BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016E09 647 bp,

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    307   2e-99   Solanum tuberosum [potatoes]
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      308   4e-99   Solanum tuberosum [potatoes]
ref|XP_006348305.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    305   7e-99   Solanum tuberosum [potatoes]
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    307   2e-98   Solanum tuberosum [potatoes]
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          305   8e-98   Nicotiana tomentosiformis
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    305   1e-97   Solanum tuberosum [potatoes]
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          304   3e-97   Solanum lycopersicum
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          303   7e-97   Solanum lycopersicum
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          300   1e-96   Nicotiana sylvestris
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               301   2e-96   Solanum tuberosum [potatoes]
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    300   1e-95   Nicotiana sylvestris
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      299   1e-95   Solanum tuberosum [potatoes]
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    299   3e-95   Nicotiana sylvestris
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          296   2e-94   Nicotiana tomentosiformis
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          296   4e-94   Solanum lycopersicum
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          293   4e-93   Nicotiana tomentosiformis
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               290   1e-91   Solanum lycopersicum
ref|XP_010323670.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2    285   4e-91   Solanum lycopersicum
ref|XP_006348300.1|  PREDICTED: secologanin synthase-like               281   9e-91   
emb|CDP15978.1|  unnamed protein product                                286   2e-90   Coffea canephora [robusta coffee]
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               285   5e-90   Solanum tuberosum [potatoes]
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          285   5e-90   Sesamum indicum [beniseed]
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    285   9e-90   Solanum lycopersicum
gb|AFB70987.1|  secologanin synthase 1                                  275   1e-89   Mitragyna speciosa
emb|CDP14360.1|  unnamed protein product                                280   2e-89   Coffea canephora [robusta coffee]
ref|XP_009615909.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    281   2e-89   Nicotiana tomentosiformis
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    282   7e-89   Nicotiana tomentosiformis
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          282   8e-89   Solanum lycopersicum
gb|AFB70988.1|  secologanin synthase 2                                  273   8e-89   Mitragyna speciosa
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               281   1e-88   Solanum tuberosum [potatoes]
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               281   1e-88   Solanum lycopersicum
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          281   2e-88   Sesamum indicum [beniseed]
gb|ABC69422.1|  CYP72A58                                                281   2e-88   Nicotiana tabacum [American tobacco]
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          281   3e-88   Nicotiana sylvestris
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          280   4e-88   Solanum lycopersicum
ref|XP_006348301.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      274   8e-88   
emb|CDP15976.1|  unnamed protein product                                278   2e-87   Coffea canephora [robusta coffee]
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               278   2e-87   Solanum tuberosum [potatoes]
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          278   2e-87   Nicotiana sylvestris
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          276   2e-86   Solanum lycopersicum
emb|CDP19609.1|  unnamed protein product                                276   2e-86   Coffea canephora [robusta coffee]
ref|XP_006598138.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    272   5e-86   Glycine max [soybeans]
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          275   6e-86   Nicotiana tomentosiformis
gb|EYU44092.1|  hypothetical protein MIMGU_mgv1a0044501mg               271   7e-86   Erythranthe guttata [common monkey flower]
emb|CDP19603.1|  unnamed protein product                                271   9e-86   Coffea canephora [robusta coffee]
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          274   9e-86   Solanum lycopersicum
emb|CDP14358.1|  unnamed protein product                                270   1e-85   Coffea canephora [robusta coffee]
gb|ABC69419.1|  CYP72A56                                                272   6e-85   Nicotiana tabacum [American tobacco]
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    271   1e-84   Glycine max [soybeans]
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               271   1e-84   
emb|CDP15988.1|  unnamed protein product                                271   2e-84   Coffea canephora [robusta coffee]
ref|XP_006362153.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      266   3e-84   
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               270   5e-84   Solanum tuberosum [potatoes]
ref|XP_009796906.1|  PREDICTED: cytochrome P450 CYP72A219-like          267   7e-84   Nicotiana sylvestris
emb|CDP19599.1|  unnamed protein product                                269   7e-84   Coffea canephora [robusta coffee]
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    266   2e-83   Solanum lycopersicum
gb|KHN44056.1|  Secologanin synthase                                    267   4e-83   Glycine soja [wild soybean]
emb|CDP15980.1|  unnamed protein product                                267   6e-83   Coffea canephora [robusta coffee]
emb|CDP15983.1|  unnamed protein product                                267   6e-83   Coffea canephora [robusta coffee]
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    266   8e-83   Solanum lycopersicum
emb|CDP11335.1|  unnamed protein product                                266   1e-82   Coffea canephora [robusta coffee]
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               266   2e-82   Solanum tuberosum [potatoes]
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   2e-82   Nicotiana sylvestris
gb|ABC69417.1|  CYP72A54                                                266   2e-82   Nicotiana tabacum [American tobacco]
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          266   2e-82   Solanum lycopersicum
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      265   5e-82   Solanum tuberosum [potatoes]
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               264   7e-82   Citrus sinensis [Valencia orange]
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          264   7e-82   Solanum lycopersicum
gb|AFS28689.1|  putative secologanin synthase                           257   7e-82   Olea europaea
gb|AFS28688.1|  putative secologanin synthase                           257   8e-82   Olea europaea
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          264   8e-82   Nicotiana tomentosiformis
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          263   1e-81   Lonicera japonica [Japanese honeysuckle]
emb|CBI39912.3|  unnamed protein product                                261   1e-81   Vitis vinifera
emb|CDP15975.1|  unnamed protein product                                263   2e-81   Coffea canephora [robusta coffee]
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               263   3e-81   Citrus sinensis [Valencia orange]
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    262   3e-81   Glycine max [soybeans]
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          260   4e-81   Vitis vinifera
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               262   5e-81   Cicer arietinum [garbanzo]
gb|ABC69393.1|  CYP72A55v2                                              262   6e-81   Nicotiana tabacum [American tobacco]
gb|KEH38477.1|  cytochrome P450 family 72 protein                       256   8e-81   Medicago truncatula
gb|ABC69392.1|  CYP72A55v1                                              261   9e-81   Nicotiana tabacum [American tobacco]
gb|AJD25168.1|  cytochrome P450 CYP72A327                               261   1e-80   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006377681.1|  cytochrome P450 family protein                     258   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          261   1e-80   Nicotiana tomentosiformis
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          260   2e-80   Solanum lycopersicum
gb|KHN44057.1|  Secologanin synthase                                    260   2e-80   Glycine soja [wild soybean]
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             260   2e-80   Phaseolus vulgaris [French bean]
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             260   2e-80   Phaseolus vulgaris [French bean]
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          259   4e-80   Artemisia annua [sweet Annie]
ref|XP_010644760.1|  PREDICTED: cytochrome P450 CYP72A219-like          256   7e-80   Vitis vinifera
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    259   8e-80   Panax ginseng [Chinese ginseng]
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               258   1e-79   Solanum tuberosum [potatoes]
gb|AIA82924.1|  SLS1                                                    258   1e-79   Gentiana rigescens
gb|AGX93048.1|  secologanin synthase-like protein                       258   1e-79   Tabernaemontana elegans
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                258   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    258   2e-79   Theobroma cacao [chocolate]
gb|AJD25171.1|  cytochrome P450 CYP72A330                               258   2e-79   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006377690.1|  cytochrome P450 family protein                     253   2e-79   Populus trichocarpa [western balsam poplar]
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    258   2e-79   Theobroma cacao [chocolate]
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    257   3e-79   Vitis vinifera
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    257   3e-79   Vitis vinifera
gb|KEH38478.1|  cytochrome P450 family 72 protein                       257   5e-79   Medicago truncatula
gb|KEH38476.1|  cytochrome P450 family 72 protein                       256   5e-79   Medicago truncatula
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               256   6e-79   Vitis vinifera
gb|KEH38472.1|  cytochrome P450 family protein                          251   8e-79   Medicago truncatula
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  256   8e-79   Medicago truncatula
emb|CDP19600.1|  unnamed protein product                                256   9e-79   Coffea canephora [robusta coffee]
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               256   9e-79   Vitis vinifera
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          256   1e-78   Medicago truncatula
emb|CBI39916.3|  unnamed protein product                                255   1e-78   Vitis vinifera
emb|CBI39929.3|  unnamed protein product                                254   1e-78   Vitis vinifera
ref|XP_010092744.1|  Secologanin synthase                               257   1e-78   Morus notabilis
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          256   1e-78   Solanum lycopersicum
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               255   2e-78   Solanum tuberosum [potatoes]
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               255   2e-78   Vitis vinifera
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      262   2e-78   
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               255   3e-78   Cicer arietinum [garbanzo]
ref|XP_006477950.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    252   3e-78   Citrus sinensis [Valencia orange]
emb|CAN67740.1|  hypothetical protein VITISV_015554                     255   3e-78   Vitis vinifera
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          254   3e-78   Vinca minor [common periwinkle]
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          254   3e-78   Solanum lycopersicum
ref|XP_007211745.1|  hypothetical protein PRUPE_ppa006307mg             252   3e-78   Prunus persica
ref|XP_011460847.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    254   3e-78   Fragaria vesca subsp. vesca
ref|XP_010092742.1|  Secologanin synthase                               254   4e-78   Morus notabilis
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          254   4e-78   Glycyrrhiza uralensis [Chinese licorice]
emb|CBI39917.3|  unnamed protein product                                253   4e-78   Vitis vinifera
emb|CBI39886.3|  unnamed protein product                                255   5e-78   Vitis vinifera
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          254   6e-78   Vitis vinifera
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               254   6e-78   Solanum lycopersicum
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          253   8e-78   Vitis vinifera
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g             253   8e-78   Populus trichocarpa [western balsam poplar]
emb|CAN72865.1|  hypothetical protein VITISV_029731                     253   9e-78   Vitis vinifera
gb|AAA17732.1|  cytochrome P450                                         253   1e-77   Catharanthus roseus [chatas]
dbj|BAP90521.1|  secologanin synthase                                   253   1e-77   Ophiorrhiza pumila
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          253   1e-77   Cinchona calisaya [quinine]
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    254   1e-77   Populus euphratica
emb|CDP15979.1|  unnamed protein product                                253   1e-77   Coffea canephora [robusta coffee]
ref|XP_002526971.1|  cytochrome P450, putative                          250   2e-77   
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                253   2e-77   Erythranthe guttata [common monkey flower]
gb|AGX93049.1|  secologanin synthase-like protein                       253   2e-77   Vinca minor [common periwinkle]
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               253   2e-77   Citrus sinensis [Valencia orange]
dbj|BAF98466.1|  cytochrome P450                                        252   2e-77   Coptis japonica var. dissecta
gb|AGX93045.1|  secologanin synthase-like protein                       252   2e-77   Cinchona calisaya [quinine]
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             252   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_009594692.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    249   3e-77   Nicotiana tomentosiformis
emb|CBI39923.3|  unnamed protein product                                250   3e-77   Vitis vinifera
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                252   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          252   3e-77   Vitis vinifera
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               252   3e-77   Citrus sinensis [Valencia orange]
