSSSSRTNPMPIQYLRRIIKWQQMDVEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICS+LLA +TLAYCAAYDHSA H VFVVISVLLFHFL  G +L+
Sbjct  61   KQTKNQWARDDPAFVVICSVLLAVATLAYCAAYDHSAAHAVFVVISVLLFHFLFIGMLLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  TFCWFLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVLLYVIHYFLSP  174



>ref|XP_007042530.1| UNC-50 family protein isoform 3 [Theobroma cacao]
 gb|EOX98361.1| UNC-50 family protein isoform 3 [Theobroma cacao]
Length=200

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    +SS +RPN +FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1    MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL+ G  L+
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVFVVISVLLFHFLLAGVFLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYV  609
            TCCW LTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFP+  L  V
Sbjct  121  TCCWSLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPINTLFSV  167



>ref|XP_010928386.1| PREDICTED: protein unc-50 homolog isoform X1 [Elaeis guineensis]
Length=248

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGRT +  RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDP F+VI  L L  +T AYCAAY  S  H V  V+SV++FHFLI G +L+
Sbjct  60   KQTKNQWARDDPGFVVILCLFLVVATSAYCAAYGESLAHAVSTVVSVVIFHFLIAGIILA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFP FI+LYV+ YF+SP
Sbjct  120  TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPTFIMLYVIQYFVSP  173



>ref|XP_004496941.1| PREDICTED: protein unc-50 homolog [Cicer arietinum]
Length=256

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  154  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  333
            RPNS    YLRRI+KWQQMD+EYTFWQM HLCTSPKVVYQHTKYHKQTKNQWARDDPAF+
Sbjct  20   RPNSTLLPYLRRIIKWQQMDVEYTFWQMFHLCTSPKVVYQHTKYHKQTKNQWARDDPAFV  79

Query  334  VICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREET  513
            VICSLLLA +TLAYCAAYDHS GH + VV SVL+FHFL+TG  L+T CWFLTN+YLREE 
Sbjct  80   VICSLLLAVATLAYCAAYDHSTGHALLVVFSVLVFHFLLTGIFLATFCWFLTNSYLREEA  139

Query  514  PNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            PNS+VVEQRVEW+YAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  140  PNSYVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSP  178



>ref|NP_001235443.1| uncharacterized protein LOC100500001 [Glycine max]
 gb|ACU14557.1| unknown [Glycine max]
Length=255

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 159/178 (89%), Gaps = 5/178 (3%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA---RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            MLPT+S KGR+SS +   RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQH
Sbjct  1    MLPTAS-KGRSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQH  59

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
            TKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  HT+ V+ SVL FHF++TG
Sbjct  60   TKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTAHTLLVIFSVLFFHFILTG  119

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
              L+T CWFLTN+YLREE PNS+VVEQRVEW+YAFDVHCNSFFP+F+LLYV+HYFLSP
Sbjct  120  VFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPLFVLLYVIHYFLSP  177



>gb|KHN42364.1| Protein unc-50 like [Glycine soja]
Length=259

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 158/182 (87%), Gaps = 9/182 (5%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA-------RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  264
            MLPT+S KGR+SS +       RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKV
Sbjct  1    MLPTAS-KGRSSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKV  59

Query  265  VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHF  444
            VYQHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  HT+ V+ SVLLFHF
Sbjct  60   VYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTAHTLLVIFSVLLFHF  119

Query  445  LITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFL  624
            L+TG  L+T CWFLTN YLREE PNS+VVEQRVEW+YAFDVHCNSFFP F+LLYV+HYFL
Sbjct  120  LLTGVFLATFCWFLTNGYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPFFVLLYVIHYFL  179

Query  625  SP  630
            SP
Sbjct  180  SP  181



>emb|CDY48219.1| BnaA07g03880D [Brassica napus]
Length=254

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  160  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  339
            N +F QY RRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  20   NPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  79

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN  519
            CSLLL  STLAYCA YDHS  H V VVISV L HFLITG +++TCCWFLTN+YLREE PN
Sbjct  80   CSLLLILSTLAYCATYDHSGSHAVVVVISVFLTHFLITGGLIATCCWFLTNSYLREEAPN  139

Query  520  SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            SHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  140  SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  176



>ref|XP_009102331.1| PREDICTED: protein unc-50 homolog [Brassica rapa]
Length=254

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  160  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  339
            N +F QY RRIVKWQQMDIEYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  20   NPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  79

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN  519
            CSLLL  STLAYCA YDHS  H V +VISV L HFLITG +++TCCWFLTN+YLREE PN
Sbjct  80   CSLLLILSTLAYCATYDHSGSHAVVLVISVFLTHFLITGGLIATCCWFLTNSYLREEAPN  139

Query  520  SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            SHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  140  SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  176



>ref|XP_007143055.1| hypothetical protein PHAVU_007G039900g [Phaseolus vulgaris]
 gb|ESW15049.1| hypothetical protein PHAVU_007G039900g [Phaseolus vulgaris]
Length=255

 Score =   290 bits (743),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 159/178 (89%), Gaps = 5/178 (3%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA---RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            MLPT+S KGR+SS +   RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQH
Sbjct  1    MLPTAS-KGRSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQH  59

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
            TKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS+ H + V+ SVL FHF++TG
Sbjct  60   TKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSSAHALLVIFSVLFFHFILTG  119

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
              L+T CWFLTN+YLREE PNS+VVEQRVEW+YAFDVHCNSFFP+F+LLYV+HYF+SP
Sbjct  120  VFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPLFVLLYVIHYFVSP  177



>ref|XP_003555962.1| PREDICTED: protein unc-50 homolog [Glycine max]
Length=258

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 157/181 (87%), Gaps = 8/181 (4%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA------RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  267
            MLPT+S KGR+SS +      RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVV
Sbjct  1    MLPTAS-KGRSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVV  59

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            YQHTKYHKQTKNQWARDDPAF+VIC LLLA +TLAYCAAYDHS  HT+ V+ SVLLFHFL
Sbjct  60   YQHTKYHKQTKNQWARDDPAFVVICCLLLAVATLAYCAAYDHSTAHTLLVIFSVLLFHFL  119

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLS  627
            +TG  L+T CWFLTN YLREE PNS+VVEQRVEW+YAFDVHCNSFFP F+LLYV+HYFLS
Sbjct  120  LTGVFLATFCWFLTNGYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPFFVLLYVIHYFLS  179

Query  628  P  630
            P
Sbjct  180  P  180



>gb|KJB11964.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=184

 Score =   285 bits (730),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    + S +RPN++FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PK+VYQHTKYH
Sbjct  1    MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKIVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
             QTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H V VVI+V LFHFL+ G +L+
Sbjct  61   NQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVSVVITVSLFHFLLAGILLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLY  606
            TCCWFLTN YLR+E PN+ VVEQRVEWLYAFD+HCNSFFPMF++LY
Sbjct  121  TCCWFLTNAYLRKEAPNTCVVEQRVEWLYAFDLHCNSFFPMFVMLY  166



>gb|KJB11966.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=224

 Score =   286 bits (732),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 153/174 (88%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S    + S +RPN++FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PK+VYQHTKYH
Sbjct  1    MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKIVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
             QTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H V VVI+V LFHFL+ G +L+
Sbjct  61   NQTKNQWARDDPAFVVICSLLLAVATVAYCAAYDHSAAHAVSVVITVSLFHFLLAGILLA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYV-VHYFLS  627
            TCCWFLTN YLR+E PN+ VVEQRVEWLYAFD+HCNSFFPMF++LY   H++L+
Sbjct  121  TCCWFLTNAYLRKEAPNTCVVEQRVEWLYAFDLHCNSFFPMFVMLYASYHHYLN  174



>ref|XP_002885951.1| hypothetical protein ARALYDRAFT_899735 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62210.1| hypothetical protein ARALYDRAFT_899735 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   286 bits (732),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLL  +T+AYC  YDHS  H V VV+SVLL HFLITGAV++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLVVATVAYCVTYDHSGSHAVVVVVSVLLTHFLITGAVIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREETPNSHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNSYLREETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_002298750.2| hypothetical protein POPTR_0001s30740g [Populus trichocarpa]
 gb|EEE83555.2| hypothetical protein POPTR_0001s30740g [Populus trichocarpa]
Length=254

 Score =   284 bits (727),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 159/177 (90%), Gaps = 4/177 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNS---VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  279
            MLPT+S KGR SS +        FPQYLRRI+KWQQMDIEYTFWQML+LCTSPKVVYQHT
Sbjct  1    MLPTTS-KGRASSSSTSRVNSSTFPQYLRRIIKWQQMDIEYTFWQMLYLCTSPKVVYQHT  59

Query  280  KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGA  459
            K+HKQTKNQWARDDPAF+VI SLLLA + LAYCAAYDHSAGH VFVVISVLLFHFLITGA
Sbjct  60   KFHKQTKNQWARDDPAFVVISSLLLAVAALAYCAAYDHSAGHAVFVVISVLLFHFLITGA  119

Query  460  VLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             L+TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  120  GLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  176



>ref|XP_010488944.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score =   284 bits (726),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLLA +T+AYCA YDHS  H V VV+SVLL HFLITGAV++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLAVATVAYCATYDHSGSHAVVVVVSVLLSHFLITGAVIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREE PNSHVVEQRVEWLY FDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSP  174



>ref|XP_010467286.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score =   284 bits (726),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLLA +T+AYCA YDHS  H V VV+SVLL HFLITGAV++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLAVATVAYCATYDHSGSHAVVVVVSVLLSHFLITGAVIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREE PNSHVVEQRVEWLY FDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSP  174



>ref|XP_010518032.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score =   284 bits (726),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPLFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLLA +T+AYCA YDHS  H V VV+SVLL HFLITGAV++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLAVATVAYCATYDHSGSHAVVVVVSVLLSHFLITGAVIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREE PNSHVVEQRVEWLY FDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  121  TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSP  174



>ref|XP_006409583.1| hypothetical protein EUTSA_v10022824mg [Eutrema salsugineum]
 gb|ESQ51036.1| hypothetical protein EUTSA_v10022824mg [Eutrema salsugineum]
Length=252

 Score =   282 bits (722),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLL  +TLAYCA YDHS  H VFVV+SV L HF ITGAV++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLVVATLAYCATYDHSGSHAVFVVVSVFLSHFFITGAVIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREE PNSHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_009396396.1| PREDICTED: protein unc-50 homolog [Musa acuminata subsp. malaccensis]
Length=248

 Score =   281 bits (720),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGR +S  RP   F QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRGTSAVRPAPGFSQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF VI  L L  +T AYCAAY  +  H+VF V+SV+ FHFL+ G +L+
Sbjct  60   KQTKNQWARDDPAFAVIFCLFLIVATSAYCAAYGVTWVHSVFTVVSVVAFHFLLAGTILA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN Y+REETP+SH VEQRVEWLYAFDVHCNSFFP F+LLYV+ YF+SP
Sbjct  120  TCCWFLTNTYMREETPSSHAVEQRVEWLYAFDVHCNSFFPAFVLLYVIQYFVSP  173



>ref|XP_011030395.1| PREDICTED: protein unc-50 homolog [Populus euphratica]
Length=254

 Score =   281 bits (720),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 158/177 (89%), Gaps = 4/177 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNS---VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  279
            MLPT+S KGR SS +        FPQYLRRI+KWQQMDIEYTFWQML+LCTSPKVVYQHT
Sbjct  1    MLPTTS-KGRASSSSTSRVNSSTFPQYLRRIIKWQQMDIEYTFWQMLYLCTSPKVVYQHT  59

Query  280  KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGA  459
            K+HKQTKNQWARDDPAF+VI SLLLA + LAYCAAYDHSAGH VFVVI VLLFHFLITGA
Sbjct  60   KFHKQTKNQWARDDPAFVVISSLLLAVAALAYCAAYDHSAGHAVFVVIYVLLFHFLITGA  119

Query  460  VLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             L+TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYFLSP
Sbjct  120  GLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFLSP  176



>gb|EPS67574.1| hypothetical protein M569_07201, partial [Genlisea aurea]
Length=235

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 153/181 (85%), Gaps = 10/181 (6%)
 Frame = +1

Query  109  MLPTSS-------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  267
            MLPTSS       LKGR    AR +  FP YLRRIVKW+QMDIEYTFWQMLHLCTSPKVV
Sbjct  1    MLPTSSSSSSSSSLKGRP---ARRSHFFPLYLRRIVKWRQMDIEYTFWQMLHLCTSPKVV  57

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            YQHTKYHKQTKNQWARDDPAF+VI +LLL+ +TLAYCAAYDH++GH VF+V SV++FHFL
Sbjct  58   YQHTKYHKQTKNQWARDDPAFVVIFTLLLSATTLAYCAAYDHNSGHAVFLVFSVVIFHFL  117

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLS  627
              GA+++T CW  TNNYLR E  NSHVVEQRVEWLYAFDVHCNSFFP+F+LLYV+HY +S
Sbjct  118  AAGAIIATFCWLFTNNYLRVEAVNSHVVEQRVEWLYAFDVHCNSFFPVFVLLYVIHYLVS  177

Query  628  P  630
            P
Sbjct  178  P  178



>emb|CDY52420.1| BnaCnng22410D [Brassica napus]
Length=252

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  160  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  339
            N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  18   NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  77

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN  519
            CSLLL  +TLAYCA YDHS  H V VV+SV L HFLITGAV++TCCWFLTN+YLREE PN
Sbjct  78   CSLLLIVATLAYCATYDHSGSHAVVVVVSVFLTHFLITGAVIATCCWFLTNSYLREEAPN  137

Query  520  SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            SHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  138  SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_009123230.1| PREDICTED: protein unc-50 homolog [Brassica rapa]
 emb|CDY54469.1| BnaA09g52730D [Brassica napus]
Length=252

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  160  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  339
            N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  18   NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  77

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN  519
            CSLLL  +TLAYCA YDHS  H V VV+SV L HFLITGAV++TCCWFLTN+YLREE PN
Sbjct  78   CSLLLIVATLAYCATYDHSGSHAVVVVVSVFLTHFLITGAVIATCCWFLTNSYLREEAPN  137

Query  520  SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            SHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  138  SHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  174



>gb|AAM61449.1| unknown [Arabidopsis thaliana]
Length=252

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLL  +T+AYC  YDHS+ H V VV+SVLL HFLITGAV++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLVVATVAYCVTYDHSSSHAVVVVVSVLLTHFLITGAVIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREETPNSHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNSYLREETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_002518676.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43601.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score =   272 bits (696),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 1/150 (1%)
 Frame = +1

Query  109  MLPTSS-LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPTSS ++  ++S +RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY
Sbjct  1    MLPTSSKIRTSSASTSRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  60

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS GH VFVVISVLLFHFLITG VL
Sbjct  61   HKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTGHAVFVVISVLLFHFLITGVVL  120

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLY  555
            +TCCWF+TN YLREE PNSHVVEQRVEW++
Sbjct  121  ATCCWFMTNAYLREEAPNSHVVEQRVEWIF  150



>ref|NP_565370.1| UNC-50 family protein [Arabidopsis thaliana]
 gb|AAK55675.1|AF378872_1 At2g15240/F15A23.2 [Arabidopsis thaliana]
 gb|AAK96450.1| At2g15240/F15A23.2 [Arabidopsis thaliana]
 gb|AAD25568.2| expressed protein [Arabidopsis thaliana]
 gb|AEC06378.1| UNC-50 family protein [Arabidopsis thaliana]
Length=252

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVICSLLL  +T+AYC  YDHS+ H V VV+SVL  HFLITGAV++
Sbjct  61   KQTKNQWARDDPAFIVICSLLLVVATVAYCVTYDHSSSHAVVVVVSVLFTHFLITGAVIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN+YLREETPNSHVVEQRVEWLY FDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCCWFLTNSYLREETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP  174



>ref|XP_004956281.1| PREDICTED: protein unc-50 homolog [Setaria italica]
Length=247

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 144/174 (83%), Gaps = 2/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGAARSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIVI  L L  +T AYCAAY  SA H    + SV+ FHFL  G VL+
Sbjct  60   KQTKNQWARDDPAFIVILILFLMFATSAYCAAYGESASHAALTITSVVFFHFLFAGIVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP
Sbjct  120  TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSP  172



>ref|XP_008651375.1| PREDICTED: uncharacterized protein LOC100280372 isoform X1 [Zea 
mays]
 gb|ACG33123.1| unc-50 [Zea mays]
 gb|ACR34211.1| unknown [Zea mays]
 tpg|DAA60645.1| TPA: Unc-50 [Zea mays]
Length=247

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYVV YFLSP
Sbjct  120  TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVVQYFLSP  172



>ref|XP_006660415.1| PREDICTED: protein unc-50 homolog [Oryza brachyantha]
Length=247

 Score =   272 bits (695),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 144/174 (83%), Gaps = 2/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRAATRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+L HFL  G VL+
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVLVHFLFAGIVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP
Sbjct  120  TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSP  172



>ref|XP_008799595.1| PREDICTED: protein unc-50 homolog isoform X2 [Phoenix dactylifera]
Length=248

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGRT +  R + +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRTPAAVRTSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAAY  S  H V  V+SV++FHFLI G +L+
Sbjct  60   KQTKNQWARDDPAFVVILCLFLVVATSAYCAAYGESLAHAVSAVVSVVVFHFLIAGIILA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMFI+LYV+ YF+SP
Sbjct  120  TCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVIQYFVSP  173



>ref|XP_002462031.1| hypothetical protein SORBIDRAFT_02g013040 [Sorghum bicolor]
 gb|EER98552.1| hypothetical protein SORBIDRAFT_02g013040 [Sorghum bicolor]
Length=247

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR ++ + P  + P YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGAARSAPPLLGP-YLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP
Sbjct  120  TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSP  172



>ref|NP_001062566.1| Os09g0109500 [Oryza sativa Japonica Group]
 dbj|BAD17579.1| putative UNC50 [Oryza sativa Japonica Group]
 dbj|BAF24480.1| Os09g0109500 [Oryza sativa Japonica Group]
 dbj|BAG90439.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84080.1| hypothetical protein OsI_30369 [Oryza sativa Indica Group]
Length=247

 Score =   269 bits (688),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGAARSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAAY  S  H    + SV+L HFL  G VL+
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESPSHAALTITSVVLVHFLFAGIVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP
Sbjct  120  TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSP  172



>ref|XP_003576742.1| PREDICTED: protein unc-50 homolog [Brachypodium distachyon]
Length=247

 Score =   269 bits (687),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR ++ + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGAARSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAA+  SA H    + SV+  HFL  G VL+
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAAFGESASHAALTITSVVFIHFLFAGLVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP
Sbjct  120  TLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSP  172