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    252   3e-77   Catharanthus roseus [chatas]
gb|AGX93046.1|  secologanin synthase-like protein                       252   3e-77   Amsonia hubrichtii
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    252   3e-77   Citrus sinensis [Valencia orange]
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          253   3e-77   Populus euphratica
gb|AAA17746.1|  cytochrome P450                                         252   3e-77   Catharanthus roseus [chatas]
ref|XP_006407057.1|  hypothetical protein EUTSA_v10020855mg             248   4e-77   Eutrema salsugineum
ref|XP_010487265.1|  PREDICTED: cytochrome P450 72A13-like              250   4e-77   Camelina sativa [gold-of-pleasure]
ref|XP_004294187.1|  PREDICTED: cytochrome P450 CYP72A219-like          252   4e-77   Fragaria vesca subsp. vesca
gb|AGX93064.1|  secologanin synthase                                    252   5e-77   Catharanthus roseus [chatas]
emb|CBI39938.3|  unnamed protein product                                249   5e-77   Vitis vinifera
gb|KHN47456.1|  Secologanin synthase                                    252   6e-77   Glycine soja [wild soybean]
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    251   6e-77   Prunus mume [ume]
emb|CBI22133.3|  unnamed protein product                                254   6e-77   Vitis vinifera
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          251   7e-77   Tabernaemontana elegans
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      251   7e-77   Glycine max [soybeans]
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    251   7e-77   Prunus mume [ume]
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          251   9e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               251   9e-77   Solanum tuberosum [potatoes]
gb|AGX93047.1|  secologanin synthase-like protein                       251   9e-77   Rauvolfia serpentina [devilpepper]
ref|XP_008345110.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   1e-76   
emb|CDP19601.1|  unnamed protein product                                250   1e-76   Coffea canephora [robusta coffee]
gb|KHN36820.1|  Secologanin synthase                                    250   1e-76   Glycine soja [wild soybean]
emb|CBI39937.3|  unnamed protein product                                249   1e-76   Vitis vinifera
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          250   1e-76   Nicotiana sylvestris
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               250   1e-76   Vitis vinifera
gb|KEH38475.1|  cytochrome P450 family 72 protein                       250   1e-76   Medicago truncatula
gb|ABC69390.1|  CYP72A53v1                                              250   1e-76   Nicotiana tabacum [American tobacco]
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             250   2e-76   Phaseolus vulgaris [French bean]
emb|CBI22129.3|  unnamed protein product                                248   2e-76   Vitis vinifera
gb|KHG20903.1|  Secologanin synthase                                    244   2e-76   Gossypium arboreum [tree cotton]
emb|CDP15982.1|  unnamed protein product                                249   2e-76   Coffea canephora [robusta coffee]
gb|ABC69389.1|  CYP72A52v1                                              250   2e-76   Nicotiana tabacum [American tobacco]
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          249   2e-76   Nicotiana tomentosiformis
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               249   2e-76   Solanum tuberosum [potatoes]
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          249   3e-76   Rauvolfia serpentina [devilpepper]
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          249   3e-76   Vitis vinifera
gb|KEH38469.1|  cytochrome P450 family 709 protein                      249   3e-76   Medicago truncatula
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          249   3e-76   Amsonia hubrichtii
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      249   4e-76   Glycine max [soybeans]
gb|KHN14193.1|  Secologanin synthase                                    249   4e-76   Glycine soja [wild soybean]
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    249   5e-76   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15973.1|  unnamed protein product                                249   5e-76   Coffea canephora [robusta coffee]
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              249   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_008364401.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    246   6e-76   
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               248   6e-76   Solanum tuberosum [potatoes]
ref|XP_009147883.1|  PREDICTED: cytochrome P450 72A15-like              244   6e-76   Brassica rapa
ref|XP_010487263.1|  PREDICTED: cytochrome P450 72A13-like              245   7e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               248   7e-76   Vitis vinifera
emb|CDP15974.1|  unnamed protein product                                246   8e-76   Coffea canephora [robusta coffee]
gb|KJB26994.1|  hypothetical protein B456_004G270700                    248   8e-76   Gossypium raimondii
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          248   8e-76   Sesamum indicum [beniseed]
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               248   8e-76   
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    248   8e-76   Nicotiana tomentosiformis
ref|XP_006348402.1|  PREDICTED: secologanin synthase-like               246   1e-75   
ref|XP_002882888.1|  CYP72A15                                           247   2e-75   Arabidopsis lyrata subsp. lyrata
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             248   2e-75   Catharanthus roseus [chatas]
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    247   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14489.1|  Secologanin synthase                                    247   2e-75   Gossypium arboreum [tree cotton]
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    247   3e-75   Arabis alpina [alpine rockcress]
gb|AGX93044.1|  secologanin synthase-like protein                       247   3e-75   Lonicera japonica [Japanese honeysuckle]
ref|XP_004295683.1|  PREDICTED: cytochrome P450 CYP72A219-like          247   3e-75   Fragaria vesca subsp. vesca
ref|XP_010502025.1|  PREDICTED: cytochrome P450 72A13-like isofor...    244   4e-75   Camelina sativa [gold-of-pleasure]
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    248   4e-75   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             246   5e-75   Phaseolus vulgaris [French bean]
emb|CDX97591.1|  BnaA05g24880D                                          246   5e-75   Brassica napus [oilseed rape]
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             246   6e-75   Medicago truncatula
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          246   7e-75   Solanum lycopersicum
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          246   7e-75   Sesamum indicum [beniseed]
ref|XP_009790241.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    244   8e-75   Nicotiana sylvestris
emb|CDX97592.1|  BnaA05g24870D                                          246   8e-75   Brassica napus [oilseed rape]
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               246   8e-75   Vitis vinifera
emb|CBI22134.3|  unnamed protein product                                246   8e-75   Vitis vinifera
gb|AJD25169.1|  cytochrome P450 CYP72A328                               246   8e-75   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          246   9e-75   Nelumbo nucifera [Indian lotus]
emb|CDX98486.1|  BnaC05g38890D                                          245   9e-75   Brassica napus [oilseed rape]
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              245   9e-75   Brassica rapa
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    245   1e-74   Arabis alpina [alpine rockcress]
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      245   1e-74   Glycine max [soybeans]
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   245   1e-74   Brassica rapa
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                245   1e-74   Erythranthe guttata [common monkey flower]
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              246   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              244   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          245   2e-74   Prunus mume [ume]
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   2e-74   Pyrus x bretschneideri [bai li]
emb|CDX97593.1|  BnaA05g24860D                                          244   2e-74   Brassica napus [oilseed rape]
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   2e-74   Solanum lycopersicum
emb|CDX98484.1|  BnaC05g38910D                                          244   2e-74   Brassica napus [oilseed rape]
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   3e-74   Nelumbo nucifera [Indian lotus]
emb|CAN71061.1|  hypothetical protein VITISV_032613                     237   3e-74   Vitis vinifera
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              244   3e-74   Brassica rapa
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   3e-74   Malus domestica [apple tree]
ref|XP_004300362.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   3e-74   Fragaria vesca subsp. vesca
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   244   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             244   4e-74   Eutrema salsugineum
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   4e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007133275.1|  hypothetical protein PHAVU_011G166000g             239   4e-74   Phaseolus vulgaris [French bean]
gb|KFK38825.1|  hypothetical protein AALP_AA3G165400                    251   4e-74   Arabis alpina [alpine rockcress]
emb|CDY51036.1|  BnaA06g02990D                                          244   5e-74   Brassica napus [oilseed rape]
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          244   5e-74   Pyrus x bretschneideri [bai li]
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              243   5e-74   Camelina sativa [gold-of-pleasure]
emb|CDP15985.1|  unnamed protein product                                243   5e-74   Coffea canephora [robusta coffee]
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              244   5e-74   Camelina sativa [gold-of-pleasure]
gb|KFK38824.1|  hypothetical protein AALP_AA3G165400                    251   6e-74   Arabis alpina [alpine rockcress]
gb|KHG20902.1|  Secologanin synthase                                    243   6e-74   Gossypium arboreum [tree cotton]
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    243   6e-74   Nicotiana sylvestris
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             243   6e-74   Phaseolus vulgaris [French bean]
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               243   7e-74   Solanum tuberosum [potatoes]
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    243   8e-74   Camelina sativa [gold-of-pleasure]
gb|AEI59772.1|  cytochrome P450                                         243   9e-74   Helianthus annuus
emb|CDY70619.1|  BnaCnng69060D                                          238   1e-73   Brassica napus [oilseed rape]
gb|ABC59099.1|  cytochrome P450 monooxygenase CYP72A66                  239   1e-73   Medicago truncatula
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  243   1e-73   Medicago truncatula
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        243   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        243   1e-73   Camelina sativa [gold-of-pleasure]
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    242   2e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          242   2e-73   Medicago truncatula
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          243   2e-73   Cucumis melo [Oriental melon]
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    242   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    243   2e-73   Medicago truncatula
gb|KHG18227.1|  Secologanin synthase                                    242   2e-73   Gossypium arboreum [tree cotton]
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             242   2e-73   Capsella rubella
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          242   2e-73   Cucumis melo [Oriental melon]
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    242   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          242   2e-73   Cucumis melo [Oriental melon]
gb|EPS69403.1|  hypothetical protein M569_05363                         242   2e-73   Genlisea aurea
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    242   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010064521.1|  PREDICTED: cytochrome P450 72A14-like              239   2e-73   Eucalyptus grandis [rose gum]
gb|EPS61172.1|  hypothetical protein M569_13627                         241   2e-73   Genlisea aurea
gb|AJD25167.1|  cytochrome P450 CYP72A326                               242   3e-73   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             242   3e-73   Phaseolus vulgaris [French bean]
ref|XP_004294189.1|  PREDICTED: cytochrome P450 72A15-like              241   3e-73   
ref|XP_006377686.1|  hypothetical protein POPTR_0011s102201g            235   3e-73   
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          241   4e-73   
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          242   4e-73   
emb|CBI22139.3|  unnamed protein product                                238   4e-73   
emb|CDY51038.1|  BnaA06g03010D                                          241   4e-73   
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              241   5e-73   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              241   6e-73   
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              241   7e-73   
gb|EYU38223.1|  hypothetical protein MIMGU_mgv1a005129mg                240   7e-73   
ref|XP_004295684.1|  PREDICTED: cytochrome P450 CYP72A219-like          241   7e-73   
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              240   8e-73   
emb|CDX75785.1|  BnaC03g38680D                                          236   8e-73   
emb|CDY65331.1|  BnaC03g73770D                                          238   9e-73   
gb|KJB12901.1|  hypothetical protein B456_002G043400                    240   1e-72   
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          240   1e-72   
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             240   1e-72   
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          240   1e-72   
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          240   1e-72   
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                     240   1e-72   
emb|CDY32348.1|  BnaC01g36670D                                          240   1e-72   
gb|KJB12904.1|  hypothetical protein B456_002G043600                    240   1e-72   
ref|XP_004307203.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    240   2e-72   
gb|KJB12906.1|  hypothetical protein B456_002G043600                    241   2e-72   
gb|KJB12897.1|  hypothetical protein B456_002G043200                    239   2e-72   
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              239   2e-72   
emb|CDY20078.1|  BnaA01g29240D                                          239   2e-72   
ref|XP_009628929.1|  PREDICTED: cytochrome P450 CYP72A219-like          238   2e-72   