>gb|ABK21352.1| unknown [Picea sitchensis]
Length=249

 Score =   268 bits (686),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S +GR  S  R + VFPQYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-RGRPPSTFRHSPVFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICS LLA +  AYCAAYD S  H  F V+SV+L HFL+ G  L+
Sbjct  60   KQTKNQWARDDPAFVVICSFLLAVAASAYCAAYDVSVAHAGFTVLSVVLVHFLLIGTFLA  119

Query  469  TCCWFLTNNYLREET-PNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCCWFLTNNYLREET  NSHVVEQ VEWLYAFDVHCNSFFP+F+ LYV+ YF+SP
Sbjct  120  TCCWFLTNNYLREETSSNSHVVEQHVEWLYAFDVHCNSFFPLFVALYVIQYFVSP  174



>ref|XP_006296617.1| hypothetical protein CARUB_v10014338mg, partial [Capsella rubella]
 gb|EOA29515.1| hypothetical protein CARUB_v10014338mg, partial [Capsella rubella]
Length=282

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  106  NMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
             MLPT+S    +SS +R N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKY
Sbjct  30   KMLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKY  89

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAFIVIC LLLA +T+AYCA YDHS+ H V VV+SVLL HFLITGA++
Sbjct  90   HKQTKNQWARDDPAFIVICILLLAVATVAYCATYDHSSSHAVVVVVSVLLSHFLITGAII  149

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +TCCWFLTN+YLREE PNSHVVEQRVEWLY FDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  150  ATCCWFLTNSYLREEAPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVIHYFLSP  204



>ref|XP_001773436.1| predicted protein [Physcomitrella patens]
 gb|EDQ61809.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPT + +GR SS   R NSV PQYLRRIVK+QQMD+EYTFWQM HLCTSPKVVYQ TKY
Sbjct  1    MLPTVN-RGRASSGGYRNNSVLPQYLRRIVKYQQMDMEYTFWQMRHLCTSPKVVYQQTKY  59

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF VIC +LLA +  ++CAAY HS    +F V SV++ HFL+ G  L
Sbjct  60   HKQTKNQWARDDPAFTVICGILLAVAVSSFCAAYGHSVAQAIFTVASVVILHFLLAGISL  119

Query  466  STCCWFLTNNYLREE-TPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +T CWFL+N+YLREE   ++HVVEQRVEWLYAFDVHCNS+FP+F++LYV+ YFLSP
Sbjct  120  ATICWFLSNHYLREEIAAHTHVVEQRVEWLYAFDVHCNSYFPLFVILYVLQYFLSP  175



>gb|ACN35099.1| unknown [Zea mays]
 tpg|DAA60644.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=254

 Score =   261 bits (667),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 142/181 (78%), Gaps = 9/181 (5%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVE-------WLYAFDVHCNSFFPMFILLYVVHYFLS  627
            T CWFLTN+YLREE PNSHVVEQRVE        LYAFDVHCNSFFP F++LYVV YFLS
Sbjct  120  TLCWFLTNSYLREE-PNSHVVEQRVECAHEILGRLYAFDVHCNSFFPAFVILYVVQYFLS  178

Query  628  P  630
            P
Sbjct  179  P  179



>gb|KHG13402.1| Protein unc-50 [Gossypium arboreum]
Length=241

 Score =   255 bits (652),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 139/186 (75%), Gaps = 35/186 (19%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV-------  267
            MLPT S    T S +RPNS+FPQYLRRIVKWQQMDIEYTFWQMLHLCT+PKVV       
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPKVVSVVHMNY  60

Query  268  -----YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVL  432
                 YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVL
Sbjct  61   HGGCSYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVL  120

Query  433  LFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVV  612
            LFHFL+TG  L+TCC                       WLYAFDVHCNSFFPMF++LYV+
Sbjct  121  LFHFLLTGVFLATCC-----------------------WLYAFDVHCNSFFPMFVMLYVI  157

Query  613  HYFLSP  630
            HYF+SP
Sbjct  158  HYFVSP  163



>ref|XP_010271213.1| PREDICTED: protein unc-50 homolog isoform X2 [Nelumbo nucifera]
Length=216

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 131/174 (75%), Gaps = 33/174 (19%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGRT S+ R N VFPQYLRRIVKW+QMDIEYTFWQM HLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRTHSNVRQNPVFPQYLRRIVKWEQMDIEYTFWQMFHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLL  +T AYCAA                            
Sbjct  60   KQTKNQWARDDPAFVVICSLLLVVATSAYCAA----------------------------  91

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
                FLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP+FI+LYV+HYFLSP
Sbjct  92   ----FLTNSYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPLFIMLYVIHYFLSP  141



>ref|XP_001783677.1| predicted protein [Physcomitrella patens]
 gb|EDQ51507.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPT + +GR S+   R NSV PQYLRRIVK++QMD+EYTFWQMLHLCTSPKVVYQ TKY
Sbjct  1    MLPTVN-RGRASTGGYRNNSVLPQYLRRIVKYKQMDMEYTFWQMLHLCTSPKVVYQQTKY  59

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF+VICS LLA +  A+CAAY HS     F V+SV+  HF + G  L
Sbjct  60   HKQTKNQWARDDPAFVVICSFLLAVAATAFCAAYGHSVAQATFTVVSVVFMHFFLVGVSL  119

Query  466  STCCWFLTNNYLREE-TPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            ++ CWFL+N+YLREE T ++HVVEQRVEWLYAFDVHCN++FP++++LYV+ YFLSP
Sbjct  120  ASICWFLSNHYLREEFTVHTHVVEQRVEWLYAFDVHCNAYFPLYVVLYVLQYFLSP  175



>gb|KHN06766.1| Protein unc-50 like [Glycine soja]
Length=210

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  235  MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVF  414
            MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VICSLLLA +TLAYCAAYDHS  HT+ 
Sbjct  1    MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVICSLLLAVATLAYCAAYDHSTAHTLL  60

Query  415  VVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMF  594
            V+ SVL FHF++TG  L+T CWFLTN+YLREE PNS+VVEQRVEW+YAFDVHCNSFFP+F
Sbjct  61   VIFSVLFFHFILTGVFLATFCWFLTNSYLREEAPNSYVVEQRVEWMYAFDVHCNSFFPLF  120

Query  595  ILLYVVHYFLSP  630
            +LLYV+HYFLSP
Sbjct  121  VLLYVIHYFLSP  132



>ref|XP_010547979.1| PREDICTED: protein unc-50 homolog isoform X2 [Tarenaya hassleriana]
Length=229

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 131/174 (75%), Gaps = 23/174 (13%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +F QY RRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICSLLLA +T+AYC AYDHS  H +FVV SVLL HF   GA ++
Sbjct  61   KQTKNQWARDDPAFVVICSLLLAVATIAYCVAYDHSVSHALFVVFSVLLLHFFTIGATVA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCC                       WLYAFDVHCNSFFPMF+LLYVVHYFLSP
Sbjct  121  TCC-----------------------WLYAFDVHCNSFFPMFVLLYVVHYFLSP  151



>ref|XP_010928388.1| PREDICTED: protein unc-50 homolog isoform X3 [Elaeis guineensis]
Length=216

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 125/174 (72%), Gaps = 33/174 (19%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGRT +  RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDP F+VI  L L  +T AYCAA                            
Sbjct  60   KQTKNQWARDDPGFVVILCLFLVVATSAYCAA----------------------------  91

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
                FLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFP FI+LYV+ YF+SP
Sbjct  92   ----FLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPTFIMLYVIQYFVSP  141



>ref|XP_010928387.1| PREDICTED: protein unc-50 homolog isoform X2 [Elaeis guineensis]
Length=225

 Score =   234 bits (598),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 127/174 (73%), Gaps = 24/174 (14%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT S KGRT +  RP+ +FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTVS-KGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDP F+VI  L L  +T AYCAAY  S  H V  V+SV++FHFLI G +L+
Sbjct  60   KQTKNQWARDDPGFVVILCLFLVVATSAYCAAYGESLAHAVSTVVSVVIFHFLIAGIILA  119

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TCC                       WLYAFDVHCNSFFP FI+LYV+ YF+SP
Sbjct  120  TCC-----------------------WLYAFDVHCNSFFPTFIMLYVIQYFVSP  150



>gb|KJB47363.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=207

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            YQHTKYHKQTKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSA H VFVVISVLLFHFL
Sbjct  9    YQHTKYHKQTKNQWARDDPAFVVICSLLLAVATIAYCAAYDHSAAHAVFVVISVLLFHFL  68

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLS  627
            +TG  L+TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMF++LYV+HYF+S
Sbjct  69   LTGVFLATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFVMLYVIHYFVS  128

Query  628  P  630
            P
Sbjct  129  P  129



>gb|ABK24141.1| unknown [Picea sitchensis]
Length=217

 Score =   227 bits (578),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  208  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  387
            MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF+VICS LLA +  AYCAAY
Sbjct  1    MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFVVICSFLLAVAASAYCAAY  60

Query  388  DHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREET-PNSHVVEQRVEWLYAFD  564
            D S  H  F V+SV+L HFL+ G  L+TCCWFLTNNYLREET  NSHVVEQ VEWLYAFD
Sbjct  61   DVSVAHAGFTVLSVVLVHFLLIGTFLATCCWFLTNNYLREETSSNSHVVEQHVEWLYAFD  120

Query  565  VHCNSFFPMFILLYVVHYFLSP  630
            VHCNSFFP+F+ LYV+ YF+SP
Sbjct  121  VHCNSFFPLFVALYVIQYFVSP  142



>tpg|DAA60647.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=215

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 125/174 (72%), Gaps = 34/174 (20%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAA                            
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAA----------------------------  91

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
                FLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYVV YFLSP
Sbjct  92   ----FLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVVQYFLSP  140



>ref|XP_002963517.1| hypothetical protein SELMODRAFT_165762 [Selaginella moellendorffii]
 gb|EFJ35388.1| hypothetical protein SELMODRAFT_165762 [Selaginella moellendorffii]
Length=246

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++  GR   H +   + P YLRRIVKW+QMD+EYTFWQMLHLCT+PKVVYQHTKYH
Sbjct  1    MLPTTA--GRGLRHPQQQQL-PHYLRRIVKWRQMDVEYTFWQMLHLCTAPKVVYQHTKYH  57

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF VI S+ LA +  AYCAAY  S       V+ V+  HFL+TG  L+
Sbjct  58   KQTKNQWARDDPAFTVISSIFLALAASAYCAAYGSSFLQAGVTVVGVVWLHFLLTGISLA  117

Query  469  TCCWFLTNNYLREETP-NSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            + CWFL N YLREE   +SHVVEQRVEWLYAFDVHCN++FP+FI+LYV+HYF SP
Sbjct  118  SICWFLCNRYLREEAAIHSHVVEQRVEWLYAFDVHCNAYFPLFIVLYVIHYFFSP  172



>ref|XP_002981564.1| hypothetical protein SELMODRAFT_114708 [Selaginella moellendorffii]
 gb|EFJ17379.1| hypothetical protein SELMODRAFT_114708 [Selaginella moellendorffii]
Length=248

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 136/176 (77%), Gaps = 4/176 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSH-ARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            MLPT++  GR   H  +     P YLRRIVKW+QMD+EYTFWQMLHLCT+PKVVYQHTKY
Sbjct  1    MLPTTA--GRGLRHPQQQQQQLPHYLRRIVKWRQMDVEYTFWQMLHLCTAPKVVYQHTKY  58

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKNQWARDDPAF VI S+ LA +  AYCAAY  S       V+ V+  HFL+TG  L
Sbjct  59   HKQTKNQWARDDPAFTVISSIFLALAASAYCAAYGSSFLQAGVTVVGVVWLHFLLTGISL  118

Query  466  STCCWFLTNNYLREETP-NSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            ++ CWFL N YLREE   +SHVVEQRVEWLYAFDVHCN++FP+FI+LYV+HYF SP
Sbjct  119  ASICWFLCNRYLREEAAIHSHVVEQRVEWLYAFDVHCNAYFPLFIVLYVIHYFFSP  174



>ref|XP_010096286.1| hypothetical protein L484_027024 [Morus notabilis]
 gb|EXB63681.1| hypothetical protein L484_027024 [Morus notabilis]
Length=286

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 13/185 (7%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYT---FWQMLHLCTS------PK  261
            MLPT S    +SS +R N +F QYLRRI+K   + ++     F+  + +  S      P 
Sbjct  1    MLPTVSKVRSSSSTSRSNPMFVQYLRRIIKLVLLCLDSVCDEFYVAVTIGKSGRQKLLPF  60

Query  262  VVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFH  441
            +  Q  K   +TKNQWARDDPAF+VICSLLLA +T+AYCAAYDHSAGH VFVVISVLLFH
Sbjct  61   ITMQ--KVTVETKNQWARDDPAFVVICSLLLAVATMAYCAAYDHSAGHAVFVVISVLLFH  118

Query  442  FLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEW--LYAFDVHCNSFFPMFILLYVVH  615
            FLI G +L+T CWF+TN+YLREE PNSHVVEQRVEW  LYAFDVHCNSFFPMF++LYV+H
Sbjct  119  FLIMGILLATFCWFITNSYLREEAPNSHVVEQRVEWQVLYAFDVHCNSFFPMFVMLYVIH  178

Query  616  YFLSP  630
            YFLSP
Sbjct  179  YFLSP  183



>gb|ADI46868.1| UNC50f [Volvox carteri f. nagariensis]
Length=250

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = +1

Query  178  YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLA  357
            Y+RR+ K +Q DIEYTFW ML LC SPK  Y+HT YHKQTKNQWARDDPAF+V+C LL+A
Sbjct  25   YMRRLFKPRQWDIEYTFWLMLQLCLSPKTAYRHTAYHKQTKNQWARDDPAFMVVCCLLVA  84

Query  358  CSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQ  537
              +LAYC  +  S   + F+++S ++  +L+ G  L+T CW LTN +LR+   + H VEQ
Sbjct  85   VGSLAYCVTFGSSLWGSAFIILSAVMIDYLMLGISLATFCWMLTNRFLRKSNLHHHQVEQ  144

Query  538  RVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             VEWLYAFDVHCNSFFP F+LLYV+ + LSP
Sbjct  145  YVEWLYAFDVHCNSFFPAFLLLYVMQFLLSP  175



>ref|XP_008338222.1| PREDICTED: protein unc-50 homolog [Malus domestica]
Length=124

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT+S    +SS +R N +  QYLRRI+KWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH
Sbjct  1    MLPTTSRGRSSSSSSRTNPMPIQYLRRIIKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VICS+LLA +TLAYCAAYDHSA H VFVVISVL FHFL  G +L+
Sbjct  61   KQTKNQWARDDPAFVVICSVLLAVATLAYCAAYDHSAAHAVFVVISVLFFHFLFIGMLLA  120

Query  469  TCCW  480
            T CW
Sbjct  121  TFCW  124



>ref|XP_005652231.1| UNC-50 [Coccomyxa subellipsoidea C-169]
 gb|EIE27687.1| UNC-50 [Coccomyxa subellipsoidea C-169]
Length=249

 Score =   197 bits (501),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++   R+S+  R  SV   YLRRI+K +QMD EYTFW ML LC SPK  Y+HT YH
Sbjct  1    MLPTTNHGSRSSNPQRRLSVLSTYLRRIIKPKQMDFEYTFWLMLQLCISPKTAYRHTSYH  60

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKN WARDDPA++VIC LL+  +  AYC A+  S  H++F V+S +   FL  G  ++
Sbjct  61   KQTKNHWARDDPAYVVICCLLVGAAACAYCVAFSSSVWHSLFTVMSAVFVDFLAIGVAIA  120

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFP  588
            T  WFL N  LR++T +SH +EQ VEW+YAFDVHCNS+FP
Sbjct  121  TVGWFLANKCLRKKTLHSHAIEQHVEWMYAFDVHCNSYFP  160



>gb|ADI46908.1| UNC50m [Volvox carteri f. nagariensis]
Length=250

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 0/174 (0%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            +LPTSS +  +    +  S    YLRR +K +Q D+EYTFW ML LC+SPK  Y+HT YH
Sbjct  2    LLPTSSHQTSSIRRVQIKSHMSAYLRRFLKPRQWDLEYTFWLMLQLCSSPKTAYRHTAYH  61

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDP F+V+C +L+A ++ AYC  +  S   ++ +V++ +L  F + G  L+
Sbjct  62   KQTKNQWARDDPGFVVVCCILVAVASSAYCVTFGESFWDSLVIVLTAVLVDFFMLGIALA  121

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            T CW +TN  LR+   + H VEQ VEWLY+FDVHCNSFFP F++LYV+ + LSP
Sbjct  122  TACWLITNRLLRKRNLHHHQVEQHVEWLYSFDVHCNSFFPFFLVLYVLQFLLSP  175



>emb|CDX98085.1| BnaA06g08360D [Brassica napus]
Length=124

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  160  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  339
            N +F QY RRIVKWQQMD+EYTFWQML+LCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI
Sbjct  18   NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  77

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCW  480
            CSLLL  +TLAYCA YDHS  H V VVISV L HFLITG +++TCCW
Sbjct  78   CSLLLIVATLAYCATYDHSGSHAVVVVISVFLTHFLITGGLIATCCW  124



>gb|ACU18710.1| unknown [Glycine max]
Length=131

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 108/128 (84%), Gaps = 8/128 (6%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA------RPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  267
            MLPT+S KGR+SS +      RPN+ +   YLRRI+KWQQMDIEYTFWQMLHLCTSPKVV
Sbjct  1    MLPTAS-KGRSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPKVV  59

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            YQHTKYHKQTKNQWARDDPAF+VIC LLLA +TLAYCAAYDHS  HT+ V+ SVLLFHFL
Sbjct  60   YQHTKYHKQTKNQWARDDPAFVVICYLLLAVATLAYCAAYDHSTAHTLLVIFSVLLFHFL  119

Query  448  ITGAVLST  471
            +TG  L+T
Sbjct  120  LTGVFLAT  127



>dbj|BAK01787.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +1

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            YQHTKYHKQTKNQWARDDPAFIVI  L L  +T AYCAA+  SA H    +ISV+  HFL
Sbjct  11   YQHTKYHKQTKNQWARDDPAFIVILILFLVFATSAYCAAFGESAPHAALTIISVVFVHFL  70

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLS  627
              G VL+T CWFLTN+YLREE PNSHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLS
Sbjct  71   FAGLVLATLCWFLTNSYLREE-PNSHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLS  129

Query  628  P  630
            P
Sbjct  130  P  130



>ref|XP_005716895.1| unnamed protein product [Chondrus crispus]
 emb|CDF37076.1| unnamed protein product [Chondrus crispus]
Length=253

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = +1

Query  112  LPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHK  291
            LP    K   +S    +   P+Y+RR  ++ QMD++YT WQML+LC +P  VY+ TKYHK
Sbjct  6    LPLYGAKSGATSLGGSSVQMPEYVRRFFQYPQMDMDYTLWQMLYLCVAPSRVYRTTKYHK  65