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          239   2e-72   
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              239   2e-72   
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          239   2e-72   
emb|CDX98485.1|  BnaC05g38900D                                          239   2e-72   
emb|CDY28093.1|  BnaC06g02740D                                          239   3e-72   
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          239   3e-72   
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    239   3e-72   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    239   3e-72   
gb|KJB12898.1|  hypothetical protein B456_002G043200                    239   3e-72   
gb|KEH38470.1|  cytochrome P450 family monooxygenase                    239   3e-72   
ref|XP_010248211.1|  PREDICTED: cytochrome P450 CYP72A219-like          236   4e-72   
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    239   4e-72   
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    239   4e-72   
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          238   5e-72   
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          238   5e-72   
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             239   5e-72   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               239   6e-72   
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          238   6e-72   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      238   6e-72   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               238   7e-72   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          238   8e-72   
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              238   8e-72   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    238   9e-72   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    238   1e-71   
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    238   1e-71   
emb|CDX82468.1|  BnaA03g33530D                                          238   1e-71   
ref|XP_006598146.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      236   2e-71   
gb|ADU19849.1|  putative secologanin synthase                           237   2e-71   
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              237   2e-71   
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    237   2e-71   
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              236   2e-71   
gb|KHN44046.1|  Secologanin synthase                                    237   2e-71   
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    236   3e-71   
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          236   3e-71   
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          235   3e-71   
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      236   3e-71   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              236   3e-71   
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    236   4e-71   
ref|NP_001183345.1|  uncharacterized protein LOC100501753               231   4e-71   
ref|XP_002455991.1|  hypothetical protein SORBIDRAFT_03g028590          236   5e-71   
emb|CDX82472.1|  BnaA03g33490D                                          233   6e-71   
ref|XP_006407061.1|  hypothetical protein EUTSA_v10020533mg             235   6e-71   
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              235   6e-71   
gb|EAZ12776.1|  hypothetical protein OsJ_02693                          236   7e-71   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          236   7e-71   
emb|CDX82471.1|  BnaA03g33500D                                          235   8e-71   
emb|CDP16565.1|  unnamed protein product                                232   8e-71   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          235   1e-70   
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          235   1e-70   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    235   1e-70   
gb|AJD25172.1|  cytochrome P450 CYP72A331                               235   1e-70   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    235   1e-70   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             234   1e-70   
dbj|BAB02395.1|  cytochrome P450-like protein                           234   2e-70   
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          234   2e-70   
gb|EAY75044.1|  hypothetical protein OsI_02940                          237   2e-70   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             234   2e-70   
ref|XP_007149356.1|  hypothetical protein PHAVU_005G063500g             230   2e-70   
ref|XP_009394609.1|  PREDICTED: cytochrome P450 72A15-like              234   2e-70   
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              234   3e-70   
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              234   3e-70   
ref|XP_006442303.1|  hypothetical protein CICLE_v10023520mg             229   3e-70   
ref|XP_008776865.1|  PREDICTED: cytochrome P450 72A15-like isofor...    231   3e-70   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          233   4e-70   
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          234   4e-70   
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                233   4e-70   
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          233   4e-70   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          233   5e-70   
emb|CDP15981.1|  unnamed protein product                                233   5e-70   
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          233   5e-70   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               233   5e-70   
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             233   6e-70   
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    233   6e-70   
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               233   6e-70   
gb|AJD25170.1|  cytochrome P450 CYP72A329                               233   7e-70   
gb|KHN12943.1|  Secologanin synthase                                    228   9e-70   
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                232   1e-69   
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              233   1e-69   
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              232   1e-69   
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               233   1e-69   
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              232   1e-69   
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    232   1e-69   
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             232   1e-69   
emb|CDP20014.1|  unnamed protein product                                228   1e-69   
ref|XP_010926847.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    229   1e-69   
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    232   1e-69   
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              232   2e-69   
dbj|BAJ85869.1|  predicted protein                                      232   2e-69   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    232   2e-69   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               233   2e-69   
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          231   2e-69   
ref|XP_009116716.1|  PREDICTED: cytochrome P450 72A15-like isofor...    231   2e-69   
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    232   2e-69   
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               232   2e-69   
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          231   2e-69   
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          231   2e-69   
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          232   2e-69   
emb|CDX75787.1|  BnaC03g38700D                                          228   2e-69   
ref|XP_006299313.1|  hypothetical protein CARUB_v10015468mg             231   3e-69   
gb|EYU26261.1|  hypothetical protein MIMGU_mgv1a004867mg                231   3e-69   
gb|ACG28404.1|  cytochrome P450 CYP72A124                               231   3e-69   
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              231   3e-69   
ref|XP_008673331.1|  PREDICTED: uncharacterized protein LOC100501...    231   3e-69   
ref|XP_004969239.1|  PREDICTED: secologanin synthase-like               231   3e-69   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               231   4e-69   
gb|ABC68405.1|  cytochrome P450 monooxygenase CYP72A68                  229   4e-69   
ref|XP_010678726.1|  PREDICTED: cytochrome P450 CYP72A219-like          228   4e-69   
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    231   4e-69   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    231   5e-69   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              231   5e-69   
gb|KCW67647.1|  hypothetical protein EUGRSUZ_F01394                     228   5e-69   
ref|XP_006442302.1|  hypothetical protein CICLE_v100197311mg            228   6e-69   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      230   6e-69   
ref|XP_007149354.1|  hypothetical protein PHAVU_005G0634001g            228   7e-69   
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          230   7e-69   
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              230   7e-69   
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               230   7e-69   
gb|EMS46232.1|  Secologanin synthase                                    229   8e-69   
ref|XP_002266550.1|  PREDICTED: cytochrome P450 CYP72A219-like          226   8e-69   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          230   8e-69   
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              230   8e-69   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  230   9e-69   
ref|XP_003569398.1|  PREDICTED: cytochrome P450 72A15-like              230   1e-68   
gb|EPS65653.1|  hypothetical protein M569_09124                         229   1e-68   
ref|XP_006646124.1|  PREDICTED: secologanin synthase-like               230   1e-68   
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          229   1e-68   
gb|EMT23021.1|  Secologanin synthase                                    229   1e-68   
ref|NP_001043631.1|  Os01g0627400                                       230   1e-68   
gb|KHN44060.1|  Secologanin synthase                                    228   1e-68   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              229   1e-68   
ref|XP_004151452.1|  PREDICTED: secologanin synthase-like               221   1e-68   
gb|EEE55021.1|  hypothetical protein OsJ_02678                          230   1e-68   
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             229   1e-68   
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              229   1e-68   
gb|EMS56507.1|  Secologanin synthase                                    228   2e-68   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              229   2e-68   
ref|XP_006407056.1|  hypothetical protein EUTSA_v10022214mg             229   2e-68   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    229   2e-68   
gb|KCW67651.1|  hypothetical protein EUGRSUZ_F01398                     224   2e-68   
gb|EAY75042.1|  hypothetical protein OsI_02938                          229   2e-68   
ref|XP_010926878.1|  PREDICTED: cytochrome P450 72A15-like isofor...    226   2e-68   
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              229   2e-68   
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          229   2e-68   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    228   3e-68   
gb|ABG85296.1|  P450 monooxygenase                                      229   3e-68   
ref|NP_001043635.1|  Os01g0627900                                       229   3e-68   
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    228   3e-68   
emb|CDY20076.1|  BnaA01g29260D                                          228   3e-68   
dbj|BAN19928.1|  cytochrome P450                                        229   3e-68   
dbj|BAN19916.1|  cytochrome P450                                        229   3e-68   
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               228   4e-68   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    228   4e-68   
ref|XP_002458201.1|  hypothetical protein SORBIDRAFT_03g028620          229   4e-68   
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      228   4e-68   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              228   4e-68   
gb|KEH37983.1|  cytochrome P450 family 72 protein                       228   4e-68   
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             228   5e-68   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          228   5e-68   
ref|NP_001043632.1|  Os01g0627500                                       228   6e-68   
gb|AAQ13550.1|AF123610_6  cytochrome P450                               228   6e-68   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     228   6e-68   
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      228   7e-68   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              227   9e-68   
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase           228   9e-68   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          228   9e-68   
ref|XP_002456001.1|  hypothetical protein SORBIDRAFT_03g028720          228   9e-68   
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             227   9e-68   
dbj|BAO73901.1|  cytochrome P450                                        223   9e-68   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          227   9e-68   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     227   1e-67   
dbj|BAO73904.1|  cytochrome P450                                        221   1e-67   
ref|XP_006644394.1|  PREDICTED: secologanin synthase-like               228   1e-67   
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      227   1e-67   
gb|KHN47459.1|  Secologanin synthase                                    227   1e-67   
gb|EMT30685.1|  Secologanin synthase                                    225   1e-67   
emb|CDY32349.1|  BnaC01g36680D                                          226   1e-67   
gb|AAQ13549.1|AF123610_5  cytochrome P450                               227   1e-67   
gb|EMS55333.1|  Secologanin synthase                                    223   2e-67   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             226   2e-67   
emb|CDP06075.1|  unnamed protein product                                229   2e-67   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              226   2e-67   
dbj|BAB87118.1|  cytochrome P450                                        227   2e-67   
ref|XP_007211746.1|  hypothetical protein PRUPE_ppa006310mg             223   3e-67   
gb|EMT07075.1|  Secologanin synthase                                    226   3e-67   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          226   3e-67   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              226   3e-67   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    226   3e-67   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          226   4e-67   
dbj|BAO73903.1|  cytochrome P450                                        223   4e-67   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              226   4e-67   
dbj|BAJ99602.1|  predicted protein                                      226   4e-67   
ref|XP_003566910.1|  PREDICTED: cytochrome P450 72A15-like              226   4e-67   
emb|CDX97588.1|  BnaA05g24910D                                          226   4e-67   



>ref|XP_006348902.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
Length=435

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  +FIE  R VY+PGW F+PTKRNRRM  IE+ V+++IRGIIDKR+KAM+GGE NN+D
Sbjct  148  EQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIERHVQATIRGIIDKRVKAMKGGEANNED  207

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K FG+SIE+VIEECK+FYFAGQETTS +LVWT+ILL R  DW
Sbjct  208  LLGILLESNFKEIEQHGDKNFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDW  267

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+++PDF+GLN LKV+TMILYESLRLYPP+  + RR  E+T LG++ L
Sbjct  268  QTRAREEVLQVFGNRKPDFDGLNHLKVVTMILYESLRLYPPVMTVTRRLNEDTVLGDMSL  327

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL LP +L+H D EIWGED
Sbjct  328  PAGVLLSLPAVLLHHDEEIWGED  350



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H IEVSR +Y+PGWRF+PTKRNRRM  IE+EV+++IRGIIDKR+K M+ GE N DD
Sbjct  231  EQAEHVIEVSRTLYIPGWRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K FGM+I++VIEECK+FYFAGQETTSV LVWTMILLSR  DW
Sbjct  291  LLGILLESNFKEIEQHGNKNFGMTIKEVIEECKLFYFAGQETTSVWLVWTMILLSRHPDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFGD  P F+GLN LKV+TMIL+ESLRLYPP++ + RR   +TKLGE+ L
Sbjct  351  QVRAREEVLQVFGDGMPGFDGLNRLKVVTMILHESLRLYPPVSALGRRITTKTKLGELNL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L LPT+L+H D EIWGED
Sbjct  411  PAGVMLSLPTILVHHDKEIWGED  433



>ref|XP_006348305.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006348306.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X3 [Solanum 
tuberosum]
Length=417

 Score =   305 bits (780),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF+EV R VY+PGWRF+PTKRNRRM  I+K+V+SSIRGIIDKR+KAM+ G  +N+D
Sbjct  130  EQAQHFLEVIRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNED  189

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G K+FGMSIE+VIEECK+FYFAG ETTSV ++WT++LLSR+ DW
Sbjct  190  LLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDW  249

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY PIT + RR  E+  LGE+ L
Sbjct  250  QARAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLARRIYEDITLGEVSL  309

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D +IWGED
Sbjct  310  PTGVLVSLPIILLHHDKDIWGED  332



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  +FIE  R VY+PGW F+PTKRNRRM  IE+ V+++IRGIIDKR+KAM+GGE NN+D
Sbjct  232  EQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIERHVQATIRGIIDKRVKAMKGGEANNED  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K FG+SIE+VIEECK+FYFAGQETTS +LVWT+ILL R  DW
Sbjct  292  LLGILLESNFKEIEQHGDKNFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+++PDF+GLN LKV+TMILYESLRLYPP+  + RR  E+T LG++ L
Sbjct  352  QTRAREEVLQVFGNRKPDFDGLNHLKVVTMILYESLRLYPPVMTVTRRLNEDTVLGDMSL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL LP +L+H D EIWGED
Sbjct  412  PAGVLLSLPAVLLHHDEEIWGED  434



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +E  R VY+PGWRF+PTKRNRRM  IEK+V++ +RGIIDKR+K+M+ GE NN+D
Sbjct  231  EQAQFLMEAIRSVYIPGWRFLPTKRNRRMKEIEKDVQALVRGIIDKRVKSMKAGEVNNED  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FGMSIE+VI+ECK+FYFAGQETTSV+LVWT+ILLSR QDW
Sbjct  291  LLGILLESNFKEIEQHGNKDFGMSIEEVIQECKLFYFAGQETTSVLLVWTLILLSRHQDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QA AREEVLQVFG+Q+PDF+GLN LK++TMILYESLRLYPP+  + RR  E+T LG++ L
Sbjct  351  QALAREEVLQVFGNQKPDFDGLNRLKIVTMILYESLRLYPPVVTLTRRPKEDTVLGDVSL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D EIWG+D
Sbjct  411  PAGVLISLPVILLHHDEEIWGKD  433



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF+EV R VY+PGWRF+PTKRNRRM  I+K+V+SSIRGIIDKR+KAM+ G  +N+D
Sbjct  232  EQAQHFLEVIRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNED  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G K+FGMSIE+VIEECK+FYFAG ETTSV ++WT++LLSR+ DW
Sbjct  292  LLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY PIT + RR  E+  LGE+ L
Sbjct  352  QARAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLARRIYEDITLGEVSL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D +IWGED
Sbjct  412  PTGVLVSLPIILLHHDKDIWGED  434