Query  292  QTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLST  471
            QTKNQWARDDPAFI I    +A S+L Y  A+  S G     ++  ++  F + G + +T
Sbjct  66   QTKNQWARDDPAFIAIMVYFMAISSLGYAIAFHKSVGGFFKAILYAIVVDFGLVGVLAAT  125

Query  472  CCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFL  624
              W+L N YL  E   SH  EQ+VEWLYAFDVHCNSFFP FILLYV  YFL
Sbjct  126  LGWYLANQYLLIENAGSHTTEQKVEWLYAFDVHCNSFFPFFILLYVFQYFL  176



>ref|XP_002503978.1| unc-50 family protein [Micromonas sp. RCC299]
 gb|ACO65236.1| unc-50 family protein [Micromonas sp. RCC299]
Length=249

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  139  TSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARD  318
            +   A   S FP Y+RR++K++QMD+EYTFWQM  +CT+PKVVY+HT Y KQTKNQWARD
Sbjct  11   SQKGAYRGSGFPTYVRRLMKFRQMDLEYTFWQMYLMCTNPKVVYRHTMYRKQTKNQWARD  70

Query  319  DPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNY  498
            DPAF+V+ ++++   ++ YC  Y  S G   + V+  +L  FL  GA ++T  W++ N Y
Sbjct  71   DPAFVVLTAIMVFAVSILYCLFYSRSLGQAAYAVVRSVLVDFLGVGAGVATAYWYVANRY  130

Query  499  LREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +RE   +SH VEQRVEW+YAFDVH N+FF +F+ LY     LSP
Sbjct  131  MREGVNHSHAVEQRVEWMYAFDVHVNAFFTLFVSLYCGQLVLSP  174



>ref|XP_003054963.1| unc-50 family protein [Micromonas pusilla CCMP1545]
 gb|EEH60215.1| unc-50 family protein [Micromonas pusilla CCMP1545]
Length=234

 Score =   188 bits (478),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = +1

Query  172  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            P YLRR +KW+QMD+EY  WQM  +CT+PKVVY+HT Y KQTKNQWARDDPA +V+ S+L
Sbjct  8    PPYLRRAMKWKQMDLEYAMWQMWLMCTNPKVVYRHTMYRKQTKNQWARDDPAVVVLTSIL  67

Query  352  LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
            +  ++  YC  +  S  H+V+VV S  L  ++  GA+++T  WF++N +LR    +SH +
Sbjct  68   VFATSSLYCCFFSKSFKHSVYVVASAGLIDYVGLGALIATGYWFVSNRFLRTGVGHSHAI  127

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            EQRVEWLYAFDVHCN+FFP+F+ LY     LSP
Sbjct  128  EQRVEWLYAFDVHCNAFFPLFLQLYAAQLVLSP  160



>dbj|GAM19513.1| hypothetical protein SAMD00019534_026880, partial [Acytostelium 
subglobosum LB1]
Length=252

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 121/171 (71%), Gaps = 7/171 (4%)
 Frame = +1

Query  136  RTSSHARPNSV-----FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTK  300
            RTSS    +SV      P+Y RRI+ + QMDIEYTFW M +LC +P  VY++T +HKQTK
Sbjct  7    RTSSSLNSDSVRFKRFVPEYFRRIMHYPQMDIEYTFWIMFYLCFNPARVYRNTSWHKQTK  66

Query  301  NQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFLITGAVLSTCC  477
            NQWARDDPAF+VI    ++ ++++Y  A+ + S  H +  +   + F F+  G V +T  
Sbjct  67   NQWARDDPAFVVIVVFFMSIASMSYAIAFHYLSVVHIIKTMFWAVFFDFITVGLVTATAG  126

Query  478  WFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            WFL+N +LRE + + H V+Q+VEWLYAFD+HCNSFFP+FI+LYV+H+FL P
Sbjct  127  WFLSNRFLRESS-HHHSVDQKVEWLYAFDIHCNSFFPLFIILYVIHFFLLP  176



>ref|NP_001146770.1| uncharacterized protein LOC100280372 [Zea mays]
 gb|ACL54712.1| unknown [Zea mays]
 tpg|DAA60646.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=123

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT++ KGR +S + P  +F  YLRRIVKWQQMDIEYTFWQM+HLCTSPKVVYQHTKYH
Sbjct  1    MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPKVVYQHTKYH  59

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAF+VI  L L  +T AYCAAY  SA H    + SV+  HFL  G VL+
Sbjct  60   KQTKNQWARDDPAFVVILILFLVFATSAYCAAYGESASHAALTITSVVFLHFLFAGIVLA  119

Query  469  TCCW  480
            T CW
Sbjct  120  TLCW  123



>ref|XP_008799585.1| PREDICTED: protein unc-50 homolog isoform X1 [Phoenix dactylifera]
Length=310

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            YQHTKYHKQTKNQWARDDPAF+VI  L L  +T AYCAAY  S  H V  V+SV++FHFL
Sbjct  115  YQHTKYHKQTKNQWARDDPAFVVILCLFLVVATSAYCAAYGESLAHAVSAVVSVVVFHFL  174

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLS  627
            I G +L+TCCWFLTN YLREE PNSHVVEQRVEWLYAFDVHCNSFFPMFI+LYV+ YF+S
Sbjct  175  IAGIILATCCWFLTNAYLREEAPNSHVVEQRVEWLYAFDVHCNSFFPMFIMLYVIQYFVS  234

Query  628  P  630
            P
Sbjct  235  P  235



>ref|XP_001696427.1| UNC-50 family protein [Chlamydomonas reinhardtii]
 gb|EDP08404.1| UNC-50 family protein [Chlamydomonas reinhardtii]
Length=245

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 4/160 (3%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLP ++  G+  +     +    YLRR +K +Q D+EYTFW ML L  SPK  Y+HT YH
Sbjct  1    MLPQATTAGKRGNKGYLGT----YLRRFLKPKQWDLEYTFWMMLQLVISPKTAYRHTAYH  56

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKNQWARDDPAFIV+C  L+  ++LAYC  +  +  HT+  V+S +L  FL+ G  ++
Sbjct  57   KQTKNQWARDDPAFIVVCCALVTVASLAYCVTFGDTLWHTLLTVLSAVLVDFLLIGVAMA  116

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFP  588
            T CW +TN +LR+   + H VEQ VEWLYAFDVHCNS+FP
Sbjct  117  TACWVITNRFLRKRNLHHHQVEQHVEWLYAFDVHCNSYFP  156



>gb|EFA81996.1| UNC-50 family protein [Polysphondylium pallidum PN500]
Length=211

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 125/177 (71%), Gaps = 5/177 (3%)
 Frame = +1

Query  103  GNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTK  282
            G    ++SL G +  + R   + P+Y RRI  + QMDIEYTFW M +LC +P  VY++T 
Sbjct  4    GVTRTSTSLHGDSVRYKR---IVPEYFRRIFHYPQMDIEYTFWIMFYLCFNPARVYRNTS  60

Query  283  YHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFLITGA  459
            +HKQTKNQWARDDPAF+VI    ++ ++++Y  A+ + S  H +  +   + F F+  G 
Sbjct  61   WHKQTKNQWARDDPAFVVILVFFMSIASMSYAIAFHYLSILHIIKTMFWAVFFDFITVGL  120

Query  460  VLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            V++T  W+++N++LRE + + H V+Q+VEWLYAFD+HCNSFFP+FI+LYV+H+FL P
Sbjct  121  VVATAGWWISNHFLRE-SAHHHSVDQKVEWLYAFDIHCNSFFPLFIILYVIHFFLLP  176



>gb|EMS49427.1| hypothetical protein TRIUR3_32733 [Triticum urartu]
Length=252

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 121/217 (56%), Gaps = 45/217 (21%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQ-------------------QMDIEYTFW  231
            MLPT++ KGR ++ + P  +F  YLRRIVK                       D+ Y F 
Sbjct  1    MLPTTASKGRGAARSAP-PLFGPYLRRIVKVGAGLLLGIHIHSSGSLRHAYGADLAYGFA  59

Query  232  QMLHLCTSPKVVYQHTKYHK------------------------QTKNQWARDDPAFIVI  339
            +      +       TK                           +TKNQWARDDPAFIVI
Sbjct  60   RPRGASAAAICGPGATKTSNLVRVSYVAEMRVCPRFLISIFLFTETKNQWARDDPAFIVI  119

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN  519
              L L  +T AYCAA+  SA H    +ISV+  HFL  G VL+T CWFLTN+YLREE PN
Sbjct  120  LILFLVFATSAYCAAFGESAPHAALTIISVVFVHFLFAGLVLATLCWFLTNSYLREE-PN  178

Query  520  SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            SHVVEQRVEWLYAFDVHCNSFFP F++LYV+ YFLSP
Sbjct  179  SHVVEQRVEWLYAFDVHCNSFFPAFVILYVLQYFLSP  215



>ref|XP_003082233.1| putative UNC50 (ISS) [Ostreococcus tauri]
 emb|CAL57179.1| UNC-50 [Ostreococcus tauri]
Length=272

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 117/194 (60%), Gaps = 20/194 (10%)
 Frame = +1

Query  109  MLPTSSLKG-------RTSSHARPNSVF----------PQYLRRIVKWQQMDIEYTFWQM  237
            MLPT+S          R +S+A    V+            YLRR  +W+QMD+EY+ WQ 
Sbjct  1    MLPTTSSDAAESRGSHRRASYAERYRVYVAAAAKSAQTGHYLRRAFRWRQMDVEYSLWQA  60

Query  238  LHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY-DHSAGHTVF  414
              +C +PK VY+HT Y KQTKN WARDDP F+V+  + +  + + +CAAY D     +  
Sbjct  61   AAMCVNPKAVYRHTTYRKQTKNHWARDDPTFVVLSCVAVGLAAIGWCAAYGDGGTSGSAR  120

Query  415  VVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN--SHVVEQRVEWLYAFDVHCNSFFP  588
            VV   ++  +L  GAVL+T  W L N +LR + P   SH VEQRVEWLYAFDVHCN+F P
Sbjct  121  VVARCVIGDYLGVGAVLATVSWHLANTHLRTKLPGGHSHAVEQRVEWLYAFDVHCNAFVP  180

Query  589  MFILLYVVHYFLSP  630
             ++LLYVV   LSP
Sbjct  181  TYVLLYVVQLTLSP  194



>ref|XP_005848175.1| hypothetical protein CHLNCDRAFT_22928 [Chlorella variabilis]
 gb|EFN56073.1| hypothetical protein CHLNCDRAFT_22928 [Chlorella variabilis]
Length=255

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQ---YLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  279
            MLPTSS     SS  R +S +     Y RR+ K  QMD +YT W ML LC SPK  Y+HT
Sbjct  1    MLPTSSPPPGHSSKQRRHSRYSLLWLYFRRLFKPTQMDFQYTLWTMLQLCISPKTAYRHT  60

Query  280  KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGA  459
             YHKQTKN WARDDPAF+VIC  L+A + LAYC A+ HS G ++  ++S +   FL  GA
Sbjct  61   SYHKQTKNHWARDDPAFVVICCTLVALAALAYCLAFSHSVGRSLLTIVSAVAVDFLAVGA  120

Query  460  VLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMF  594
             ++T  W L+N +LR +  +SH VEQ VEW+YAFDVHCN+FFPMF
Sbjct  121  AIATAGWALSNRFLRRQNQHSHAVEQSVEWMYAFDVHCNAFFPMF  165



>gb|KEH44100.1| UNC-50 family protein [Medicago truncatula]
Length=189

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +1

Query  343  SLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNS  522
            +LLLA +TLAYCAAYDHS+GH +FVV SVLLFHFL+TG  L+T CWFLTN+YLREE PNS
Sbjct  16   TLLLAVATLAYCAAYDHSSGHALFVVFSVLLFHFLLTGIFLATFCWFLTNSYLREEAPNS  75

Query  523  HVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +VVEQRVEW+YAFDVHCNSFFPMF+LLYV+HYFLSP
Sbjct  76   YVVEQRVEWMYAFDVHCNSFFPMFVLLYVIHYFLSP  111



>gb|KIZ03662.1| putative Protein unc-50 like protein [Monoraphidium neglectum]
Length=212

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 102/141 (72%), Gaps = 4/141 (3%)
 Frame = +1

Query  208  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  387
            MD EYTFW ML LC SPK  Y+HT Y KQTKNQWARDDPAF+V+C LLLA ++ AYC   
Sbjct  1    MDFEYTFWLMLQLCISPKTAYRHTSYQKQTKNQWARDDPAFVVVCCLLLAGASAAYCV--  58

Query  388  DHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDV  567
              +  H++  ++S ++  FL+ G  +S+  WF++N +LR+     H VEQ VEWLY+FDV
Sbjct  59   --TLWHSLLSILSAVVVDFLLIGLAISSASWFISNRFLRKRNLPHHQVEQHVEWLYSFDV  116

Query  568  HCNSFFPMFILLYVVHYFLSP  630
            HCNS+FP+F+LLYV  + LSP
Sbjct  117  HCNSYFPLFLLLYVFQFLLSP  137



>ref|XP_629704.1| UNC-50 family protein [Dictyostelium discoideum AX4]
 sp|Q54DD7.1|UNC50_DICDI RecName: Full=Protein unc-50 homolog [Dictyostelium discoideum]
 gb|EAL61284.1| UNC-50 family protein [Dictyostelium discoideum AX4]
Length=261

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 112/168 (67%), Gaps = 2/168 (1%)
 Frame = +1

Query  130  KGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQW  309
             G  SS +R   + P+Y RRI  + QMDIEYTFW M +LC +P  VY+ T +HKQTKNQW
Sbjct  17   DGTASSASRYRRLIPEYFRRIFHYPQMDIEYTFWIMFYLCFNPSRVYRVTSWHKQTKNQW  76

Query  310  ARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFLITGAVLSTCCWFL  486
            ARDDPAF VI    +A ++++Y   +   S  + + V+   +   F+  G +++T  W++
Sbjct  77   ARDDPAFAVILVFFMAIASMSYAITFHFLSFLNVIKVMFWAVFVDFITVGLLIATIGWWV  136

Query  487  TNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            TN +LR    N H V+Q VEWLYAFD+HCNSFFP+FI+LYVV +FL P
Sbjct  137  TNKFLRVSVHN-HSVDQSVEWLYAFDIHCNSFFPLFIILYVVQFFLLP  183



>ref|XP_003294507.1| hypothetical protein DICPUDRAFT_159511 [Dictyostelium purpureum]
 gb|EGC28968.1| hypothetical protein DICPUDRAFT_159511 [Dictyostelium purpureum]
Length=255

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 8/181 (4%)
 Frame = +1

Query  109  MLPTS------SLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  270
            MLP S      S   R  S +R   + P+Y RRI  + QMDIEYTFW M +LC  P  VY
Sbjct  1    MLPISYTNINNSRITRDGSSSRYRRLIPEYFRRIFHYPQMDIEYTFWIMFYLCFGPSRVY  60

Query  271  QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLLFHFL  447
            + T +HKQTKNQWARDDPAF VI    +A ++L+Y   + + S  H +  +   +   F+
Sbjct  61   KVTSWHKQTKNQWARDDPAFAVILVFFMAIASLSYAITFHYLSFYHIIKTMFWAVFVDFI  120

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLS  627
              G V++T  W++TN +LR    N H V+Q VEWLYAFD+HCNSFFP+FI LYV  +F  
Sbjct  121  SLGLVIATLGWWITNKFLRVSAHN-HSVDQNVEWLYAFDIHCNSFFPLFIFLYVFQFFFL  179

Query  628  P  630
            P
Sbjct  180  P  180



>gb|EXX54778.1| Gmh1p [Rhizophagus irregularis DAOM 197198w]
Length=316

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA-----RP---NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  264
            +LPT+S +    S       RP   ++  P +LRR+ ++ QMD E+  WQML+LC +P+ 
Sbjct  3    ILPTTSPRSTFPSDTHHKRRRPTYWSASIPIFLRRLFRFPQMDFEFALWQMLYLCIAPRR  62

Query  265  VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHF  444
            VY++  YHKQTKNQWARDDPAF+VI S  L  S +A+   Y H     + +++ ++   F
Sbjct  63   VYRNIYYHKQTKNQWARDDPAFVVILSFFLGVSAIAWGLVYGHGFIGILKMILFMVFIDF  122

Query  445  LITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFL  624
            ++ G V+ST CW   N +L       H VEQ VEW YAFDVHCNSFFP+F++LYV  +FL
Sbjct  123  VVVGMVISTICWAFANRFLTHRH-TLHAVEQTVEWAYAFDVHCNSFFPLFLILYVAQFFL  181



>ref|XP_005819408.1| hypothetical protein GUITHDRAFT_121394 [Guillardia theta CCMP2712]
 gb|EKX32428.1| hypothetical protein GUITHDRAFT_121394 [Guillardia theta CCMP2712]
Length=154

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 102/162 (63%), Gaps = 9/162 (6%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLPT  L    S         P YLRR +K+ QMD+E   WQM+ LC  PK VY+HT +H
Sbjct  1    MLPTPGLYRHRSG------FIPDYLRRAIKYSQMDLENASWQMVTLCIDPKRVYKHTCFH  54

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLITGAVL  465
            KQTKNQWARDDP F V+C   L  + +AY  A+   + G  + +V+  + F FL  GA+L
Sbjct  55   KQTKNQWARDDPGFTVLCIFFLLVAAVAYTIAFRVTNPGAFIRLVLGAVCFDFLFVGALL  114

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPM  591
            +T  W + N YLR  T   H VEQ+VEWLYAFD+HCN+FFP+
Sbjct  115  ATLTWAIANKYLRVRT--LHSVEQKVEWLYAFDIHCNAFFPL  154



>ref|XP_001420594.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98887.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=249

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = +1

Query  151  ARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAF  330
            AR N+    Y RR  +W+QMD+EY+ WQ   +C +PK VY+HT Y KQTKNQWARDDP F
Sbjct  6    ARRNASAGHYFRRAFRWRQMDVEYSLWQAASMCVNPKAVYRHTTYRKQTKNQWARDDPTF  65

Query  331  IVICSLLLACSTLAYCAAY-DHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLRE  507
            +V+  + +  + + YCA Y    A  T  +     +  +L  G VL+T  W+L N YLR 
Sbjct  66   VVMSCVFVTVAAIGYCAMYGGGGASATARIAARCAVGDYLGLGCVLATVSWYLANTYLRT  125

Query  508  E--TPNSHVVEQRVEWLYAFDVHCNSFFP  588
            +    +SH VEQRVEW+YAFDVHCN+F P
Sbjct  126  KHMGGHSHAVEQRVEWMYAFDVHCNAFAP  154



>emb|CDH59652.1| unc-50-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH55428.1| unc-50-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=258

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  172  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            P  LRR+ ++ QMD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+V+ + L
Sbjct  31   PIILRRLFRFPQMDFEFALWQMAYLLIAPRRVYRNIYYHKQTKNQWARDDPAFLVLLASL  90

Query  352  LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
            L  S +A+  AY       +  ++ ++L  FL+ G++ +T  WF++N +L  +T  +H V
Sbjct  91   LCVSAVAWGLAYGLGMVGILRAMLFMVLVDFLLVGSLAATFTWFVSNRFLIMDT-MAHAV  149

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            EQ+VEW YAFDVHCNSFFP+F++ YV+ +F  P
Sbjct  150  EQKVEWAYAFDVHCNSFFPVFLITYVLQFFFMP  182



>gb|ESA04707.1| hypothetical protein GLOINDRAFT_38971 [Rhizophagus irregularis 
DAOM 181602]
Length=215

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 93/139 (67%), Gaps = 1/139 (1%)
 Frame = +1

Query  208  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  387
            MD E+  WQML+LC +P+ VY++  YHKQTKNQWARDDPAF+VI S  L  S +A+   Y
Sbjct  1    MDFEFALWQMLYLCIAPRRVYRNIYYHKQTKNQWARDDPAFVVILSFFLGVSAIAWGLVY  60

Query  388  DHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDV  567
             H     + +++ ++   F++ G V+ST CW   N +L       H VEQ VEW YAFDV
Sbjct  61   GHGFIGILKMILFMVFIDFVVVGMVISTICWAFANRFLTHR-HTLHAVEQTVEWAYAFDV  119

Query  568  HCNSFFPMFILLYVVHYFL  624
            HCNSFFP+F++LYV  +FL
Sbjct  120  HCNSFFPLFLILYVAQFFL  138



>gb|EPB86721.1| hypothetical protein HMPREF1544_06507 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=257

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 109/172 (63%), Gaps = 2/172 (1%)
 Frame = +1

Query  115  PTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  294
            P+SS      S  RP    P  LRR+ ++ QMD E+  WQM +L  +P+ VY++  YHKQ
Sbjct  15   PSSSASYYNQS-GRPRKGSPALLRRLFRFPQMDFEFALWQMGYLLIAPRRVYRNIYYHKQ  73

Query  295  TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTC  474
            TKN+W+RDDPAFIV+ +  L  S +A+   Y       +  ++S+L   FL+ GA+++T 
Sbjct  74   TKNRWSRDDPAFIVLLATFLTLSAIAWGFTYHLGTYGIIKTILSMLCIDFLLFGAIIATF  133

Query  475  CWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             W++ N +L +   N++ V Q+VEW YAFDVHCN+F P++++LYV+  F  P
Sbjct  134  TWYICNKFLIQNI-NTYAVAQQVEWAYAFDVHCNAFIPVYLILYVIQLFFLP  184



>dbj|GAN07871.1| UNC-50-like protein [Mucor ambiguus]
Length=276

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 108/172 (63%), Gaps = 1/172 (1%)
 Frame = +1

Query  115  PTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  294
            P+SS     +   R     P  LRR+ ++ QMD E+  WQM +L  +P+ VY++  YHKQ
Sbjct  14   PSSSSASYYNQSGRSRKGSPALLRRLFRFPQMDFEFAVWQMGYLLIAPRRVYRNIYYHKQ  73

Query  295  TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTC  474
            TKN+W+RDDPAFIVI +  L  S + +   Y       +  ++S+L   FL+ GA++ST 
Sbjct  74   TKNRWSRDDPAFIVILAAFLTLSGIVWGFTYHLGTYGIIKTILSMLCIDFLLFGAMISTF  133

Query  475  CWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             W+++N +L +   N++ V Q+VEW YAFDVHCN+F P++++LYV+  F  P
Sbjct  134  TWYISNKFLIQNA-NTYAVAQQVEWAYAFDVHCNAFIPVYLILYVIQLFFLP  184



>ref|XP_008612241.1| hypothetical protein SDRG_08150 [Saprolegnia diclina VS20]
 gb|EQC34379.1| hypothetical protein SDRG_08150 [Saprolegnia diclina VS20]
Length=287

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 116/183 (63%), Gaps = 8/183 (4%)
 Frame = +1

Query  103  GNMLPTSSLKGRTSS---HARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  273
            G+  PT   +G + +       +S  P+Y  R+V ++QMD+E T++QM+ LC +P  VY+
Sbjct  24   GSAFPTRPARGASGTLPLFRNCSSAVPEYFARMVDYRQMDLEATYYQMVTLCIAPSKVYK  83

Query  274  HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLIT  453
               Y KQTKN+WARDDPAF VI  L L  ++LA+  A++ ++    F++I  ++  +L+ 
Sbjct  84   SAYYRKQTKNRWARDDPAFAVIQVLFLFVASLAWTVAFEKTSSLG-FLLICDVIVEWLVL  142

Query  454  GAVLSTCCWFLTNNYLREETP----NSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            G +LST  W++ N +LR   P    ++  VEQ VEW YAFD+HCN FF +F+L++VV + 
Sbjct  143  GVLLSTASWWVANTFLRLSPPGIASDTFFVEQSVEWQYAFDIHCNGFFVLFLLVHVVQFL  202

Query  622  LSP  630
            L P
Sbjct  203  LVP  205



>emb|CDS07387.1| hypothetical protein LRAMOSA01336 [Absidia idahoensis var. thermophila]
Length=259

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 113/184 (61%), Gaps = 10/184 (5%)
 Frame = +1

Query  106  NMLPTSSLKGRTS---------SHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            ++LPT++   R +          + R  S  P  ++R+V W QMD +   WQM +L  +P
Sbjct  2    SLLPTTNTFTRNTPPSWSSQPHKYGRSFSSRPLIIQRLVHWTQMDFDVAIWQMAYLLIAP  61

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            K VY++  YHKQTKNQWARDDPAF V+ + L+A S  A+   Y     + ++    ++L 
Sbjct  62   KRVYRNVYYHKQTKNQWARDDPAFFVLLTGLMAISGAAWAVVYGKGWWNVLYTSAFMVLV  121

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
             FL+ G++++T  W++TN +L+     S+ V+Q VEW YAFDVHCN++ P F++LY++ +
Sbjct  122  DFLLIGSLVATVTWWITNRFLKFNR-MSYAVDQNVEWAYAFDVHCNAYIPFFLILYILQF  180

Query  619  FLSP  630
            F  P
Sbjct  181  FFLP  184



>dbj|GAN10508.1| UNC-50-like protein [Mucor ambiguus]
Length=264

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = +1

Query  154  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  333
            + +S  P  + R+V++ QMD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+
Sbjct  29   KRSSPMPLIITRLVRFTQMDFEFALWQMAYLLLAPRRVYRNIYYHKQTKNQWARDDPAFL  88

Query  334  VICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREET  513
            V+ + LL  S +A+   +       V  ++ ++L  F++ G++++T  WF TN +L +  
Sbjct  89   VLLASLLCVSAIAWGLVFGLGFLGVVKAMLLMVLVDFVLVGSIVATLLWFFTNRFLNQSN  148

Query  514  PNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +   +Q+VEW YAFD+HCNSFFP+F++LY++ +
Sbjct  149  AITQTHDQKVEWAYAFDIHCNSFFPLFLILYIIQF  183



>ref|XP_009537820.1| hypothetical protein PHYSODRAFT_565867 [Phytophthora sojae]
 gb|EGZ07056.1| hypothetical protein PHYSODRAFT_565867 [Phytophthora sojae]
Length=295

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 111/172 (65%), Gaps = 21/172 (12%)
 Frame = +1

Query  154  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  333
            R  S FP+Y  R+V ++QMD++ TF+QM+ LC  P  VY+   Y KQTKN+WARDDPAF 
Sbjct  50   RSCSAFPEYFARVVDYRQMDLDATFYQMVTLCVQPAKVYKSAYYRKQTKNRWARDDPAFA  109

Query  334  VICSLLLACSTLAYCAAY--DHSAGHTVFVVISVLLFHFLIT-----GAVLSTCCWFLTN  492
            VI    L  +T+A+  A+  D +A +      + LLFH ++      G V+ST CW++ N
Sbjct  110  VIQFAFLLVATVAWAIAFRVDSAAKY------ASLLFHAVVVEWIGFGLVISTLCWWIAN  163

Query  493  NYLREETPNSH------VVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            ++LR+   NSH       VEQRVEW +AFD+HCNSFF MF+ LYV+ + L+P
Sbjct  164  HHLRQR--NSHGMGDALYVEQRVEWQFAFDIHCNSFFIMFLFLYVLQFLLAP  213



>gb|EMS24311.1| UNC-50-like protein [Rhodosporidium toruloides NP11]
 emb|CDR41879.1| RHTO0S06e07404g1_1 [Rhodosporidium toruloides]
Length=256

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 109/185 (59%), Gaps = 12/185 (6%)
 Frame = +1

Query  109  MLPTSSL--KGRTSSHARPNSVFPQ--------YLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPTS     G+ +      + FP+        +LR++ +W Q+D E   WQM +LC +P
Sbjct  1    MLPTSRAPRNGQGAQFTSAGNGFPRIGNGGMKTWLRKLSRWPQLDFELAVWQMCYLCIAP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDH-SAGHTVFVVISVLL  435
            + VY++  YHKQTKN WARDDPA +++ +L L  S + +   Y H     TV  V S + 
Sbjct  61   RRVYRNVYYHKQTKNTWARDDPAMLLLITLCLFVSAILWSVLYAHYGIVDTVKTVFSFIF  120

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
             HF   G ++ST  W L+N +L   T + H  +Q+VEWLYAFD+H NSFFP+F+ LYV  
Sbjct  121  LHFFGLGLLISTSLWALSNRFLTHAT-HVHATDQKVEWLYAFDIHANSFFPLFLQLYVAQ  179

Query  616  YFLSP  630
              L+P
Sbjct  180  LLLAP  184



>ref|XP_006676512.1| hypothetical protein BATDEDRAFT_9454 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82888.1| hypothetical protein BATDEDRAFT_9454 [Batrachochytrium dendrobatidis 
JAM81]
Length=272

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 2/154 (1%)
 Frame = +1

Query  160  NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVI  339
             S F  Y RR+    QMD E   WQM +L  SP+ VY++  Y+KQTKN WARDDPAF ++
Sbjct  44   GSTFGTYFRRMTSLPQMDFELALWQMAYLVISPRRVYRNVYYNKQTKNHWARDDPAFHIL  103

Query  340  CSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPN  519
             +L +  + + Y  AY  S   T+ ++   LL  FL TG +++T  WF TN ++ ++   
Sbjct  104  IALCMCVAAIVYGIAYSESVLGTLHLIAYTLLIEFLGTGLMIATTAWFFTNQFMLQQ--Q  161

Query  520  SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             H VEQ VEW+Y+FDVHCN+F P F++ YVV +F
Sbjct  162  VHAVEQSVEWMYSFDVHCNAFVPFFLITYVVQFF  195



>gb|EPB86813.1| hypothetical protein HMPREF1544_06429 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=231

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = +1

Query  172  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            P  L R+V++ QMD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+V+ + L
Sbjct  2    PLILTRLVRFTQMDFEFALWQMAYLLIAPRRVYRNIYYHKQTKNQWARDDPAFLVLLASL  61

Query  352  LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
            L+ S +A+   +       V  ++ ++L  F++ G++++TC WF TN +L +    +   
Sbjct  62   LSVSAIAWGLVFGLGFLGVVKAMLLMVLVDFVLVGSIVATCLWFFTNRFLNQSNAITQTN  121

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            +Q+VEW YAFDVHCNSFFP+F++LY+V +F
Sbjct  122  DQKVEWAYAFDVHCNSFFPLFLILYIVQFF  151



>gb|ETL47305.1| hypothetical protein L916_02928 [Phytophthora parasitica]
 gb|ETP23865.1| hypothetical protein F441_03060 [Phytophthora parasitica CJ01A1]
Length=291

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 113/187 (60%), Gaps = 13/187 (7%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA--------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  264
            ML +  L  R    A        R  S FP+Y  R++ ++QMD++ TF+QM+ LC  P  
Sbjct  23   MLSSDPLGSRQKKKAKRAGTDVFRSCSAFPEYFARVLDYRQMDLDATFYQMVTLCVQPAK  82

Query  265  VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFH  441
            VY+   Y KQTKN+WARDDPAF VI    L  +T+A+  A+   SA     ++   ++  
Sbjct  83   VYKSAYYRKQTKNRWARDDPAFAVIQFAFLLVATVAWAIAFRVDSAAKYASLLFHAVVIE  142

Query  442  FLITGAVLSTCCWFLTNNYLREET----PNSHVVEQRVEWLYAFDVHCNSFFPMFILLYV  609
            +L  G V+ST CW++ N++LR+       ++  VEQRVEW +AFD+HCNSFF +F+ LYV
Sbjct  143  WLGCGLVISTLCWWIANHHLRQRNNLGVGDALYVEQRVEWQFAFDIHCNSFFILFLFLYV  202

Query  610  VHYFLSP  630
            + + L+P
Sbjct  203  LQFLLAP  209



>ref|XP_008916126.1| hypothetical protein PPTG_19429 [Phytophthora parasitica INRA-310]
 gb|ETI48585.1| hypothetical protein F443_07402 [Phytophthora parasitica P1569]
 gb|ETK93917.1| hypothetical protein L915_02952 [Phytophthora parasitica]
 gb|ETM00411.1| hypothetical protein L917_02854 [Phytophthora parasitica]
 gb|ETM53612.1| hypothetical protein L914_02917 [Phytophthora parasitica]
 gb|ETM98584.1| hypothetical protein PPTG_19429 [Phytophthora parasitica INRA-310]
 gb|ETO82760.1| hypothetical protein F444_03127 [Phytophthora parasitica P1976]
 gb|ETP51864.1| hypothetical protein F442_03047 [Phytophthora parasitica P10297]
Length=291

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 113/187 (60%), Gaps = 13/187 (7%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA--------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  264
            ML +  L  R    A        R  S FP+Y  R++ ++QMD++ TF+QM+ LC  P  
Sbjct  23   MLSSDPLGSRQKKKAKRAGTDVFRSCSAFPEYFARVLDYRQMDLDATFYQMVTLCVQPAK  82

Query  265  VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFH  441
            VY+   Y KQTKN+WARDDPAF VI    L  +T+A+  A+   SA     ++   ++  
Sbjct  83   VYKSAYYRKQTKNRWARDDPAFAVIQFAFLLVATVAWAIAFRVDSAAKYASLLFHAVVIE  142

Query  442  FLITGAVLSTCCWFLTNNYLREET----PNSHVVEQRVEWLYAFDVHCNSFFPMFILLYV  609
            +L  G V+ST CW++ N++LR+       ++  VEQRVEW +AFD+HCNSFF +F+ LYV
Sbjct  143  WLGCGLVISTLCWWIANHHLRQRNNLGVGDALYVEQRVEWQFAFDIHCNSFFILFLFLYV  202

Query  610  VHYFLSP  630
            + + L+P
Sbjct  203  LQFLLAP  209



>emb|CDH60549.1| unc-50-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=259

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 112/183 (61%), Gaps = 9/183 (5%)
 Frame = +1

Query  106  NMLPTSSLKGR--------TSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  261
            ++LPT++   R        +  + R  S  P  ++R++ W QMD +   WQM +L  +PK
Sbjct  3    SLLPTTNTFTRNNPSWNPHSQKYGRSFSSRPLIVQRLLHWTQMDFDVALWQMAYLLIAPK  62

Query  262  VVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFH  441
             VY++  YHKQTKNQWARDDPAF V+ + LLA S  A+   +       ++    ++L  
Sbjct  63   RVYRNVYYHKQTKNQWARDDPAFFVLLTGLLAISGTAWAVVFGKGWWGILYTSAFMVLID  122

Query  442  FLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            FL+ G++++T  W++TN +L+     S+ V+Q VEW YAFDVHCN++ P F++LY++ +F
Sbjct  123  FLLVGSLVATFTWWITNRFLKFNR-MSYAVDQNVEWAYAFDVHCNAYIPFFLILYILQFF  181

Query  622  LSP  630
              P
Sbjct  182  FLP  184



>ref|XP_007383729.1| UNC-50-like protein [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN09032.1| UNC-50-like protein [Punctularia strigosozonata HHB-11173 SS5]
Length=262

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 106/185 (57%), Gaps = 10/185 (5%)
 Frame = +1

Query  106  NMLPTSSLKGRTSSHARP----------NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  255
            ++LP +S  G  + HA P           S  P   +R+ + Q MD E   WQ+ +LC +
Sbjct  2    SILPVNSHPGSVNGHASPLQSHAPAWTAKSRVPLIFKRLTRIQSMDFELAAWQLTYLCIA  61

Query  256  PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  435
            PK VY++  +HKQTKN WARDDPA +V+ S  LA + +A+   +    G  + +   ++L
Sbjct  62   PKRVYKNVYFHKQTKNTWARDDPAIMVLISACLAVAGIAWGIVWYSGIGAGIELASVMIL  121

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
              +L+ GA+++T  W ++N  L     +S   + RVEW YAFDVH N+FFPMF+ LYV  
Sbjct  122  RDYLLVGAIMATILWAISNRLLLSPPSHSTPADSRVEWAYAFDVHTNAFFPMFLTLYVAQ  181

Query  616  YFLSP  630
             FL P
Sbjct  182  LFLVP  186



>ref|XP_002899351.1| transmembrane protein, putative [Phytophthora infestans T30-4]
 gb|EEY62320.1| transmembrane protein, putative [Phytophthora infestans T30-4]
Length=291

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 107/166 (64%), Gaps = 9/166 (5%)
 Frame = +1

Query  154  RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFI  333
            R  S FP+Y  R++ ++QMD++ TF+QM+ LC  P  VY+   Y KQTKN+WARDDPAF 
Sbjct  46   RSCSAFPEYFARVLDYRQMDLDATFYQMVTLCVQPAKVYKSAYYRKQTKNRWARDDPAFA  105

Query  334  VICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREE  510
            VI    L  +TLA+  A+   SA     ++   ++  +L  G V+ST CW+  N++LR+ 
Sbjct  106  VIQFAFLLVATLAWAIAFRVDSAAKYASLLFHAVVVEWLGFGLVISTLCWWTANHHLRQR  165

Query  511  TPNSH------VVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
              NSH       VEQRVEW +AFD+HCNSFF +F+ LYV+ + L+P
Sbjct  166  --NSHGVGDALYVEQRVEWQFAFDIHCNSFFILFLFLYVLQFLLTP  209



>gb|KDO25449.1| hypothetical protein SPRG_09392 [Saprolegnia parasitica CBS 223.65]
Length=380

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 114/183 (62%), Gaps = 8/183 (4%)
 Frame = +1

Query  103  GNMLPTSSLKGRTSS---HARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  273
            G   PT   +G + +       +S  P+Y  R+V ++QMD+E T++QM+ LC +P  VY+
Sbjct  117  GAAFPTRPARGASGTLPLFRNCSSAVPEYFARMVDYRQMDLEATYYQMVTLCIAPSKVYK  176