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  +FIE  R VY+PGW F+PTKRNRRM  IEK V+++IRGIIDKR+KAM GGE NN D
Sbjct  232  EQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIEKHVQATIRGIIDKRVKAMTGGEANNKD  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI+Q G K+FG+SIE+VIEECK+FYFAGQETTS +LVWT+ILL R  DW
Sbjct  292  LLGILLESNFKEIKQHGDKDFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAR EVLQVFG ++PDF+GL  LKV+TMILYESLRLYPP+T + RR  E+  LG+I L
Sbjct  352  QTRARTEVLQVFGSRKPDFDGLTHLKVVTMILYESLRLYPPVTTVTRRLNEDAVLGDISL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   LL LP +L+H D EIWGED
Sbjct  412  PADVLLSLPAVLLHHDEEIWGED  434



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H I VSR +Y+PGWRF+PTKRNRRM  IE +V+++IRGIIDKR+K ++ GE N DD
Sbjct  231  EQAEHVIAVSRTLYIPGWRFLPTKRNRRMKEIEGKVQTTIRGIIDKRVKGIKAGEANTDD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FGM+I++VIEECK+FYFAGQETTSV+LVWTMILLSR  DW
Sbjct  291  LLGILLESNFKEIEQHGNKDFGMTIKEVIEECKLFYFAGQETTSVLLVWTMILLSRHPDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFGD  P F+GLN LKV+TMIL+ESLRLYPP+  + RR   +TKLGE+ L
Sbjct  351  QVRAREEVLQVFGDGMPGFDGLNRLKVVTMILHESLRLYPPVGALGRRITTKTKLGELNL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L LPT+L+H D EIWGED
Sbjct  411  PAGVMLSLPTILVHHDKEIWGED  433



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H I +SR +Y+PGWRF+PTKRNRRM  IEKEV+++IRGIIDKR+KAM+ GE N DD
Sbjct  230  EQAEHVIAISRTLYIPGWRFMPTKRNRRMKQIEKEVQATIRGIIDKRVKAMKAGEANADD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILL+SN +EI Q G K+FGMS ++VIEECK+FYFAGQETTSV+LVWTM LLSR  DW
Sbjct  290  LLGILLDSNFKEIEQHGNKDFGMSTQEVIEECKLFYFAGQETTSVLLVWTMFLLSRHPDW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQVFGD   +F+GL+ LK++TMIL+ESLRLYPP+  + RR   +TKLGE+ L
Sbjct  350  QARAREEVLQVFGDGMLEFDGLSRLKIVTMILHESLRLYPPVGALGRRITTKTKLGELGL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L LP LL+H D EIWGED
Sbjct  410  PAGVMLSLPILLVHHDKEIWGED  432



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF+EV+R VY+PGWRF+PTKRNRRM  I+K+V+SSIRGIIDKR+KAM+ G  +N+D
Sbjct  232  EQTQHFLEVTRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNED  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G K+FGMSIE+VIEECK+FYFAG ETTSV ++WT++LLSR  DW
Sbjct  292  LLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGTETTSVWILWTLVLLSRCPDW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQV G ++PDF+GLN LKV+TMILYESLRLY PIT + RR  E+  LGE+ L
Sbjct  352  QARAREEVLQVLGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLTRRIYEDITLGEVSL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D +IWGED
Sbjct  412  PTGVLVSLPIILLHHDKDIWGED  434



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF++  R +Y+PGWRF+PTKRNRRM  IEK+V++SI GIIDKR  AM+ GE NN+D
Sbjct  231  EQAQHFMKAIRSIYIPGWRFLPTKRNRRMKEIEKDVQASITGIIDKR--AMKAGEVNNED  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV+LVWT+ILLSR QDW
Sbjct  289  LLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QA+AREEVLQVFG Q+PDF+GLN LK++  +LYESLRLYPP+  + RR  E+T LG++ L
Sbjct  349  QAQAREEVLQVFGSQKPDFDGLNRLKIVRELLYESLRLYPPVVSLTRRPKEDTVLGDVSL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D EIWG+D
Sbjct  409  PAGVLISLPVILLHHDEEIWGKD  431



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H IEVSR +Y+ GWRF+PTKRNRRM  IE+EV+++IRGIIDKR+K M+ GE N DD
Sbjct  232  EQAKHVIEVSRTLYILGWRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDD  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K FGM+I+DVIEECK+F+FAGQETTSV LVWTMILLSR  DW
Sbjct  292  LLGILLESNFKEIEQHGNKNFGMTIKDVIEECKLFFFAGQETTSVWLVWTMILLSRHPDW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQ+FGD  P+F+GLN LKV+TMIL+ESLRLYPP   + RR   + KLG++ L
Sbjct  352  QVRAREEVLQLFGDGMPEFDGLNRLKVVTMILHESLRLYPPTAALGRRITTKMKLGKLNL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L LPT+L+H D EIWGED
Sbjct  412  PEGVMLSLPTILVHHDKEIWGED  434



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 168/203 (83%), Gaps = 2/203 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF++  R +Y+PGWRF+PTKRNRRM  IEK+  S + GIIDKR+KAM+ GE NN+D
Sbjct  231  EQAQHFMKAIRSIYIPGWRFLPTKRNRRMKEIEKD--SKVTGIIDKRVKAMKAGEVNNED  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV+LVWT+ILLSR QDW
Sbjct  289  LLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QA+AREEVLQVFG Q+PDF+GLN LK++  +LYESLRLYPP+  + RR  E+T LG++ L
Sbjct  349  QAQAREEVLQVFGSQKPDFDGLNRLKIVRELLYESLRLYPPVVSLTRRPKEDTVLGDVSL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D EIWG+D
Sbjct  409  PAGVLISLPVILLHHDEEIWGKD  431



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H I +S  +Y+PGWRF+PTKRNRRM  IEKEV++++RGIIDKR+K M+ GE N DD
Sbjct  229  EQAEHVIAISSTLYIPGWRFMPTKRNRRMKEIEKEVQATVRGIIDKRVKTMKAGEANADD  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILL+SN +EI Q G K FGMS ++VIEECK+FYFAGQETTSV+LVWTM+LLSR  +W
Sbjct  289  LLGILLDSNFKEIEQHGSKNFGMSTQEVIEECKLFYFAGQETTSVLLVWTMVLLSRHPEW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQVFGD   +F+GLN LK++TMIL+ESLRLYPP+  + RR   +TKLGE+ L
Sbjct  349  QARAREEVLQVFGDGMLEFDGLNRLKIVTMILHESLRLYPPVGALGRRITTKTKLGELNL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L LP LL+H D EIWGED
Sbjct  409  PAGVMLSLPMLLVHHDEEIWGED  431



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF+EV R VY+PGWRF+PTKRNRRM  ++ +V+SSIRGIIDKR+KAM+ G  +N+D
Sbjct  227  EQAQHFLEVIRSVYIPGWRFLPTKRNRRMKELKNDVRSSIRGIIDKRLKAMEAGNADNED  286

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G K+FGMSIE+VIEECK+FYFAG ETTSV ++WT++LLSR  DW
Sbjct  287  LLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRHPDW  346

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQV G ++PDF+GLN LKV+TMILYESLRLY PIT + RR  E+  LGE+ L
Sbjct  347  QERAREEVLQVLGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLTRRVYEDITLGEVSL  406

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D +IWGED
Sbjct  407  PTGVLVSLPMILLHHDKDIWGED  429



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  +F+E  R VY+PGWRF+PTKRNRRM  +EK+V++SIRGIIDKR+KAM+ GE +N+D
Sbjct  231  EQAQYFVEAIRSVYIPGWRFLPTKRNRRMKEVEKDVRASIRGIIDKRVKAMKAGEASNED  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN  E  Q   K+  MSIE+VI+ECK+FY AGQETTSV+LVWT+ILLSR QDW
Sbjct  291  LLGILLESNFTEAEQHRHKDSAMSIEEVIQECKLFYVAGQETTSVLLVWTLILLSRHQDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q+RAREEV QVFG+Q+PDF+GLN LKV+TMILYESLRLY P+  + RR  E+  LG + L
Sbjct  351  QSRAREEVFQVFGNQKPDFDGLNRLKVVTMILYESLRLYSPVVSLIRRPNEDAILGNVSL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL LP +L+H D EIWG+D
Sbjct  411  PEGVLLSLPVILLHHDEEIWGKD  433



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HFIE +R +Y+ G RF+PTK+NRRM  I+K V++ IRGIIDKR+KA++ GE N DD
Sbjct  231  EQAQHFIEATRTLYILGSRFLPTKKNRRMKEIDKNVQAMIRGIIDKRVKALKAGEANTDD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG+LLESN ++I Q G K+FGMS  ++IEECK+FYFAGQETTSV+LVWTMILLSR  DW
Sbjct  291  LLGMLLESNFKQIEQHGNKDFGMSTREIIEECKLFYFAGQETTSVLLVWTMILLSRHLDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFGD + +F+GLN LK++TMIL ESLRLYPP   ++R+T   TKLGE+ L
Sbjct  351  QTRAREEVLQVFGDSKLEFDGLNRLKIVTMILNESLRLYPPADSLNRKTTTNTKLGELSL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L+LP +L+H D EIWGED
Sbjct  411  PAGVMLVLPIILLHHDKEIWGED  433