Query  274  HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLIT  453
               Y KQTKN+WARDDPAF VI  L L  ++LA+  A++ ++    F++I  ++  +L+ 
Sbjct  177  SAYYRKQTKNRWARDDPAFAVIQVLFLFVASLAWTVAFEKTSSLG-FLLICDVIVEWLVL  235

Query  454  GAVLSTCCWFLTNNYLREETP----NSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            G +LST  W+  N +LR   P    ++  VEQ VEW YAFD+HCN FF +F+L++VV + 
Sbjct  236  GVLLSTASWWCANTFLRLSPPGIASDTFFVEQSVEWQYAFDIHCNGFFVLFLLIHVVQFL  295

Query  622  LSP  630
            L P
Sbjct  296  LVP  298



>ref|XP_004354055.1| hypothetical protein ACA1_165790 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR24358.1| hypothetical protein ACA1_165790 [Acanthamoeba castellanii str. 
Neff]
Length=232

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 107/175 (61%), Gaps = 19/175 (11%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            MLP+ +    T+      S  P+YLRRI+ + QMDIEYTF      C      Y+ T + 
Sbjct  1    MLPSYT----TNRFNGSRSYIPEYLRRIIHYPQMDIEYTF------C------YRTTSWR  44

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVF-VVISVLLFHFLITGAVL  465
            KQTKNQWARDDPAFI I  L +A + +AY  A++     T+  ++       FL  G   
Sbjct  45   KQTKNQWARDDPAFIAILVLFMAVAAIAYSVAFNAWNPVTLLRIMFWAAFIEFLGLGLAT  104

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +T  WF+ N YLR ++   H V+Q+VEWLYAFDVHCNSFFP+F++LYV+ +FL P
Sbjct  105  ATLGWFVANKYLRVQS--LHAVDQKVEWLYAFDVHCNSFFPLFVVLYVLQFFLLP  157



>emb|CDS07641.1| hypothetical protein LRAMOSA01590 [Absidia idahoensis var. thermophila]
Length=216

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = +1

Query  208  MDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAY  387
            MD E+  WQM +L  +P+ VY++  YHKQTKNQWARDDPAF+V+ + LL  S +A+  AY
Sbjct  1    MDFEFALWQMAYLLIAPRRVYRNIYYHKQTKNQWARDDPAFLVLLASLLCVSAVAWGLAY  60

Query  388  DHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDV  567
                   +  ++ ++L  FL+ G++ +T  WF++N  L  +T  +H VEQ+VEW YAFDV
Sbjct  61   GLGMVGILRAMLFMVLVDFLLVGSLAATFTWFVSNRLLIMDTM-AHAVEQKVEWAYAFDV  119

Query  568  HCNSFFPMFILLYVVHYFLSP  630
            HCNSFFP+F++ YV+ +F  P
Sbjct  120  HCNSFFPVFLITYVLQFFFMP  140



>gb|KIM42215.1| hypothetical protein M413DRAFT_444663 [Hebeloma cylindrosporum 
h7]
Length=254

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = +1

Query  97   STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            S  + LP+S   GRTSS  R     P   RR  + QQMD E   WQ+ +LC +P+ VY++
Sbjct  10   SPEDGLPSS---GRTSSSLR----LPVIFRRFHRLQQMDFELAAWQLTYLCLAPRRVYRN  62

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
              +HKQTKN WARDDPA +V+    L  S +A+   Y ++ G  + + + ++L  FL++G
Sbjct  63   VYFHKQTKNTWARDDPAILVLIGACLCVSAVAWGVVYSYTIGEMLEIALMMVLRDFLLSG  122

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
              ++T  WF +N+ L     +S   + +VEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  123  IAVATILWFTSNSLLLAPPSHSTQADSKVEWAYAFDVHTNAFFPLYLTLYLAQLFLLP  180



>gb|KIY48492.1| UNC-50 protein [Fistulina hepatica ATCC 64428]
Length=258

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 106/174 (61%), Gaps = 3/174 (2%)
 Frame = +1

Query  118  TSSLK-GRTSSH--ARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            TSSL+ G TSS   ARP    P   RR+ ++ QMD E   WQ+ +LC +P+ VY++  +H
Sbjct  10   TSSLEDGSTSSSPFARPTPSIPLIFRRLHRFHQMDFELAAWQLTYLCLAPRRVYRNVYFH  69

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTKN WARDDPA +V+ +  L  S +A+   Y +S      + + ++L  + +TG +++
Sbjct  70   KQTKNTWARDDPAILVLITACLCVSAVAWSVVYKYSLAQAARLALLMILRDYFLTGIIIA  129

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +  WF +N  L     ++   + RVEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  130  SILWFSSNRLLLSPPSHATPADSRVEWAYAFDVHTNAFFPLYLTLYIAQLFLVP  183



>gb|KIL62269.1| hypothetical protein M378DRAFT_165972 [Amanita muscaria Koide 
BX008]
Length=252

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 102/172 (59%), Gaps = 1/172 (1%)
 Frame = +1

Query  118  TSSLKGRTSSHARPNS-VFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  294
            TS         +RP S   P   RR+ ++ QMD E   WQ+ +LC SPK VY++  +HKQ
Sbjct  6    TSGYSAEGGLASRPVSHRIPMIFRRLHRFHQMDFELAAWQLTYLCLSPKRVYRNVYFHKQ  65

Query  295  TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTC  474
            TKN WARDDPA +V+ S  L  S +A+   Y +    T+ + + ++L  +L++G ++++ 
Sbjct  66   TKNTWARDDPAILVLISACLTVSAVAWAVVYSYGIPGTIKLTLLMILRDYLLSGIIIASI  125

Query  475  CWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             WF++N  L     ++   + RVEW YAFDVH N+FFP ++ LY+   FL P
Sbjct  126  LWFISNKLLLSPPSHTTPADSRVEWAYAFDVHTNAFFPFYLTLYLAQLFLVP  177



>emb|CDO71142.1| hypothetical protein BN946_scf184845.g12 [Trametes cinnabarina]
Length=247

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 98/172 (57%), Gaps = 0/172 (0%)
 Frame = +1

Query  115  PTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  294
            PT  L G +   A P S  P   RR++++Q MD E   WQ+ +LC SPK VY++  +HKQ
Sbjct  9    PTPQLNGGSYRKASPTSRIPVIFRRLLRFQSMDFELAAWQLTYLCISPKRVYRNVYFHKQ  68

Query  295  TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTC  474
            TKN WARDDPA +++ +  L  + +A+   Y +     + +   ++   F + G V++T 
Sbjct  69   TKNTWARDDPAILILIAACLCVTAIAWSVVYSYGLWGAIQLAFLMIFRDFFLCGVVIATF  128

Query  475  CWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             WF  N  L     +S   + +VEW YAFDVH N+F P+++ LY+   FL P
Sbjct  129  IWFFANRVLLSPPSHSTPEDAKVEWAYAFDVHTNAFVPLYLTLYLAQLFLVP  180



>ref|XP_010727867.1| PREDICTED: protein unc-50 homolog [Larimichthys crocea]
Length=254

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 109/174 (63%), Gaps = 7/174 (4%)
 Frame = +1

Query  109  MLPTSS---LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  279
            MLPT+S   L  R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++ 
Sbjct  1    MLPTTSNGSLGARDAARHTAGAKRYKYLRRLLHFRQMDFEFAIWQMLYLFTSPQRVYRNF  60

Query  280  KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGA  459
             Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G 
Sbjct  61   HYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLDMGVVETLKLLLWVVFVDCIGVGL  120

Query  460  VLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            ++ST  WF++N YL   T  +H     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  LISTLMWFISNKYLLNHTSRNH----DVEWGYAFDVHLNAFYPLLVILHFLQLF  170



>ref|XP_002112386.1| hypothetical protein TRIADDRAFT_24802 [Trichoplax adhaerens]
 gb|EDV24496.1| hypothetical protein TRIADDRAFT_24802 [Trichoplax adhaerens]
Length=241

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = +1

Query  175  QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLL  354
            QY +R++K+++MD E+  WQML+LC SP+ VY++  Y  QTK+QWARDDPAF+V+ ++ L
Sbjct  13   QYFQRLIKFREMDFEFAMWQMLYLCVSPRKVYRNFHYRHQTKHQWARDDPAFLVLLAMAL  72

Query  355  ACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVE  534
              S++ +      +    V  +  V+    +  G  + T  WF+TN YL+E+   SH  E
Sbjct  73   CISSIGFAIVLKLNVLAFVKFLFWVIFIDCIGVGLAIGTLLWFITNKYLKEK--QSHGSE  130

Query  535  QRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            Q VEWLY+FDVH N+FFP+ I+L+VV     P
Sbjct  131  QSVEWLYSFDVHLNAFFPLLIVLHVVQMIFMP  162



>gb|EPT05753.1| hypothetical protein FOMPIDRAFT_1111164 [Fomitopsis pinicola 
FP-58527 SS1]
Length=260

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 99/166 (60%), Gaps = 0/166 (0%)
 Frame = +1

Query  133  GRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWA  312
            G + S    ++  P   RR+ ++QQMD E   WQ+ +LC SPK VY++  +HKQTKN WA
Sbjct  20   GPSRSIGSLSNRMPVMFRRLTRFQQMDFELAAWQLTYLCLSPKRVYRNVYFHKQTKNTWA  79

Query  313  RDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTN  492
            RDDPA I++ S  L  S +A+   Y ++    + + + +++  +L  GA+++T  WF +N
Sbjct  80   RDDPAIIILISGCLVVSAIAWSVVYSYTPFQAIKLALLMIIRDYLFVGALMATIMWFFSN  139

Query  493  NYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
              L     +S   +  VEW YAFDVH N+FFP ++ LY+   FL P
Sbjct  140  RVLLSPPSHSAPSDSAVEWGYAFDVHTNAFFPFYLTLYLAQLFLVP  185



>emb|CCA22710.1| transmembrane protein putative [Albugo laibachii Nc14]
Length=351

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 111/175 (63%), Gaps = 5/175 (3%)
 Frame = +1

Query  121  SSLKGRTSSHA-RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  297
            S+ K ++S  + R  S+ P+Y  RI+ ++QMD++ TF+QM+ L   P  VY+   Y KQT
Sbjct  96   SNRKNKSSPISFRSCSILPEYFFRIIYYRQMDLDATFYQMITLLLQPSKVYKSAYYRKQT  155

Query  298  KNQWARDDPAFIVICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLITGAVLSTC  474
            KN+WARDDPAF VI    L  +T+A+   +   + G  +  +   ++  +L  G +++T 
Sbjct  156  KNRWARDDPAFAVIEMGFLLIATIAWAITFRIDNLGLYLSFLFHAIVVEWLGMGLLIATI  215

Query  475  CWFLTNNYL---REETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            CW++TNN+L   R +  +   VEQ VEW YAFD+HCNSFF +F+LLYVV + L P
Sbjct  216  CWYITNNHLRLRRSQIADMLYVEQHVEWQYAFDIHCNSFFVLFLLLYVVQFLLLP  270



>emb|CDR40017.1| CYFA0S04e01750g1_1 [Cyberlindnera fabianii]
Length=302

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 105/176 (60%), Gaps = 5/176 (3%)
 Frame = +1

Query  118  TSSLKGRTS--SHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHK  291
            +S   GR+S  + +RP+   P  ++R  K   +D E   W++ +L  SPK VY+   YHK
Sbjct  53   SSRFPGRSSRFTASRPHFKIPILIKRFFKPPTLDFETAMWEIFYLIVSPKRVYKSLYYHK  112

Query  292  QTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLST  471
            QTKN+WARDDP+F+++ SL L  S +A+  AY       + +++ ++L  F +TG ++ST
Sbjct  113  QTKNRWARDDPSFVILLSLFLTLSAVAWGIAYSPGVTSILKLILYMVLVDFFLTGVIIST  172

Query  472  CCWFLTNNYLREETPN---SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             CW L N + + +  +     V E  +EW Y FDVHCNSF  +++ LY+V + L P
Sbjct  173  ICWVLVNKFFKSKAAHDSIGAVSENDLEWAYCFDVHCNSFLVIWVALYMVQFILLP  228



>gb|KFH64319.1| hypothetical protein MVEG_10144 [Mortierella verticillata NRRL 
6337]
Length=305

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 100/148 (68%), Gaps = 2/148 (1%)
 Frame = +1

Query  172  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            P +LRR+ ++  MD ++  WQM++LC SP++VY++  YHKQTKNQWARDDPAF+VI S +
Sbjct  80   PLFLRRLFRFPHMDFQFALWQMVYLCISPRIVYRNIHYHKQTKNQWARDDPAFMVILSGV  139

Query  352  LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
            L CS +A+   Y H     + +++ ++   F++ G V++T CW + N +L   +  S   
Sbjct  140  LCCSAIAWGLVYGHGMMGILRMMLYMVFVDFVVIGVVVATICWTIANRFLARASVYS--T  197

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVH  615
            EQ VEW YAFD+HCN+F P+  LLY++ 
Sbjct  198  EQSVEWQYAFDIHCNAFMPVIALLYIIQ  225



>ref|XP_002611641.1| hypothetical protein BRAFLDRAFT_63694 [Branchiostoma floridae]
 gb|EEN67651.1| hypothetical protein BRAFLDRAFT_63694 [Branchiostoma floridae]
Length=243

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 105/165 (64%), Gaps = 9/165 (5%)
 Frame = +1

Query  127  LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQ  306
            L+ R ++ A+      +YLRRI+K++QMD E+  WQML+LC +P+ VY++  Y KQTK+Q
Sbjct  2    LEARHTAGAKRY----KYLRRILKFRQMDFEFALWQMLYLCVAPQRVYRNFHYRKQTKDQ  57

Query  307  WARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFL  486
            WARDDPAF+V+ S  L  S+L +      S    + +++ V+    +  G +++T  WF+
Sbjct  58   WARDDPAFLVLLSFWLCASSLGFAIVLQLSIMGMIKLLLWVIFVDCIGVGLMVATLLWFV  117

Query  487  TNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             N YL+ +       +Q VEW YAFDVH N+FFP+ I+L+V+  F
Sbjct  118  ANKYLQTQKS-----DQEVEWGYAFDVHLNAFFPLLIILHVIQLF  157



>ref|XP_007313694.1| hypothetical protein SERLADRAFT_457222 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN92501.1| hypothetical protein SERLA73DRAFT_190984 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO29452.1| hypothetical protein SERLADRAFT_457222 [Serpula lacrymans var. 
lacrymans S7.9]
Length=255

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 103/172 (60%), Gaps = 3/172 (2%)
 Frame = +1

Query  115  PTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQ  294
            P+ +L G + S    +S  P   RR+ ++QQMD E  FWQ+ +LC +PK VY++  YHKQ
Sbjct  12   PSHNLPGTSMSV---SSRVPVIFRRLHRFQQMDFELAFWQLSYLCLAPKRVYRNVYYHKQ  68

Query  295  TKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTC  474
            TKN WARDDPA +++    L  S +A+   Y  S    + + + +++  +L  GA+++T 
Sbjct  69   TKNTWARDDPAILILLFACLFVSAVAWSVVYRSSPPEAIKLALVMIIRDYLFVGAIVATI  128

Query  475  CWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             W  +N  L   + ++   +  VEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  129  IWLFSNRVLLSPSSHTATADSGVEWAYAFDVHTNAFFPLYLTLYLAQLFLLP  180



>ref|XP_007501158.1| PREDICTED: protein unc-50 homolog isoform X2 [Monodelphis domestica]
Length=259

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSMNSRIQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_007370707.1| UNC-50-like protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF56563.1| UNC-50-like protein [Dichomitus squalens LYAD-421 SS1]
Length=255

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 104/179 (58%), Gaps = 4/179 (2%)
 Frame = +1

Query  106  NMLP-TSSLKGRTSSHARPNSVF---PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  273
            ++LP TS   G    +  P+      P   RR+ ++QQMD E   WQ+ +LC +PK VY+
Sbjct  2    DVLPVTSPNPGNGGQYRNPSPALVRVPVIFRRLHRFQQMDFEQAAWQLTYLCLAPKRVYR  61

Query  274  HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLIT  453
            +  +HKQTKN WARDDPA +++ +  L  S +A+   Y +     + + I +++  +L+ 
Sbjct  62   NVYFHKQTKNTWARDDPAILILIAACLCVSAVAWSVVYSYGIWGAIGLAILMVVRDYLLV  121

Query  454  GAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            G V++T  WF  N  L     +S + + RVEW YAFDVH N+FFP ++ LY+   FL P
Sbjct  122  GFVIATILWFFANRVLLSPPSHSTLEDARVEWAYAFDVHTNAFFPFYLTLYLAQLFLVP  180



>ref|XP_008045490.1| UNC-50-like protein [Trametes versicolor FP-101664 SS1]
 gb|EIW51616.1| UNC-50-like protein [Trametes versicolor FP-101664 SS1]
Length=255

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 101/179 (56%), Gaps = 4/179 (2%)
 Frame = +1

Query  106  NMLPT-SSLKGRTSSHARPNSV---FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  273
            ++LPT S          R +SV    P   RR+ + QQMD E   WQ+ +LC SPK VY+
Sbjct  2    DLLPTISPTPQHNGGQFRGSSVSNRVPVIFRRLTRVQQMDFELAAWQLTYLCISPKRVYR  61

Query  274  HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLIT  453
            +  +HKQTKN WARDDPA +++ +  L  S +A+   Y +S    + +   ++   FL+ 
Sbjct  62   NVYFHKQTKNTWARDDPAILILIAACLVVSAIAWSVVYSYSLWGAIELAFLMIFRDFLLG  121

Query  454  GAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            G  +ST  WF  N  L     +S   + +VEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  122  GIAVSTIIWFFANRVLLSPPSHSTPEDAKVEWAYAFDVHTNAFFPLYLTLYLAQLFLVP  180



>gb|KIJ99107.1| hypothetical protein K443DRAFT_680257 [Laccaria amethystina LaAM-08-1]
Length=258

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 103/178 (58%), Gaps = 4/178 (2%)
 Frame = +1

Query  109  MLPTSSL----KGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            +LPTS+      G  S+    +   P   +R  ++QQMD E   WQ+ +LC +P+ VY++
Sbjct  2    VLPTSTSFSPEDGNMSTRTNTSFRVPVIFKRFHRFQQMDFELAAWQLTYLCLAPRRVYRN  61

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
              +HKQTKN W+RDDPA +V+    L  S +A+   Y  +    V +  +++L  FL++G
Sbjct  62   VYFHKQTKNTWSRDDPAILVLIGACLCVSAIAWGIIYSRNIWSIVNLAATMILRDFLLSG  121

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             V+ST  WF+ N  L     +S   +  VEW YAFDVH N+FFP+F+ LY+   FL P
Sbjct  122  IVISTIIWFIANRLLLSPPSHSTPADSSVEWAYAFDVHTNAFFPLFLTLYLAQLFLLP  179



>ref|XP_011401270.1| Unc-50-like protein [Auxenochlorella protothecoides]
 gb|KFM28256.1| Unc-50-like protein [Auxenochlorella protothecoides]
Length=211

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = +1

Query  235  MLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVF  414
            ML L  SPK  Y+HT YH+QTK+ WARDDPAF+V+ + ++A  T AYC A+    G ++ 
Sbjct  1    MLQLLISPKTAYRHTSYHRQTKDHWARDDPAFVVLLAGIIALITAAYCIAFGPGLGGSLL  60

Query  415  VVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMF  594
            ++++ ++  FLI GA++S   W L   +L   +   H +EQR+E +YAFDVHCNS  P  
Sbjct  61   IILAAVIRDFLIVGALISLGGWLLATRFLYSPSGQEHAIEQRMELMYAFDVHCNSLLPWL  120

Query  595  ILLYVVHYFLSP  630
            +++ V+   LSP
Sbjct  121  LIVNVLQLVLSP  132



>gb|KII91286.1| hypothetical protein PLICRDRAFT_38019 [Plicaturopsis crispa FD-325 
SS-3]
Length=257

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = +1

Query  106  NMLPTS--SLKGRTSSHAR-PNSV---FPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  267
            ++LPTS  +  G  +   R P +V    P   RR+ ++ QMD E   W + +LC SP+ V
Sbjct  2    SVLPTSQSNFAGNDALSPRTPTTVTNRIPLIFRRLHRFDQMDFELAAWTLTYLCVSPRRV  61

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            Y++  +HKQTKN WARDDPA +++    L  S +A+   Y +S    + + + ++L  +L
Sbjct  62   YRNVYFHKQTKNTWARDDPAVLILIGACLCVSAVAWSVVYSYSIRRAIELALLMILRDYL  121

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLS  627
            +TGAV++T  WF +N  L     +S   +  VEW YAFDVH N+FFP+++ LY+   FL 
Sbjct  122  LTGAVVATIFWFFSNRVLLSPPSHSTPADSAVEWAYAFDVHTNAFFPLYLTLYLAQLFLL  181

Query  628  P  630
            P
Sbjct  182  P  182



>ref|XP_001636568.1| predicted protein [Nematostella vectensis]
 gb|EDO44505.1| predicted protein [Nematostella vectensis]
Length=257

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 100/150 (67%), Gaps = 4/150 (3%)
 Frame = +1

Query  175  QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLL  354
            +YL+RI+K++ MD E+  WQML+LC SP+ VY++  YHKQTK+QWARDDPAF+V+ S  L
Sbjct  28   KYLKRILKFRHMDFEFALWQMLYLCVSPQKVYRNFHYHKQTKDQWARDDPAFLVLLSFWL  87

Query  355  ACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
              S++ +      H  G   F ++ V+    +  G  ++T  W +TN YLR   P+++  
Sbjct  88   CVSSIGFAIVLKLHFLGFIKF-LLWVVFIDCIGCGLCIATVLWIVTNRYLR--IPSTYNR  144

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            EQ VEW YAFDVH N+FFP+ I+L+VV  F
Sbjct  145  EQGVEWGYAFDVHLNAFFPLLIILHVVQLF  174



>ref|XP_001838985.2| hypothetical protein CC1G_05538 [Coprinopsis cinerea okayama7#130]
 gb|EAU82916.2| hypothetical protein CC1G_05538 [Coprinopsis cinerea okayama7#130]
Length=249

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 105/176 (60%), Gaps = 4/176 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVF--PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTK  282
            +LPTSS         RP++ F  P   +R+ ++QQMD E   WQ+ +LC +PK VY++  
Sbjct  2    VLPTSSYS--LEDGGRPSNSFRVPLIFKRLHRFQQMDFELAAWQLTYLCLAPKRVYRNVY  59

Query  283  YHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAV  462
            +HKQTKNQWARDDPA +V+ +  L  S + +   Y ++    + +   ++L  FL++G +
Sbjct  60   FHKQTKNQWARDDPAILVLVAACLCVSAVIWGLVYSYNPLQMLGLAAVMILRDFLLSGIL  119

Query  463  LSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            ++T  WF  N  L     +S   +  VEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  120  MATILWFTANRLLLSPPSHSTPADSFVEWAYAFDVHTNAFFPLYLTLYLAQLFLLP  175



>ref|XP_003218830.1| PREDICTED: protein unc-50 homolog [Anolis carolinensis]
 ref|XP_003218831.1| PREDICTED: protein unc-50 homolog [Anolis carolinensis]
 ref|XP_008105286.1| PREDICTED: protein unc-50 homolog [Anolis carolinensis]
Length=259

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 109/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+SL  R   +   NS             +YLRR+  ++ MD E+  WQML+L TSP
Sbjct  1    MLPTTSLNSRDHGNESLNSREAARHTAGAKRYKYLRRLFHFRHMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            ++VY++ +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +      + G T+ +++ V+  
Sbjct  61   QMVYRNFQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLGLAFGETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLTKHQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_001884712.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR04540.1| predicted protein, partial [Laccaria bicolor S238N-H82]
Length=222

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = +1

Query  184  RRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACS  363
            RR  ++QQMD E   WQ+ +LC +P+ VY++  +HKQTKN W+RDDPA +V+    L  S
Sbjct  1    RRFHRFQQMDFELAAWQLTYLCLAPRRVYRNVYFHKQTKNTWSRDDPAILVLIGACLCVS  60

Query  364  TLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRV  543
             +A+   Y       + + ++++L  FL++G V+ST  WF  N  L     +S   + RV
Sbjct  61   AIAWGIIYSRDIWSIINLAVTMILRDFLLSGIVISTILWFTANRLLLSPPSHSTPADSRV  120

Query  544  EWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            EW YAFDVH N+FFP+F+ LY+   FL P
Sbjct  121  EWAYAFDVHTNAFFPLFLTLYLAQLFLLP  149



>ref|XP_009664646.1| PREDICTED: protein unc-50 homolog [Struthio camelus australis]
 gb|KFV76637.1| Protein unc-50 [Struthio camelus australis]
Length=259

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R   +   NS             +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRNQGNGALNSRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_008978360.1| PREDICTED: protein unc-50 homolog isoform X2 [Callithrix jacchus]
Length=266

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 110/185 (59%), Gaps = 14/185 (8%)
 Frame = +1

Query  97   STGNMLPTSSLKG----------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHL  246
             +G MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L
Sbjct  4    GSGKMLPSTSLNSSVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYL  63

Query  247  CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  426
             TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  64   FTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLW  123

Query  427  VLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLY  606
            V+    +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  124  VVFIDCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILH  179

Query  607  VVHYF  621
             +  F
Sbjct  180  FIQLF  184



>ref|XP_009552003.1| hypothetical protein HETIRDRAFT_436750 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW75743.1| hypothetical protein HETIRDRAFT_436750 [Heterobasidion irregulare 
TC 32-1]
Length=255

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 102/175 (58%), Gaps = 1/175 (1%)
 Frame = +1

Query  106  NMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            N  P+ +     SSH+  N V P   RR++++Q MD E   WQ+ +LC +PK VY++  +
Sbjct  7    NAGPSQNGSSFQSSHSVTNRV-PVIFRRLLRFQHMDFELAAWQLTYLCLAPKRVYRNVYF  65

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
            HKQTKN WARDDPA +++ +  L  S +A+   + +S    V + + ++   FL+ G V+
Sbjct  66   HKQTKNTWARDDPAILILIAACLIVSAIAWSVVWSYSPLEAVRLALLMIFRDFLLVGIVV  125

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +T  WF  N  L     +S   +  VEW Y FDVH N+FFP+++ LY+   FL P
Sbjct  126  ATFFWFFANRTLLSPPSHSTPADSAVEWGYTFDVHTNAFFPLYLTLYLAQLFLVP  180



>ref|NP_956541.1| protein unc-50 homolog [Danio rerio]
 sp|Q7ZUU1.1|UNC50_DANRE RecName: Full=Protein unc-50 homolog [Danio rerio]
 gb|AAH47831.1| Unc-50 homolog (C. elegans) [Danio rerio]
 gb|AAI64589.1| Unc50 protein [Danio rerio]
Length=259

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 110/179 (61%), Gaps = 12/179 (7%)
 Frame = +1

Query  109  MLPTSS--------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKV  264
            MLPTSS        L  R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ 
Sbjct  1    MLPTSSPQIHRNGSLSERDAARHTAGAKRYKYLRRLLHFRQMDFEFAVWQMLYLFTSPQK  60

Query  265  VYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHF  444
            VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    
Sbjct  61   VYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGLVLDMGFVETLTLLLWVVFIDC  120

Query  445  LITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            +  G ++ST  WF+TN YL +  PN    +  VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  IGVGLLISTLMWFVTNKYLMKH-PNR---DYDVEWGYAFDVHLNAFYPLLVILHFLQLF  175



>ref|XP_008844068.1| PREDICTED: protein unc-50 homolog [Nannospalax galili]
 ref|XP_008844069.1| PREDICTED: protein unc-50 homolog [Nannospalax galili]
Length=259

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 106/174 (61%), Gaps = 4/174 (2%)
 Frame = +1

Query  100  TGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  279
            + +ML    L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++ 
Sbjct  8    SSSMLGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNF  67

Query  280  KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGA  459
             Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G 
Sbjct  68   HYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGL  127

Query  460  VLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  128  LISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_007197375.1| PREDICTED: protein unc-50 homolog [Balaenoptera acutorostrata 
scammoni]
Length=259

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     H     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDH----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>gb|KDQ59999.1| hypothetical protein JAAARDRAFT_592665 [Jaapia argillacea MUCL 
33604]
Length=257

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 106/180 (59%), Gaps = 6/180 (3%)
 Frame = +1

Query  109  MLPTSSL-----KGRTSSHARPN-SVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  270
            +LPTS+       G TS  +  + S  P   RR+ ++ QMD E   WQ+ +LC +PK VY
Sbjct  3    LLPTSATAATFPNGSTSPRSNASTSRIPLIFRRLHRFHQMDFELAAWQLTYLCLAPKRVY  62

Query  271  QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLI  450
            ++  +HKQTKN W+RDDPA +++ +  L  S +A+   Y +S   T+ +   ++   +L+
Sbjct  63   RNVYFHKQTKNTWSRDDPAILILLAACLCVSAVAWSVVYSYSLFSTIQLAFLMIFRDYLL  122

Query  451  TGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             GA++ST  WF++N  L      +   +  VEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  123  VGAIVSTIFWFVSNRLLLSPPSPTSPADTSVEWAYAFDVHTNAFFPLYLTLYLAQLFLVP  182



>ref|XP_003765692.1| PREDICTED: protein unc-50 homolog [Sarcophilus harrisii]
Length=358

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 109/185 (59%), Gaps = 14/185 (8%)
 Frame = +1

Query  97   STGNMLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHL  246
             +  MLPT+S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L
Sbjct  96   GSRKMLPTTSMNSRLQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYL  155

Query  247  CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  426
             TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  156  FTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLW  215

Query  427  VLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLY  606
            V+    +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  216  VVFIDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILH  271

Query  607  VVHYF  621
             +  F
Sbjct  272  FIQLF  276



>ref|XP_001363404.2| PREDICTED: protein unc-50 homolog isoform X1 [Monodelphis domestica]
Length=358

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 109/185 (59%), Gaps = 14/185 (8%)
 Frame = +1

Query  97   STGNMLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHL  246
             +  MLPT+S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L
Sbjct  96   GSRKMLPTTSMNSRIQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYL  155

Query  247  CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  426
             TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  156  FTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLW  215

Query  427  VLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLY  606
            V+    +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  216  VVFIDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILH  271

Query  607  VVHYF  621
             +  F
Sbjct  272  FIQLF  276



>gb|EMD34649.1| hypothetical protein CERSUDRAFT_116823 [Ceriporiopsis subvermispora 
B]
Length=260

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 95/151 (63%), Gaps = 0/151 (0%)
 Frame = +1

Query  172  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            P   RR+ ++QQMD E   WQ+ +LC SPK VY++  +HKQTKN WARDDPA +V+ +  
Sbjct  33   PAIFRRLHRFQQMDFELAAWQLTYLCLSPKRVYRNVYFHKQTKNTWARDDPAILVLLAAC  92

Query  352  LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
            L+ + +A+   Y ++    + + + +++  +L+ G +++T  W  +N  L     +S   
Sbjct  93   LSVAAIAWSVVYSYTPLQAIQLALLMIIRDYLLVGVIVATILWAFSNGVLLSPPSHSTPA  152

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYFL  624
            + +VEW YAFDVH N+FFP F++LY+   FL
Sbjct  153  DSKVEWAYAFDVHTNAFFPFFLMLYIAQLFL  183



>ref|XP_007244197.1| PREDICTED: protein unc-50 homolog [Astyanax mexicanus]
Length=301

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 110/183 (60%), Gaps = 14/183 (8%)
 Frame = +1

Query  97   STGNMLPTS----------SLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHL  246
             +GNMLPT+          SL  R ++    ++   +YLRR++ ++QMD E+  WQML+L
Sbjct  37   DSGNMLPTTTYSPQNQGNGSLNSRDAARHTASAKRYKYLRRLLHFKQMDFEFAMWQMLYL  96

Query  247  CTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVIS  426
             TSP+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ 
Sbjct  97   FTSPQRVYRNFHYRKQTKDQWARDDPAFLVMLSIWLCVSTVGFGLVLDMGFVETLKLLLW  156

Query  427  VLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLY  606
            V+    +  G ++ST  W +TN YL +     +     VEW YAFDVH N+F+P+ ++L+
Sbjct  157  VVFIDCIGVGLLISTLMWIITNKYLMKHRSKDY----DVEWGYAFDVHLNAFYPLLVILH  212

Query  607  VVH  615
             + 
Sbjct  213  FLQ  215



>ref|XP_006870815.1| PREDICTED: protein unc-50 homolog [Chrysochloris asiatica]
Length=259

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP+ S+  R   +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSISVNSRVQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAGWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +        +  VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSR----DSDVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_005948786.1| PREDICTED: protein unc-50 homolog isoform X2 [Haplochromis burtoni]
Length=229

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = +1

Query  109  MLPTSSLKG----RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            MLPT++  G    R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  1    MLPTTNSNGALASRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  60

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
             +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    +     T+ +++ V+    +  G
Sbjct  61   FQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLEMGVVETLKLLLWVVFVDCIGVG  120

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH-YFLSP  630
             ++ST  W +TN YL ++   +      VEW YAFDVH N+F+P+ ++L+ +  +F++P
Sbjct  121  LLISTIMWVVTNRYLLKQPSRNF----DVEWGYAFDVHLNAFYPLLVILHFLQLFFINP  175



>gb|EWM29534.1| unc-50 family protein [Nannochloropsis gaditana]
Length=272

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = +1

Query  175  QYLRRIVKWQQMDIEYTFWQMLHLCTS-PKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            +YLRRIV   QMD +  F  +L LC+S P+ +Y+   Y K TKN WARDDPA  VI    
Sbjct  38   EYLRRIVDPNQMDFDAAFEDILMLCSSHPQRMYKMASYRKHTKNHWARDDPALAVIQIAF  97

Query  352  LACSTLAYCAAYDHSAG--HTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSH  525
            L  S+ AY  A+    G  H +F+ +  +LF +L+ G V++T C  + N YL E    SH
Sbjct  98   LLVSSSAYALAFHVRGGPVHYLFLALRAILFDWLLVGLVVATVCRSVANRYLLEL--RSH  155

Query  526  VVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             VEQ VEW YAFD+HCN+F P F+L  V+HYF
Sbjct  156  SVEQEVEWRYAFDIHCNAFLPFFLLTSVLHYF  187



>ref|XP_005855343.1| unc-50 family protein [Nannochloropsis gaditana CCMP526]
 gb|EKU21018.1| unc-50 family protein [Nannochloropsis gaditana CCMP526]
Length=272

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = +1

Query  175  QYLRRIVKWQQMDIEYTFWQMLHLCTS-PKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            +YLRRIV   QMD +  F  +L LC+S P+ +Y+   Y K TKN WARDDPA  VI    
Sbjct  38   EYLRRIVDPNQMDFDAAFEDILMLCSSHPQRMYKMASYRKHTKNHWARDDPALAVIQIAF  97

Query  352  LACSTLAYCAAYDHSAG--HTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSH  525
            L  S+ AY  A+    G  H +F+ +  +LF +L+ G V++T C  + N YL E    SH
Sbjct  98   LLVSSSAYALAFHVRGGPVHYLFLALRAILFDWLLVGLVVATVCRSVANRYLLEL--RSH  155

Query  526  VVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             VEQ VEW YAFD+HCN+F P F+L  V+HYF
Sbjct  156  SVEQEVEWRYAFDIHCNAFLPFFLLTSVLHYF  187



>ref|XP_009982050.1| PREDICTED: protein unc-50 homolog [Tauraco erythrolophus]
 gb|KFV15696.1| Protein unc-50 [Tauraco erythrolophus]
Length=259

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+SL  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSLNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|NP_001290995.1| unc-50 homolog [Esox lucius]
 ref|XP_010884592.1| PREDICTED: protein unc-50 homolog [Esox lucius]
 ref|XP_010884593.1| PREDICTED: protein unc-50 homolog [Esox lucius]
 gb|ACO13743.1| unc-50 homolog [Esox lucius]
Length=256

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 108/176 (61%), Gaps = 9/176 (5%)
 Frame = +1

Query  109  MLPTS-----SLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  273
            MLPT+     SL  R ++     +   +YLRR++ ++ MD E+  WQML+L TSP+ VY+
Sbjct  1    MLPTTASQNGSLSARDAARHTAGAKRYKYLRRLLHFKAMDFEFAMWQMLYLFTSPQRVYR  60

Query  274  HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLIT  453
            +  Y KQTK+QWARDDPAF+V+ S+ L  STL +    D     T+ +++ V+    +  
Sbjct  61   NFHYRKQTKDQWARDDPAFLVLLSVWLCVSTLGFGLVLDMGFVETLKLLLWVVFIDCIGV  120

Query  454  GAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            G ++ST  WF+TN YL ++       +  VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  GLLISTLMWFVTNKYLLKQPSK----DFDVEWGYAFDVHLNAFYPLLVILHFLQLF  172



>ref|XP_007109671.1| PREDICTED: protein unc-50 homolog isoform X3 [Physeter catodon]
Length=237