>ref|XP_010323670.1| PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Solanum lycopersicum]
Length=431

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +EV+R +Y+PG RF+PTKRN+RM  IEKE++++IR IIDKR++AM+GGET+ DD
Sbjct  144  EQAEHVMEVARSIYIPGSRFLPTKRNKRMLEIEKEIQTTIRRIIDKRLRAMEGGETSKDD  203

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGM+  +VIEECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  204  LLGILLESNMKEIEQHGSKDFGMTTVEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEW  263

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+ +PD EGL  LK++TMILYE+LRL+PP+    R   EE KLGE+ L
Sbjct  264  QVRAREEVLQVFGNDKPDLEGLGRLKIVTMILYETLRLFPPLPTFGRTNKEEVKLGELNL  323

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L++P +L+H D EIWGED
Sbjct  324  PAGVILIVPAILVHYDKEIWGED  346



>ref|XP_006348300.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=350

 Score =   281 bits (720),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +   R VY+PGWRF+PT+RNRRM  I+K+V SSIRGIIDKR+KAM+ G+ +N+D
Sbjct  63   EQAQHVLAAIRSVYIPGWRFLPTRRNRRMKEIKKDVWSSIRGIIDKRLKAMKDGDADNED  122

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI QQ  K+FGMSIEDVIE+CK+FY AG ETTSV L+WT++LLSR+QDW
Sbjct  123  LLGILLESNFKEIEQQRNKDFGMSIEDVIEKCKLFYLAGAETTSVWLLWTLVLLSRYQDW  182

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQVFG ++PDF+GLN LKV+TMILYESLRLYPPIT + RR  E+  LGE+ L
Sbjct  183  QARAREEVLQVFGCRKPDFDGLNHLKVVTMILYESLRLYPPITALTRRVNEDITLGELSL  242

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H + E+WGED
Sbjct  243  PAGVLVSLPVILLHREEEVWGED  265



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 163/203 (80%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HFIE +R +Y+PGWRF+PTKRN RM  I ++V+ SI+ II+ R+KAM+  +  +DD
Sbjct  231  EQTEHFIEAARSLYIPGWRFIPTKRNTRMKQIARDVQESIKDIINARLKAMKAAKACDDD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G K FGM++ +VIEECK+FYFAGQETTSV+LVWTMILLSR+ +W
Sbjct  291  LLGILLESNSKEIDHHGNKNFGMTVLEVIEECKLFYFAGQETTSVLLVWTMILLSRYPEW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQ+FG  +PDF+GLN LK++TMIL+E LRLYPP+T + RR  EET+LG + L
Sbjct  351  QMRAREEVLQLFGTDKPDFDGLNHLKLITMILHEVLRLYPPVTALFRRAAEETRLGNLTL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D EIWG+D
Sbjct  411  PAGLLVSLPVMLLHHDPEIWGDD  433



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HFIE  R VY+PGWRF+PTKRNRRM  I+K+V+S IRGIIDKR+KAM+ G+ +N+D
Sbjct  226  EQVPHFIEAMRSVYIPGWRFLPTKRNRRMKEIKKDVRSLIRGIIDKRLKAMEAGDADNED  285

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI QQGG K+FGMSI+++IEECK+FYFAG ETTSV L+WT++LLSR+QD
Sbjct  286  LLGILLESNFKEIEQQGGNKDFGMSIDEIIEECKLFYFAGSETTSVWLLWTLVLLSRYQD  345

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQA+AREEVLQVFG ++PDF GLN LKV+TMILYESLRLY P+T + R  +E+  LGE+ 
Sbjct  346  WQAQAREEVLQVFGSRKPDFNGLNRLKVVTMILYESLRLYSPVTTLTRLAIEDITLGEVS  405

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G L+ LPT+++H D EIWGED
Sbjct  406  LPAGVLVSLPTVILHHDKEIWGED  429



>ref|XP_011082969.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 161/203 (79%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF   SR +Y+PGWRFVPTKRN+RM  I +EV+S IRGII +R++AM+ GE NN+D
Sbjct  229  EQAGHFFIASRSMYIPGWRFVPTKRNKRMKEIAEEVQSLIRGIISRRVEAMKAGEANNED  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K FGM+I++V+EECK+FYFAGQETTS +LVWT++LLSR+ DW
Sbjct  289  LLGILLESNAREIEQHGNKTFGMTIDEVVEECKLFYFAGQETTSSLLVWTLVLLSRYPDW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG Q P F+GLN LK++TMILYE LR YPP+  + RR  EETKLG + L
Sbjct  349  QKRAREEVLQVFGRQTPAFDGLNYLKIVTMILYEVLRFYPPVVTLGRRVTEETKLGNLTL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  + LP + +H + +IWG+D
Sbjct  409  PAGVQISLPLISLHHNRDIWGDD  431



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   285 bits (728),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +EV+R +Y+PG RF+PTKRN+RM  IEKE++++IR IIDKR++AM+GGET+ DD
Sbjct  239  EQAEHVMEVARSIYIPGSRFLPTKRNKRMLEIEKEIQTTIRRIIDKRLRAMEGGETSKDD  298

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGM+  +VIEECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  299  LLGILLESNMKEIEQHGSKDFGMTTVEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEW  358

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+ +PD EGL  LK++TMILYE+LRL+PP+    R   EE KLGE+ L
Sbjct  359  QVRAREEVLQVFGNDKPDLEGLGRLKIVTMILYETLRLFPPLPTFGRTNKEEVKLGELNL  418

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L++P +L+H D EIWGED
Sbjct  419  PAGVILIVPAILVHYDKEIWGED  441



>gb|AFB70987.1| secologanin synthase 1, partial [Mitragyna speciosa]
Length=231

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 162/203 (80%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ +H +   + VYVPGWRF+PTK NRRM  I K+V+ SIR II+ R+KAM+  E  +DD
Sbjct  16   EQAVHLLTAIQSVYVPGWRFLPTKMNRRMKQIAKDVQDSIREIINARLKAMKTWEGCDDD  75

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI  +G K+FGM+I +VIEECK+FYFAGQETTSV+L+WTM+LLSR+ DW
Sbjct  76   LLGILLESNSKEIENRGNKDFGMTILEVIEECKLFYFAGQETTSVLLIWTMVLLSRYPDW  135

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQ+FG  +PDF+GLN LK++TMIL+E LRLYPP+  + RR  +ET+LG + L
Sbjct  136  QARAREEVLQLFGTDKPDFDGLNHLKLVTMILHEVLRLYPPLPVLTRRAAKETQLGNLTL  195

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   L+ LP +L+H D EIWG+D
Sbjct  196  PAQVLVSLPAMLLHHDPEIWGDD  218



>emb|CDP14360.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF++    +Y+PGWRF+PTKRNRRM  I K+V+ SIR II+ R+KAM+ GE   DD
Sbjct  121  EQSEHFLKARESIYIPGWRFLPTKRNRRMKQIAKDVQESIREIINARLKAMKEGEACADD  180

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G K+FGM+I++VI+ECK+FYFAGQETTSV+LVWTMILLSR+ +W
Sbjct  181  LLGILLESNSKEIDNHGNKDFGMTIKEVIDECKLFYFAGQETTSVLLVWTMILLSRYPNW  240

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQ FG  +PDFEGLN LK++TMIL+E LRLYPP   + RR   E +LG++ L
Sbjct  241  QARAREEVLQHFGTNKPDFEGLNHLKLVTMILHEVLRLYPPAATIARRAAVEIQLGDLNL  300

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   LL LPT+L+H D EIWG D
Sbjct  301  PAQVLLSLPTILLHHDPEIWGND  323



>ref|XP_009615909.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=436

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +E  R +YVPG RF+PTK N+RM  IEKE++++IR IIDKR++AM+ GETNN+D
Sbjct  149  EQAEYVMEKGRSIYVPGSRFLPTKTNKRMLEIEKEIQTTIRRIIDKRLRAMKAGETNNED  208

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL+EI   G KEFGM+  +VIEECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  209  LLGILLESNLEEIELHGSKEFGMTASEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEW  268

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q  AREEVLQVFG+ +PD EGLN LK++TMILYE+LRL+PP+    RRT EE KLGE+ L
Sbjct  269  QVLAREEVLQVFGNDKPDLEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNL  328

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L++P +L+H D EIWGED
Sbjct  329  PDGVVLLIPAVLVHYDKEIWGED  351



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   282 bits (721),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +E  R +YVPG RF+PTK N+RM  IEKE++++IR IIDKR++AM+ GETNN+D
Sbjct  227  EQAEYVMEKGRSIYVPGSRFLPTKTNKRMLEIEKEIQTTIRRIIDKRLRAMKAGETNNED  286

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL+EI   G KEFGM+  +VIEECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  287  LLGILLESNLEEIELHGSKEFGMTASEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEW  346

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q  AREEVLQVFG+ +PD EGLN LK++TMILYE+LRL+PP+    RRT EE KLGE+ L
Sbjct  347  QVLAREEVLQVFGNDKPDLEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNL  406

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L++P +L+H D EIWGED
Sbjct  407  PDGVVLLIPAVLVHYDKEIWGED  429