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTVGFGFVLDMGFLETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|NP_620274.1| protein unc-50 homolog [Rattus norvegicus]
 ref|XP_006244798.1| PREDICTED: protein unc-50 homolog isoform X1 [Rattus norvegicus]
 ref|XP_006244799.1| PREDICTED: protein unc-50 homolog isoform X1 [Rattus norvegicus]
 sp|O55227.1|UNC50_RAT RecName: Full=Protein unc-50 homolog; AltName: Full=Uncoordinated-like 
protein [Rattus norvegicus]
 gb|AAB93932.1| unc-50 related protein [Rattus norvegicus]
 gb|AAK08985.1| UNC50 [Rattus norvegicus]
 gb|AAH61976.1| Unc-50 homolog (C. elegans) [Rattus norvegicus]
 gb|EDL99237.1| unc-50 homolog (C. elegans), isoform CRA_a [Rattus norvegicus]
 gb|EDL99238.1| unc-50 homolog (C. elegans), isoform CRA_a [Rattus norvegicus]
 gb|EDL99239.1| unc-50 homolog (C. elegans), isoform CRA_a [Rattus norvegicus]
Length=259

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 4/172 (2%)
 Frame = +1

Query  106  NMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKY  285
            +M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y
Sbjct  10   SMYGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHY  69

Query  286  HKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVL  465
             KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++
Sbjct  70   RKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLI  129

Query  466  STCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  130  STLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_007069043.1| PREDICTED: protein unc-50 homolog [Chelonia mydas]
 gb|EMP27185.1| Protein unc-50 like protein [Chelonia mydas]
Length=259

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  +   +   NS             +YLRR++ ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVSSQNQGNGALNSRDAARHTAGAKRYKYLRRLLHFRQMDFEFAVWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFQTIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  FL  624
            F 
Sbjct  177  FF  178



>gb|KDQ22505.1| hypothetical protein PLEOSDRAFT_1068813 [Pleurotus ostreatus 
PC15]
Length=250

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 94/153 (61%), Gaps = 0/153 (0%)
 Frame = +1

Query  172  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            P   RR+ ++QQMD E   WQ+ +LC +PK VY++  +HKQTKN WARDDPA +V+ +  
Sbjct  23   PVIFRRLHRFQQMDFELAAWQLTYLCLAPKRVYRNVYFHKQTKNTWARDDPAILVLIAAC  82

Query  352  LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
            L  S +A+   Y       +++ + ++   +L+TG  ++T  WF +N  L     +S   
Sbjct  83   LCVSAVAWSVVYSLGVLEAIWLALLMVGRDYLLTGIAVATILWFTSNRLLLSPPSHSTPA  142

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            + RVEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  143  DSRVEWAYAFDVHTNAFFPLYLTLYLAQLFLLP  175



>ref|XP_009694201.1| PREDICTED: protein unc-50 homolog [Cariama cristata]
 gb|KFP55291.1| Protein unc-50 [Cariama cristata]
Length=259

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 109/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +   +S             +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSSRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_004686209.1| PREDICTED: protein unc-50 homolog [Condylura cristata]
Length=256

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 108/178 (61%), Gaps = 11/178 (6%)
 Frame = +1

Query  109  MLPTSSL-------KGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  267
            MLP++SL         R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ V
Sbjct  1    MLPSTSLGHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRV  60

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            Y++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +
Sbjct  61   YRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCV  120

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
              G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  GVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  174



>emb|CAB45714.1| hypothetical protein [Homo sapiens]
 gb|AAK08987.1| UNC50 [Homo sapiens]
 emb|CAG38495.1| UNC50 [Homo sapiens]
Length=259

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L 
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+++  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHLIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_004369383.1| PREDICTED: protein unc-50 homolog [Trichechus manatus latirostris]
Length=259

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 104/171 (61%), Gaps = 4/171 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y 
Sbjct  11   MQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR  70

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++S
Sbjct  71   KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCIGVGLLIS  130

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  131  TLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_006137461.1| PREDICTED: protein unc-50 homolog isoform X1 [Pelodiscus sinensis]
 ref|XP_006137462.1| PREDICTED: protein unc-50 homolog isoform X2 [Pelodiscus sinensis]
Length=256

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 107/179 (60%), Gaps = 11/179 (6%)
 Frame = +1

Query  109  MLPTSS-------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  267
            MLPT+S       L  R ++     +   +YLRR+  ++QMD E+  WQML+L TSP+ V
Sbjct  1    MLPTTSQNQGNGALNSRDAARHTAGAKRYKYLRRLFHFRQMDFEFAVWQMLYLFTSPQKV  60

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            Y++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D      + +++ V+    +
Sbjct  61   YRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFEMIKLLLWVVFIDCV  120

Query  448  ITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFL  624
              G ++ST  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  F 
Sbjct  121  GVGLLISTLMWFISNKYLVKQQSRDY----EVEWGYAFDVHLNAFYPLLVILHFIQLFF  175



>ref|XP_010350355.1| PREDICTED: protein unc-50 homolog isoform X2 [Saimiri boliviensis 
boliviensis]
Length=216

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKG----------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++SL            R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSLNSSVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>emb|CCI42182.1| unnamed protein product [Albugo candida]
Length=759

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 111/184 (60%), Gaps = 14/184 (8%)
 Frame = +1

Query  121  SSLKGRTSSHARPN----------SVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  270
            S  + R+ + +R N          S+ P+Y  RIV ++QMD++ TF+QM+ L   P  VY
Sbjct  267  SEQRTRSKARSRRNKSSPISFRSCSMLPEYFFRIVYYRQMDLDATFYQMITLLLQPSKVY  326

Query  271  QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYD-HSAGHTVFVVISVLLFHFL  447
            +   Y KQTKN+WARDDPAF VI    L  +T+A+   +   + G  +  +   ++  +L
Sbjct  327  KSAYYRKQTKNRWARDDPAFAVIELGFLLIATIAWAITFQTDNIGSFLSFLFHAIIVEWL  386

Query  448  ITGAVLSTCCWFLTNNYL---REETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              G +++T CW++TNN+L   R +  +   VEQ VEW YAFD+HCNSFF +F+LLYV+ +
Sbjct  387  GMGLLIATTCWYITNNHLRLRRSQIADMLYVEQHVEWQYAFDIHCNSFFVLFLLLYVIQF  446

Query  619  FLSP  630
             L P
Sbjct  447  LLLP  450



>ref|XP_009280084.1| PREDICTED: protein unc-50 homolog isoform X2 [Aptenodytes forsteri]
Length=233

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+VI S+ L  ST+ +    D      + +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVILSIWLCVSTVGFGFVLDMGFFEMIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCIGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_005400780.1| PREDICTED: protein unc-50 homolog isoform X1 [Chinchilla lanigera]
Length=261

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  106  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  255
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  2    KMLPSTSVNSSVHGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  61

Query  256  PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  435
            P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  STL +    D     T+ +++ V+ 
Sbjct  62   PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTLGFGFVLDMGFFETIKLLLWVVF  121

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  122  IDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  177

Query  616  YF  621
             F
Sbjct  178  LF  179



>ref|XP_009321854.1| PREDICTED: protein unc-50 homolog [Pygoscelis adeliae]
 gb|KFW61216.1| Protein unc-50 [Pygoscelis adeliae]
Length=259

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCASTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCIGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_010145856.1| PREDICTED: protein unc-50 homolog [Eurypyga helias]
 gb|KFW01419.1| Protein unc-50 [Eurypyga helias]
Length=259

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 109/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR++ ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_002920011.1| PREDICTED: protein unc-50 homolog [Ailuropoda melanoleuca]
Length=259

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 104/171 (61%), Gaps = 4/171 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y 
Sbjct  11   MQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR  70

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++S
Sbjct  71   KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLIS  130

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  131  TLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|NP_001014921.1| protein unc-50 homolog [Bos taurus]
 ref|XP_005909901.1| PREDICTED: protein unc-50 homolog isoform X1 [Bos mutus]
 ref|XP_010827919.1| PREDICTED: protein unc-50 homolog isoform X1 [Bison bison bison]
 gb|AAX09048.1| unc-50 homolog [Bos taurus]
 tpg|DAA24916.1| TPA: protein unc-50 homolog [Bos taurus]
Length=260

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = +1

Query  97   STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11   AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67   FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH-YFLSP  630
             ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  +F++P
Sbjct  127  LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFFINP  181



>ref|XP_009865405.1| PREDICTED: protein unc-50 homolog [Apaloderma vittatum]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 109/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+ S+              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSLSNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_005400781.1| PREDICTED: protein unc-50 homolog isoform X2 [Chinchilla lanigera]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 107/173 (62%), Gaps = 8/173 (5%)
 Frame = +1

Query  103  GNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTK  282
            GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++  
Sbjct  13   GNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFH  68

Query  283  YHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAV  462
            Y KQTK+QWARDDPAF+V+ S+ L  STL +    D     T+ +++ V+    +  G +
Sbjct  69   YRKQTKDQWARDDPAFLVLLSIWLCVSTLGFGFVLDMGFFETIKLLLWVVFIDCVGVGLL  128

Query  463  LSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            +ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  129  ISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_010163802.1| PREDICTED: protein unc-50 homolog [Caprimulgus carolinensis]
 gb|KFZ46648.1| Protein unc-50 [Caprimulgus carolinensis]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     TV +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETVKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_004315897.1| PREDICTED: protein unc-50 homolog isoform 2 [Tursiops truncatus]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_004277814.1| PREDICTED: protein unc-50 homolog isoform 2 [Orcinus orca]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_005228739.1| PREDICTED: protein unc-50 homolog [Falco peregrinus]
 ref|XP_005444796.1| PREDICTED: protein unc-50 homolog [Falco cherrug]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+SL  R+  +              +   +YLRR++ ++QMD E+  WQML+L  SP
Sbjct  1    MLPTTSLNSRSQGNGVLSPRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFVSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_006712467.1| PREDICTED: protein unc-50 homolog isoform X3 [Homo sapiens]
Length=261

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 109/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L 
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_005575107.1| PREDICTED: protein unc-50 homolog isoform X2 [Macaca fascicularis]
Length=222

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S+      +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_002811726.1| PREDICTED: protein unc-50 homolog [Pongo abelii]
 ref|XP_002811727.1| PREDICTED: protein unc-50 homolog [Pongo abelii]
 ref|XP_003279280.1| PREDICTED: protein unc-50 homolog isoform 1 [Nomascus leucogenys]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S+      +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L 
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_006177666.1| PREDICTED: protein unc-50 homolog [Camelus ferus]
 ref|XP_010957354.1| PREDICTED: protein unc-50 homolog [Camelus bactrianus]
 ref|XP_010990981.1| PREDICTED: protein unc-50 homolog [Camelus dromedarius]
Length=259

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = +1

Query  118  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  297
              +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14   NGALSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  298  KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCC  477
            K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74   KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  478  WFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            WF++N YL +     +     VEW YAFDVH N+F+P+ I+L+ +  F
Sbjct  134  WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLIILHFIQLF  177



>ref|XP_008530515.1| PREDICTED: protein unc-50 homolog isoform X2 [Equus przewalskii]
Length=225

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 112/185 (61%), Gaps = 15/185 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSPAHGNGALSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH-  615
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  616  YFLSP  630
            +F++P
Sbjct  177  FFINP  181



>ref|XP_011272571.1| putative membrane protein [Wickerhamomyces ciferrii]
 emb|CCH45543.1| putative membrane protein [Wickerhamomyces ciferrii]
Length=300

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 104/184 (57%), Gaps = 6/184 (3%)
 Frame = +1

Query  97   STGNMLPTSSLKG-RTS--SHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVV  267
            ST N    S + G RT   S +R N   P +++R  K   +D E   W++ +L  SPK V
Sbjct  43   STSNGTNRSRVFGSRTDRFSPSRSNFKIPIFIKRFFKPPTLDFETAIWEIFYLIVSPKRV  102

Query  268  YQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFL  447
            Y+   YHKQTKN+WARDDP+F+++    L  S +A+  AY  +    + +++ ++   F 
Sbjct  103  YKSLYYHKQTKNRWARDDPSFMILLVGFLTLSAIAWGVAYSPNIISILKLILYMVFIDFF  162

Query  448  ITGAVLSTCCWFLTNNYLREETPN---SHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
            I G  +ST  WFL N + R+   N     V E  +EW Y FDVHCNSF  +++LLY++ +
Sbjct  163  IVGVFISTLGWFLANRFFRKRNTNNTIGAVTEGDLEWAYCFDVHCNSFLVIWVLLYMIQF  222

Query  619  FLSP  630
             L P
Sbjct  223  ILLP  226



>ref|NP_054763.2| protein unc-50 homolog [Homo sapiens]
 ref|XP_001158336.1| PREDICTED: protein unc-50 homolog [Pan troglodytes]
 ref|XP_004031523.1| PREDICTED: protein unc-50 homolog isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004031524.1| PREDICTED: protein unc-50 homolog isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_008977043.1| PREDICTED: protein unc-50 homolog [Pan paniscus]
 ref|XP_008977048.1| PREDICTED: protein unc-50 homolog [Pan paniscus]
 ref|XP_009441222.1| PREDICTED: protein unc-50 homolog [Pan troglodytes]
 sp|Q53HI1.2|UNC50_HUMAN RecName: Full=Protein unc-50 homolog; AltName: Full=Periodontal 
ligament-specific protein 22; Short=PDLs22; AltName: Full=Protein 
GMH1 homolog; Short=hGMH1; AltName: Full=Uncoordinated-like 
protein [Homo sapiens]
 gb|AAD27771.1|AF077038_1 unc-50 related protein homolog [Homo sapiens]
 gb|AAH17019.1| UNC50 protein [Homo sapiens]
 gb|AAH25992.1| Unc-50 homolog (C. elegans) [Homo sapiens]
 gb|AAH91481.1| UNC50 protein [Homo sapiens]
 gb|EAX01900.1| unc-50 homolog (C. elegans), isoform CRA_a [Homo sapiens]
 gb|EAX01901.1| unc-50 homolog (C. elegans), isoform CRA_a [Homo sapiens]
 gb|EAX01902.1| unc-50 homolog (C. elegans), isoform CRA_a [Homo sapiens]
 gb|ADQ31836.1| unc-50 homolog (C. elegans) [synthetic construct]
 gb|AIC51084.1| UNC50, partial [synthetic construct]
Length=259

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 109/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L 
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_004277813.1| PREDICTED: protein unc-50 homolog isoform 1 [Orcinus orca]
Length=273

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  106  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  255
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  14   KMLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  73

Query  256  PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  435
            P+ VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+ 
Sbjct  74   PQRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVF  133

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  134  IDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  189

Query  616  YF  621
             F
Sbjct  190  LF  191



>ref|XP_008496291.1| PREDICTED: protein unc-50 homolog [Calypte anna]
 gb|KFP04190.1| Protein unc-50 [Calypte anna]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNARSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  FL  624
            F 
Sbjct  177  FF  178



>gb|KIK55005.1| hypothetical protein GYMLUDRAFT_176255 [Gymnopus luxurians FD-317 
M1]
Length=233

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 93/153 (61%), Gaps = 0/153 (0%)
 Frame = +1

Query  172  PQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLL  351
            P   RR+ ++ QMD E   WQ+ +LC +P+ VY++  +HKQTKN WARDDPA +V+ +  
Sbjct  6    PLIFRRLHRFNQMDFEQAIWQLGYLCLAPRRVYRNVYFHKQTKNTWARDDPAILVLIAAC  65

Query  352  LACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
            L  S +A+  AY  S      + + +++  +L+TG V++T  WF++N  L     +S   
Sbjct  66   LFVSGIAWSVAYSFSVRRAFELAVVMIVRDYLLTGLVVATVLWFVSNRILVAPPSHSSPA  125

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            +  VEW YAFDVH N+FFP F+ LYV    + P
Sbjct  126  DSAVEWAYAFDVHTNAFFPFFLTLYVAQLLILP  158



>ref|XP_006734278.1| PREDICTED: protein unc-50 homolog isoform X3 [Leptonychotes weddellii]
Length=233

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 103/169 (61%), Gaps = 4/169 (2%)
 Frame = +1

Query  118  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  297
              +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14   NGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  298  KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCC  477
            K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74   KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  478  WFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFL  624
            WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F 
Sbjct  134  WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLFF  178



>ref|XP_004704408.1| PREDICTED: protein unc-50 homolog [Echinops telfairi]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = +1

Query  118  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  297
              SL  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14   NGSLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  298  KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCC  477
            K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74   KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  478  WFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            WF++N YL +        +  VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  134  WFVSNKYLVKRQSR----DSDVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_003794391.1| PREDICTED: protein unc-50 homolog [Otolemur garnettii]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S+      +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSMNSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_004315896.1| PREDICTED: protein unc-50 homolog isoform 1 [Tursiops truncatus]
Length=273

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  106  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  255
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  14   KMLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  73

Query  256  PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  435
            P+ VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+ 
Sbjct  74   PQRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTIGFGFVLDMGFFETIKLLLWVVF  133

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  134  IDCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  189

Query  616  YF  621
             F
Sbjct  190  LF  191



>ref|XP_005502640.1| PREDICTED: protein unc-50 homolog [Columba livia]
 gb|EMC84526.1| Protein unc-50 like protein [Columba livia]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVSSRSQGNGVLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_007957650.1| PREDICTED: protein unc-50 homolog [Orycteropus afer afer]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP+ S+  +   +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSISMNSQIQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_006166648.1| PREDICTED: protein unc-50 homolog [Tupaia chinensis]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S+      +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSMGSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_009635948.1| PREDICTED: protein unc-50 homolog [Egretta garzetta]
 gb|KFP14978.1| Protein unc-50 [Egretta garzetta]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_003124957.1| PREDICTED: protein unc-50 homolog isoform 2 [Sus scrofa]
 ref|XP_003124956.1| PREDICTED: protein unc-50 homolog isoform 1 [Sus scrofa]
Length=259

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S+   +  +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSLSQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_009470844.1| PREDICTED: protein unc-50 homolog [Nipponia nippon]
 ref|XP_009816620.1| PREDICTED: protein unc-50 homolog [Gavia stellata]
 ref|XP_009881397.1| PREDICTED: protein unc-50 homolog [Charadrius vociferus]
 ref|XP_009923831.1| PREDICTED: protein unc-50 homolog [Haliaeetus albicilla]
 ref|XP_009945923.1| PREDICTED: protein unc-50 homolog [Leptosomus discolor]
 ref|XP_010192222.1| PREDICTED: protein unc-50 homolog [Mesitornis unicolor]
 ref|XP_010574053.1| PREDICTED: protein unc-50 homolog isoform X1 [Haliaeetus leucocephalus]
 gb|KFP97038.1| Protein unc-50 [Haliaeetus albicilla]
 gb|KFQ07685.1| Protein unc-50 [Leptosomus discolor]
 gb|KFQ28727.1| Protein unc-50 [Mesitornis unicolor]
 gb|KFR05639.1| Protein unc-50 [Nipponia nippon]
 gb|KFV45406.1| Protein unc-50 [Gavia stellata]
 gb|KGL91756.1| Protein unc-50 [Charadrius vociferus]
Length=259

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_009501868.1| PREDICTED: protein unc-50 homolog [Phalacrocorax carbo]
 gb|KFW74883.1| Protein unc-50 [Phalacrocorax carbo]
Length=259

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGTLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_010135874.1| PREDICTED: protein unc-50 homolog [Buceros rhinoceros silvestris]
 gb|KFO90613.1| Protein unc-50 [Buceros rhinoceros silvestris]
Length=259

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGVLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>gb|KFP47788.1| Protein unc-50 [Cathartes aura]
Length=259

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>gb|EFB24064.1| hypothetical protein PANDA_008691 [Ailuropoda melanoleuca]
Length=275

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 104/171 (61%), Gaps = 4/171 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYH  288
            M    +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y 
Sbjct  27   MQGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR  86

Query  289  KQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLS  468
            KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++S
Sbjct  87   KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLIS  146

Query  469  TCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  147  TLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  193



>ref|XP_009556227.1| PREDICTED: protein unc-50 homolog [Cuculus canorus]
 gb|KFO73999.1| Protein unc-50 [Cuculus canorus]
Length=259

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  FL  624
            F 
Sbjct  177  FF  178



>ref|XP_009996985.1| PREDICTED: protein unc-50 homolog [Chaetura pelagica]
 gb|KFU84174.1| Protein unc-50 [Chaetura pelagica]
Length=259

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 109/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSL--KGRTSSHARPNSVFP--------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S   +G+ +    P             +YLRR++ ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSFGSRGQGNGALGPRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     TV +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTVGFGFVLDMGFFETVKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_007109670.1| PREDICTED: protein unc-50 homolog isoform X2 [Physeter catodon]
Length=259

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSPVQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ SL L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSLWLCVSTVGFGFVLDMGFLETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_006712466.1| PREDICTED: protein unc-50 homolog isoform X2 [Homo sapiens]
Length=278

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 109/182 (60%), Gaps = 14/182 (8%)
 Frame = +1

Query  106  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  255
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  17   KMLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  76

Query  256  PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  435
            P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L
Sbjct  77   PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVL  136

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  137  IDCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  192

Query  616  YF  621
             F
Sbjct  193  LF  194



>ref|XP_004575434.1| PREDICTED: protein unc-50 homolog [Maylandia zebra]
Length=265

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  109  MLPTSSLKG----RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            MLPT++  G    R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  1    MLPTTNSNGALASRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  60

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
             +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    +     T+ +++ V+    +  G
Sbjct  61   FQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLEMGVVETLKLLLWVVFVDCIGVG  120

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             ++ST  W +TN YL ++   +      VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  LLISTIMWVVTNRYLLKQPSRNF----DVEWGYAFDVHLNAFYPLLVILHFLQLF  171



>ref|XP_005750571.1| PREDICTED: protein unc-50 homolog [Pundamilia nyererei]
 ref|XP_005948785.1| PREDICTED: protein unc-50 homolog isoform X1 [Haplochromis burtoni]
Length=265

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  109  MLPTSSLKG----RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            MLPT++  G    R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  1    MLPTTNSNGALASRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  60

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
             +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    +     T+ +++ V+    +  G
Sbjct  61   FQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLEMGVVETLKLLLWVVFVDCIGVG  120

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             ++ST  W +TN YL ++   +      VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  LLISTIMWVVTNRYLLKQPSRNF----DVEWGYAFDVHLNAFYPLLVILHFLQLF  171



>ref|XP_005706262.1| UNC-50 family protein isoform 1 [Galdieria sulphuraria]
 gb|EME29742.1| UNC-50 family protein isoform 1 [Galdieria sulphuraria]
Length=221

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 95/153 (62%), Gaps = 6/153 (4%)
 Frame = +1

Query  175  QYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLL  354
            +Y RR+ +  ++D EY FWQ+LHLC SP  VY++TKYHKQTKNQWARDDPAF++I   L+
Sbjct  5    EYSRRVFRLGELDFEYAFWQVLHLCLSPSRVYRNTKYHKQTKNQWARDDPAFLLILIYLI  64

Query  355  ACSTLAYCAAYD-HSAGHTVFVVISVLLFHFLITGAVLSTCCWFLTNNYLREETPNSHVV  531
                LAY   +         ++V  V L  F+  G +++   WF  N +LR    +   V
Sbjct  65   VLIDLAYLVCFQIRGISLLGYIVKDVTL--FICIGCLVTLVFWFFCNRFLRM---SGMAV  119

Query  532  EQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            E RVEWLYAFDVHCNSF    ++ YV  YFL P
Sbjct  120  ESRVEWLYAFDVHCNSFLLFALINYVARYFLLP  152



>ref|XP_010070908.1| PREDICTED: protein unc-50 homolog [Pterocles gutturalis]
 gb|KFU97602.1| Protein unc-50 [Pterocles gutturalis]
Length=259

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVSSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_006980507.1| PREDICTED: protein unc-50 homolog [Peromyscus maniculatus bairdii]
Length=259

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVGSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCIGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_005977165.1| PREDICTED: protein unc-50 homolog [Pantholops hodgsonii]
Length=259

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 108/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  97   STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11   AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67   FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  127  LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_007263761.1| UNC-50-like protein [Fomitiporia mediterranea MF3/22]
 gb|EJD05615.1| UNC-50-like protein [Fomitiporia mediterranea MF3/22]
Length=256

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 105/180 (58%), Gaps = 6/180 (3%)
 Frame = +1

Query  109  MLPTS--SLKGRTSSHARP----NSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  270
            +LPTS  S    T++ A+P     +  P   RR+ ++QQMD E   WQ+ +LC +PK VY
Sbjct  3    ILPTSAPSTPNNTTTFAQPPKPVTARLPLIFRRLHRFQQMDFELAAWQLTYLCLAPKRVY  62

Query  271  QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLI  450
            ++  +HKQTKN WARDDPA +V+    L  S +A+   + +S    + +   ++   FL 
Sbjct  63   RNVYFHKQTKNTWARDDPAILVLIGACLIVSAIAWSIVWYYSPLEAIRLAFYMIFRDFLF  122

Query  451  TGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
             G V++T  W ++N +L     +++  +  VEW YAFDVH N+FFP ++ LY+   FL P
Sbjct  123  FGVVIATIIWLISNVFLFSPPSHANPEDSAVEWAYAFDVHTNAFFPFYLTLYLAQLFLVP  182



>ref|XP_005263970.1| PREDICTED: protein unc-50 homolog isoform X1 [Homo sapiens]
Length=276

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 109/182 (60%), Gaps = 14/182 (8%)
 Frame = +1

Query  106  NMLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTS  255
             MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TS
Sbjct  17   KMLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  76

Query  256  PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  435
            P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+L
Sbjct  77   PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVL  136

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
               +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  137  IDCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  192

Query  616  YF  621
             F
Sbjct  193  LF  194



>ref|XP_005212372.1| PREDICTED: protein unc-50 homolog isoform X3 [Bos taurus]
 ref|XP_005909902.1| PREDICTED: protein unc-50 homolog isoform X2 [Bos mutus]
 ref|XP_010827920.1| PREDICTED: protein unc-50 homolog isoform X2 [Bison bison bison]
 sp|Q3ZBG6.1|UNC50_BOVIN RecName: Full=Protein unc-50 homolog [Bos taurus]
 gb|AAI03306.1| Unc-50 homolog (C. elegans) [Bos taurus]
Length=259

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 108/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  97   STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  11   AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  66

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  67   FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  126

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  127  LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>gb|ELR46035.1| Protein unc-50-like protein, partial [Bos mutus]
Length=264

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 108/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  97   STGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            + GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++
Sbjct  16   AQGNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRN  71

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
              Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G
Sbjct  72   FHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVG  131

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  132  LLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  182



>ref|XP_008322929.1| PREDICTED: protein unc-50 homolog [Cynoglossus semilaevis]
 ref|XP_008322930.1| PREDICTED: protein unc-50 homolog [Cynoglossus semilaevis]
Length=257

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  109  MLPTS------SLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVY  270
            MLPT+      +L  R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY
Sbjct  1    MLPTTLPHSNGALGSRDAARHTAGAKRYKYLRRLLHFRQMDFEFAVWQMLYLFTSPQRVY  60

Query  271  QHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLI  450
            ++  Y KQTK+QWARDDPAF+V+ S+ L  ST  +    D     T+ +++ V+    + 
Sbjct  61   RNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTTGFGLVLDMGVMETLKLLLWVVFVDCIG  120

Query  451  TGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             G ++ST  WF++N YL ++ P+ ++    VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  VGLLISTLMWFISNKYLLKQ-PSRNL---DVEWGYAFDVHLNAFYPLLVILHFLQLF  173



>ref|XP_006807177.1| PREDICTED: LOW QUALITY PROTEIN: protein unc-50 homolog [Neolamprologus 
brichardi]
Length=265

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  109  MLPTSSLKG----RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            MLPT++  G    R ++     +   +YLRR++ ++QMD E+  WQML+L TSP+ VY++
Sbjct  1    MLPTTNSNGALASRDAARHTAGAKRYKYLRRLLHFRQMDFEFALWQMLYLFTSPQRVYRN  60

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
             +Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    +     T+ +++ V+    +  G
Sbjct  61   FQYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGLVLEMGVVETLKLLLWVVFVDCIGVG  120

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
             ++ST  W +TN YL ++   +      VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  LLISTIMWVVTNRYLLKQPSRNF----DVEWGYAFDVHLNAFYPLLVILHFLQLF  171



>ref|XP_010310695.1| PREDICTED: protein unc-50 homolog [Balearica regulorum gibbericeps]
 gb|KFO07831.1| Protein unc-50 [Balearica regulorum gibbericeps]
Length=259

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFVSNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>gb|ACI66574.1| unc-50 homolog [Salmo salar]
Length=256

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 109/176 (62%), Gaps = 9/176 (5%)
 Frame = +1

Query  109  MLPTSS-----LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  273
            MLPT+S     L  R ++     +   +YLRR++ ++ MD E+  WQML+L TSP+ VY+
Sbjct  1    MLPTTSPQNGSLSARDAARHTAGAKRYKYLRRLLHFKAMDFEFAVWQMLYLFTSPQRVYR  60

Query  274  HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLIT  453
            +  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  
Sbjct  61   NFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGLVLDMGFVETLKLLLWVVFIDCIGV  120

Query  454  GAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            G ++ST  WF+TN YL +  P S   +  VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  GLLISTLMWFITNKYLLK--PPSK--DYDVEWGYAFDVHLNAFYPLLVILHFLQLF  172



>ref|XP_010014017.1| PREDICTED: protein unc-50 homolog [Nestor notabilis]
 gb|KFQ50633.1| Protein unc-50 [Nestor notabilis]
Length=259

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHA----------RPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVSSRSQGNGVLSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVVLHFIQL  176

Query  619  FL  624
            F 
Sbjct  177  FF  178



>ref|XP_009280076.1| PREDICTED: protein unc-50 homolog isoform X1 [Aptenodytes forsteri]
 gb|KFM01211.1| Protein unc-50 [Aptenodytes forsteri]
Length=259

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+VI S+ L  ST+ +    D      + +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVILSIWLCVSTVGFGFVLDMGFFEMIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCIGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>gb|EDL14524.1| unc-50 homolog (C. elegans), isoform CRA_b [Mus musculus]
Length=268

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 107/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  106  NMLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTS  255
             MLP++SL      +   NS             +YLRR+ +++QMD E+  WQML+L TS
Sbjct  9    KMLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTS  68

Query  256  PKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLL  435
            P+ VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+ 
Sbjct  69   PQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVF  128

Query  436  FHFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVH  615
               +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ + 
Sbjct  129  IDCVGVGLLISTLMWFVSNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQ  184

Query  616  YF  621
             F
Sbjct  185  LF  186



>ref|XP_006203938.1| PREDICTED: protein unc-50 homolog [Vicugna pacos]
Length=259

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = +1

Query  118  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  297
              +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  14   NGALSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  73

Query  298  KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCC  477
            K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  74   KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  133

Query  478  WFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  134  WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_005075445.1| PREDICTED: protein unc-50 homolog [Mesocricetus auratus]
Length=259

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 110/181 (61%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPT----SSLKG------RTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP+    SSL+G      R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVSSSLQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|NP_001167379.1| protein unc-50 homolog [Salmo salar]
 gb|ACI69680.1| unc-50 homolog [Salmo salar]
 gb|ACN09959.1| unc-50 homolog [Salmo salar]
 gb|ACN12306.1| unc-50 homolog [Salmo salar]
Length=256

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 107/176 (61%), Gaps = 9/176 (5%)
 Frame = +1

Query  109  MLPTSS-----LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQ  273
            MLPT+S     L  R ++     +   +YLRR++ ++ MD E+  WQML+L TSP+ VY+
Sbjct  1    MLPTTSPQNGSLSARDAARHTAGAKRYKYLRRLLHFKAMDFEFAVWQMLYLFTSPQRVYR  60

Query  274  HTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLIT  453
            +  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  
Sbjct  61   NFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGLVLDMGFVETLKLLLWVVFIDCIGV  120

Query  454  GAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            G ++ST  WF+TN YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  121  GLLISTLMWFITNKYLLKPPSKDY----DVEWGYAFDVHLNAFYPLLVILHFLQLF  172



>ref|XP_006734276.1| PREDICTED: protein unc-50 homolog isoform X1 [Leptonychotes weddellii]
Length=261

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = +1

Query  118  TSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTKYHKQT  297
              +L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++  Y KQT
Sbjct  16   NGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQT  75

Query  298  KNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAVLSTCC  477
            K+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G ++ST  
Sbjct  76   KDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLM  135

Query  478  WFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  136  WFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  179



>gb|KFZ63733.1| Protein unc-50 [Podiceps cristatus]
Length=258

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHAR----------PNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLPT+S+  R+  +              +   +YLRR+  ++QMD E+  WQML+L TSP
Sbjct  1    MLPTTSVNSRSQGNGALSPRDAARHTAGAKRYKYLRRLFHFRQMDFEFALWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDLGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL ++    +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKQQNRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_854439.1| PREDICTED: protein unc-50 homolog isoform X2 [Canis lupus familiaris]
 ref|XP_005626096.1| PREDICTED: protein unc-50 homolog isoform X1 [Canis lupus familiaris]
Length=263

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_005359995.1| PREDICTED: protein unc-50 homolog [Microtus ochrogaster]
Length=259

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 105/174 (60%), Gaps = 4/174 (2%)
 Frame = +1

Query  100  TGNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHT  279
            + +M     L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP+ VY++ 
Sbjct  8    SSSMQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNF  67

Query  280  KYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGA  459
             Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G 
Sbjct  68   HYRKQTKDQWARDDPAFLVLLSVWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGL  127

Query  460  VLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  128  LISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|XP_004006198.1| PREDICTED: protein unc-50 homolog [Ovis aries]
Length=259

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 107/173 (62%), Gaps = 8/173 (5%)
 Frame = +1

Query  103  GNMLPTSSLKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQHTK  282
            GN + +S    R ++ A+      +YLRR+ +++QMD E+  WQML+L TSP+ VY++  
Sbjct  13   GNGVLSSRDAARHTAGAKRY----KYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFH  68

Query  283  YHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITGAV  462
            Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+    +  G +
Sbjct  69   YRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLL  128

Query  463  LSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYF  621
            +ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  F
Sbjct  129  ISTLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQLF  177



>ref|NP_080399.1| protein unc-50 homolog [Mus musculus]
 ref|XP_006496283.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 ref|XP_006496284.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 ref|XP_006496285.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 ref|XP_006496286.1| PREDICTED: protein unc-50 homolog isoform X1 [Mus musculus]
 sp|Q9CQ61.1|UNC50_MOUSE RecName: Full=Protein unc-50 homolog; AltName: Full=Periodontal 
ligament-specific protein 22; Short=PDLs22 [Mus musculus]
 dbj|BAB22683.1| unnamed protein product [Mus musculus]
 dbj|BAB23302.1| unnamed protein product [Mus musculus]
 gb|AAH19484.1| Unc-50 homolog (C. elegans) [Mus musculus]
 gb|AAK08986.1| UNC50 [Mus musculus]
 dbj|BAE22715.1| unnamed protein product [Mus musculus]
 dbj|BAE21338.1| unnamed protein product [Mus musculus]
 gb|EDL14523.1| unc-50 homolog (C. elegans), isoform CRA_a [Mus musculus]
Length=259

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPNSVFP----------QYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++SL      +   NS             +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G ++ST  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLISTLMWFVSNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_010360424.1| PREDICTED: protein unc-50 homolog isoform X2 [Rhinopithecus roxellana]
Length=231

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLPTSS----------LKGRTSSHARPNSVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSP  258
            MLP++S          L  R ++     +   +YLRR+ +++QMD E+  WQML+L TSP
Sbjct  1    MLPSTSVNSSVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP  60

Query  259  KVVYQHTKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLF  438
            + VY++  Y KQTK+QWARDDPAF+V+ S+ L  ST+ +    D     T+ +++ V+  
Sbjct  61   QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGFVLDMGFLETIKLLLWVVFI  120

Query  439  HFLITGAVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHY  618
              +  G +++T  WF++N YL +     +     VEW YAFDVH N+F+P+ ++L+ +  
Sbjct  121  DCVGVGLLIATLMWFISNKYLVKRQSRDY----DVEWGYAFDVHLNAFYPLLVILHFIQL  176

Query  619  F  621
            F
Sbjct  177  F  177



>ref|XP_007308896.1| UNC-50-like protein [Stereum hirsutum FP-91666 SS1]
 gb|EIM81930.1| UNC-50-like protein [Stereum hirsutum FP-91666 SS1]
Length=255

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
 Frame = +1

Query  109  MLPTSSLKGRTSSHARPN----SVFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPKVVYQH  276
            +LPTS+   +     RP+    +  P   RR++++  MD E   WQ+ +LC +PK VY++
Sbjct  3    ILPTSAGPHQNGFPQRPSQSVTNRVPVIFRRLLRFHSMDFELAAWQLTYLCLAPKRVYRN  62

Query  277  TKYHKQTKNQWARDDPAFIVICSLLLACSTLAYCAAYDHSAGHTVFVVISVLLFHFLITG  456
              +HKQTKN WARDDPA +++ +  L+ + +A+   + +    T+ +   ++   +L+ G
Sbjct  63   VYFHKQTKNTWARDDPAILILIAACLSVAAIAWSVMWSYGILDTLKLAFLMIFRDYLLVG  122

Query  457  AVLSTCCWFLTNNYLREETPNSHVVEQRVEWLYAFDVHCNSFFPMFILLYVVHYFLSP  630
            AV++T  WF  N  L     +S   +  VEW YAFDVH N+FFP+++ LY+   FL P
Sbjct  123  AVMATFFWFFANRALLSPPSHSTPADTSVEWAYAFDVHTNAFFPLYLTLYLAQLFLVP  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875