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + IE  + +Y+PG RF+PTKRN+RM  IEKE++++IR IIDKR++AM+ G+T+ DD
Sbjct  229  EQAEYVIEKGQSIYIPGSRFLPTKRNKRMLEIEKEIQTTIRCIIDKRLRAMEAGDTSKDD  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL+EI   G K+FGM+I DV++ECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  289  LLGILLESNLKEIELHGKKDFGMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQ+FG+ +PD EGLN LK++TMILYE+LRL+PP+    RRT EE KL E+ L
Sbjct  349  QVRAREEVLQIFGNNKPDLEGLNRLKIVTMILYETLRLFPPLPIFGRRTEEEVKLRELNL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL++PT+L+H D EIWGED
Sbjct  409  PAGVLLIIPTILVHYDKEIWGED  431



>gb|AFB70988.1| secologanin synthase 2, partial [Mitragyna speciosa]
Length=231

 Score =   273 bits (697),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H + V R +Y+PG RF+PTKRNRRM  I+K V+++IR  IDKR+KA+Q GE + DD
Sbjct  16   EQADHIMTVGRSLYIPGMRFLPTKRNRRMKEIDKVVQATIRDTIDKRVKAIQAGEASKDD  75

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG+LLESN +EI Q G K+FGMSI+DVIEECK+FYFAGQETTS +LVWT+ILLS+ QDW
Sbjct  76   LLGLLLESNFKEIEQHGNKDFGMSIKDVIEECKLFYFAGQETTSTLLVWTLILLSKHQDW  135

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q+ AREEVLQVFG  E DF+GL+ LK++TM+L E LRLYPP+  + RR  EETK+G++ L
Sbjct  136  QSCAREEVLQVFGRDEIDFDGLSHLKIVTMVLNEVLRLYPPVVVLARRLNEETKVGKLSL  195

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL L   L+H D E+WG D
Sbjct  196  PAGVLLTLQIQLLHHDFEVWGSD  218



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + I+++R VY+PG RF+PTKRN+RM AIEK+V+++IR IIDKR++AM+ GET+ +D
Sbjct  230  EQAEYVIDITRSVYIPGSRFLPTKRNKRMLAIEKQVQTTIRRIIDKRLRAMEAGETSKND  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G KEFGM+  ++IEECK+FYFAGQE TSV+LVWTMILLS   +W
Sbjct  290  LLGILLESNMKEIEQHGSKEFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+PP+    RR   E KLGE+ L
Sbjct  350  QVRAREEVLQVFGNEKPNLEGLSRLKIMTMILHETLRLFPPVPTYRRRNKHEVKLGELSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL +PT+L+H D E+WGED
Sbjct  410  PSGVLLFIPTVLIHYDKELWGED  432



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +++SR +Y+PG RF+PTKRN+RM  IEK+++++IR IIDKR++AM+ GET+ DD
Sbjct  230  EQAEHIMDISRSIYIPGSRFLPTKRNKRMLEIEKQIQTTIRHIIDKRLRAMEAGETSKDD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FG++  +VIEECK+FYFAGQETTSV+LVWTM+LL    +W
Sbjct  290  LLGILLESNMKEIEQHGNKDFGLTTTEVIEECKLFYFAGQETTSVLLVWTMVLLCLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+++PD EGL+ LK++TMILYE+LRL+PP+    RR  EE KLGE+ L
Sbjct  350  QVRAREEVLQVFGNEKPDLEGLSHLKIVTMILYETLRLFPPLPVFSRRNKEEVKLGELQL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   +L++P + +H D EIWGED
Sbjct  410  PAEVILIIPAIFIHYDKEIWGED  432



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H I+ S+ +Y+PGWRFVPTKRN+RM  IEKEV+SSIR II +R+KAM+ GE +++D
Sbjct  229  EQAEHVIKASQSIYIPGWRFVPTKRNKRMKEIEKEVQSSIRSIISRRIKAMKAGEASSED  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN QEI+Q G K FGM+I++V+EECK+FYFAGQETTSV+LVWT+ILLSRF DW
Sbjct  289  LLGILLESNFQEIKQHGNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWTLILLSRFPDW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG Q PDF+ LN LK++TMIL E LRLYPP+ G+ R+  EETKLG++ L
Sbjct  349  QKRAREEVLQVFGSQTPDFDSLNHLKIVTMILNEVLRLYPPVVGLGRKVTEETKLGKLTL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  + LP +L+H   EIWG+D
Sbjct  409  PAGVQISLPIILLHHSREIWGDD  431



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +EV R VY+PG RF+PTKRNRRM  I+K+V++SI+GIIDKR+KAM+ G+TNN+D
Sbjct  226  EQAQYLVEVFRSVYIPGRRFLPTKRNRRMKEIKKDVRASIKGIIDKRLKAMKAGDTNNED  285

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV+L+W+++LLSR+QDW
Sbjct  286  LLGILLESNIKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDW  345

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREE+LQVFG ++PDF+GLN LK++TMILYESLRLYP +  + RR  E+  LGE+ L
Sbjct  346  QARAREEILQVFGSRKPDFDGLNHLKIVTMILYESLRLYPSLITLTRRCNEDIVLGELSL  405

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D EIWGED
Sbjct  406  PAGVLVSLPLILLHHDEEIWGED  428



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +EV R VY+PG RF+PTKRNRRM  I+K+V++SI+GIIDKR+KAM+ G+TNN+D
Sbjct  232  EQAQYLVEVFRSVYIPGRRFLPTKRNRRMKEIKKDVRASIKGIIDKRLKAMKAGDTNNED  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV+L+W+++LLSR+QDW
Sbjct  292  LLGILLESNIKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREE+LQVFG ++PDF+GLN LK++TMILYESLRLYP +  + RR  E+  LGE+ L
Sbjct  352  QARAREEILQVFGSRKPDFDGLNHLKIVTMILYESLRLYPSLITLTRRCNEDIVLGELSL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D EIWGED
Sbjct  412  PAGVLVSLPLILLHHDEEIWGED  434



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +E+SR +Y+PG RF+PTKRN+RM  IEK+V+++IR IIDKR++AM+ GET+ +D
Sbjct  230  EQAEHVMEISRTIYIPGSRFLPTKRNKRMLEIEKQVQTTIRHIIDKRLRAMEAGETSKND  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGM+  +VI+ECK FYFAGQETT+V+LVWTMILL    +W
Sbjct  290  LLGILLESNMKEIEQHGSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREE LQVFG+++P+ EGL+ LK++T+IL+E+LRL+PP+    RR   E KLGE+ L
Sbjct  350  QARAREEALQVFGNEKPNLEGLSRLKIVTIILHETLRLFPPVATYRRRNKHEVKLGELSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL +PT+L+H D E+WGED
Sbjct  410  PAGVLLFIPTVLIHYDKELWGED  432



>ref|XP_006348301.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=350

 Score =   274 bits (701),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H+I+ +R V +PGWRF+PTKR+RRM  I+ EV++SI+GIIDKRMKAM+ G+ +N+D
Sbjct  63   EQAKHYIDAARSVNIPGWRFLPTKRSRRMKEIKNEVRTSIKGIIDKRMKAMKAGDADNED  122

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K FGMSIE+VIEECK+FY AGQETTSV+LVWT++LLSR+QDW
Sbjct  123  LLGILLESNFKEIEQHGNKNFGMSIEEVIEECKLFYLAGQETTSVLLVWTLVLLSRYQDW  182

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q +AREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY P+   +R   E+  LGE+ L
Sbjct  183  QTQAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPLITHNREVTEDIVLGELSL  242

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP  L+H D +IWGED
Sbjct  243  PAGVLVSLPDSLLHHDKDIWGED  265



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF++    VY+PGWRF+PTK NRRM  I K+V+ SIR II+ R+KAM+ GE   DD
Sbjct  231  EQAEHFLKAVESVYIPGWRFLPTKLNRRMKQIAKDVQESIREIINARLKAMKEGEACADD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G K+FGM+I DVIEECK+FYFAGQETTSVMLVWTM+LLSR  +W
Sbjct  291  LLGILLESNSKEIDDHGNKDFGMTIGDVIEECKLFYFAGQETTSVMLVWTMVLLSRHPNW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQ FG+ +PDF+GLN LK++TMIL+E LRLYPP+  + RRT E+ +LG + L
Sbjct  351  QARAREEVLQHFGNNKPDFKGLNHLKLVTMILHEVLRLYPPVPAIPRRTDEDIQLGNLTL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P    + LP +L+H D EIWG+D
Sbjct  411  PAQVQVSLPAILLHYDPEIWGDD  433



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  +FI+  R+VYVPG RF+PTKRNRRM  I+ EV++S++GIIDKRMKAM+ G  +N+D
Sbjct  231  EQAQNFIDAVREVYVPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNED  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV+LVWT++LLSR QDW
Sbjct  291  LLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRNQDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q +AREEVLQVFG ++PDF+GLN LKV+TMILYESLRLYPP+  ++R+  E+  LGE+ L
Sbjct  351  QTQAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELSL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ LP +L+H D E+WGED
Sbjct  411  PAGVLVSLPVILLHHDEEVWGED  433



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +E+ R +Y+PG RF+PTKRN+RM  IEK+V+++I+ IIDKR+KAM+ GET+ DD
Sbjct  238  EQAEYVMEIGRSIYIPGSRFLPTKRNKRMLEIEKQVQTTIKRIIDKRLKAMEEGETSKDD  297

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL+EI   G KEFG++  +VIEECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  298  LLGILLESNLKEIELHGRKEFGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEW  357

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+ +PD EGL+ LK++TMILYE+LRL+PP+    RR  EE KLG++ L
Sbjct  358  QVRAREEVLQVFGNDKPDLEGLSRLKIVTMILYETLRLFPPLPAFGRRNKEEVKLGKLHL  417

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL++P +L+H D EIWGED
Sbjct  418  PAGVLLIIPAILVHYDKEIWGED  440



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + I+++R VY+PG RF+PTK+N+RM  IEK+V+++IR IIDKR++AM+ GE + +D
Sbjct  230  EQAEYVIDITRSVYIPGSRFLPTKKNKRMLEIEKQVQTTIRRIIDKRLRAMEAGEPSKND  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGM+  ++IEECK+FYFAGQE TSV+LVWTMILLS   +W
Sbjct  290  LLGILLESNMKEIEQHGSKDFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSVHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+PP+    RR + E KLGE+ L
Sbjct  350  QVRAREEVLQVFGNEKPNLEGLSRLKIVTMILHETLRLFPPVPTYRRRNIHEVKLGELSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL +PT+L+H D E+WGED
Sbjct  410  PAGVLLFIPTVLIHYDKELWGED  432



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYV--PGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  174
            EQ  H ++++R VY+  PG+RF+PTKRNRRM  I +EV  S+R +I+ R KAM+ GE  +
Sbjct  234  EQTEHLMQLARSVYINIPGFRFLPTKRNRRMKQIAREVNGSVREMINTRRKAMRAGEAGS  293

Query  175  DDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            DDLLG++L+SN QEI + G K+ GM+ E++++ECK+FYFAGQETTS +LVWTM+LL R+ 
Sbjct  294  DDLLGLMLQSNSQEIEKHGNKDSGMTTEEIVDECKLFYFAGQETTSALLVWTMVLLCRYP  353

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQARAREEVLQ FG ++PDF+GLN LK++TMIL+E LRLYPP+  M RRT+EETKLG +
Sbjct  354  EWQARAREEVLQQFGTKDPDFDGLNHLKIVTMILHEVLRLYPPVATMSRRTIEETKLGNL  413

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP G  L LP LLMH D +IWGED
Sbjct  414  TLPAGVQLTLPILLMHHDPDIWGED  438



>ref|XP_006598138.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Glycine 
max]
 ref|XP_006598139.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X3 [Glycine 
max]
 ref|XP_006598140.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X4 [Glycine 
max]
Length=419

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 165/206 (80%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H ++V  ++ +PGWRF+PTK +RRM  I++E+K+S++ +I+KR KA++ GE   +D
Sbjct  127  EQTEHLMKVILKIQIPGWRFLPTKTHRRMKEIDREIKASLKNMINKREKALKSGEATKND  186

Query  181  LLGILLESNLQEIRQQG---GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  351
            LLGILLESN +EI++ G    K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+
Sbjct  187  LLGILLESNHKEIQEHGNRNSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRY  246

Query  352  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  531
             DWQARAREE  QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM+R   ++ KLG 
Sbjct  247  PDWQARAREEAFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGN  306

Query  532  IVLPRGALLMLPTLLMHVDSEIWGED  609
            + LP G  + LPT+L+H DSE+WGED
Sbjct  307  LTLPAGVQVFLPTVLIHHDSELWGED  332



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +++ R +Y+PG RF+PTKRN+RM  IEK+V+++IR IIDKR+KAM+ GET+ DD
Sbjct  229  EQAEYVMDIGRSIYIPGSRFLPTKRNKRMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDD  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL+EI   G  +FG++  +VIEECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  289  LLGILLESNLKEIELHGRNDFGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAR+EVLQ+FG+ +PD EGL+ LK++TMILYE+LRL+PP+    RR  EE KLGE+ L
Sbjct  349  QVRARKEVLQIFGNDKPDLEGLSRLKIVTMILYETLRLFPPLPAFGRRNKEEVKLGELHL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL++P +L+H D EIWGED
Sbjct  409  PAGVLLVIPAILVHYDKEIWGED  431



>gb|EYU44092.1| hypothetical protein MIMGU_mgv1a0044501mg, partial [Erythranthe 
guttata]
Length=390

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NND  177
            EQ  + I+  + +Y+PGWRFVPTKRN RM  IEKE++SSIRG+IDKR+K M+ GE  NN+
Sbjct  102  EQAEYIIKALQTIYIPGWRFVPTKRNNRMKEIEKEIQSSIRGMIDKRVKVMKAGEAGNNE  161

Query  178  DLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            DLLGILLESN  EI Q G K FGM+ ++V+EECK+FY AGQETTS ++VWT++LLS++ +
Sbjct  162  DLLGILLESNFNEIEQYGNKSFGMTTDEVVEECKLFYLAGQETTSALIVWTLVLLSQYPE  221

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQ FG+Q P+F+GLN LK++ MIL E LRLYPP+  + RR  EETKLG + 
Sbjct  222  WQMKAREEVLQNFGNQTPEFDGLNHLKIVNMILNEVLRLYPPVAALGRRVTEETKLGRLT  281

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP + +H + +IWGED
Sbjct  282  LPAGVDVSLPIMFLHHNRDIWGED  305



>emb|CDP19603.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 161/205 (79%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYV--PGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  174
            EQ  H ++ +R VY+  PG+RF+PTKR+RRM  I +EV  S+R +I+ R KAM+ GE  +
Sbjct  121  EQTEHLMQAARSVYINIPGFRFLPTKRSRRMKQIAREVNGSVREMINTRRKAMRAGEAGS  180

Query  175  DDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            DDLLG++L+SN QEI + G K+FGM+ E++++ECK+FY AGQETTS +LVWTM+LL R+ 
Sbjct  181  DDLLGLMLQSNSQEIEKHGNKDFGMTTEEIVDECKLFYLAGQETTSALLVWTMVLLCRYP  240

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQARAREEVLQ FG ++PDFEGLN LK++TMIL+E LRLYPP+  M RRT +ETKLG +
Sbjct  241  EWQARAREEVLQQFGAKDPDFEGLNHLKIVTMILHEVLRLYPPVAIMSRRTTQETKLGNL  300

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP G  + LP +LMH D +IWGED
Sbjct  301  TLPAGVQITLPIMLMHHDLDIWGED  325



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   274 bits (701),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 171/204 (84%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NND  177
            EQ  +FI+  R+VY+PG RF+PTKRNRRM  I+ EV++S++GIIDKRMKAM+ G   NN+
Sbjct  231  EQAQNFIDAVREVYIPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNNE  290

Query  178  DLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            DLLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV+LVWT++LLSR+QD
Sbjct  291  DLLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRYQD  350

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVF  ++PDF+GLN LKV+TMILYESLRLYPP+  ++R+  E+  LGE+ 
Sbjct  351  WQTQAREEVLQVFESRKPDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELC  410

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G L+ LP +L+H D +IWGED
Sbjct  411  LPAGVLVSLPMILLHHDKDIWGED  434



>emb|CDP14358.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  HF++    +YVPGWRF+PTKRNRRM  I K+V+ SIR II  R+KAM+ GE   DD
Sbjct  91   EQSEHFLKARESIYVPGWRFLPTKRNRRMKQIAKDVQESIREIITTRLKAMKEGEACADD  150

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGIL ESN +EI   G K+FGM+I++VI+ECK+FYFAGQETTS++LVWTMILLSR+  W
Sbjct  151  LLGILPESNSKEIDNHGNKDFGMTIKEVIDECKLFYFAGQETTSLLLVWTMILLSRYPYW  210

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQ FG  + DFEGLN LK++TMIL+E LRLYPP   + RR   E +LG + L
Sbjct  211  QARAREEVLQHFGTNKLDFEGLNRLKLVTMILHEVLRLYPPAATIARRAAVEIQLGNLTL  270

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   LL LPT+L+H D EIWG D
Sbjct  271  PAQVLLSLPTILLHHDPEIWGND  293



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 163/203 (80%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +++ R +Y+PG RF+PTKRN+RM  IEK+V+++IR IIDKR+KAM+ GET+ DD
Sbjct  229  EQAEYVMDIGRSIYIPGSRFLPTKRNKRMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDD  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL+EI   G  + G++  +VIEECK+FYFAGQETTSV+LVWTMILL    +W
Sbjct  289  LLGILLESNLKEIELHGRNDLGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAR+EVLQ+FG+ +PD EGL+ LK++TMILYE+LRL+PP+    RR  EE KLGE+ L
Sbjct  349  QVRARKEVLQIFGNDKPDLEGLSRLKIVTMILYETLRLFPPLPAFGRRNKEEVKLGELHL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL++P +L+H D EIWGED
Sbjct  409  PAGVLLVIPAILVHYDKEIWGED  431



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 165/206 (80%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H ++V  ++ +PGWRF+PTK +RRM  I++E+K+S++ +I+KR KA++ GE   +D
Sbjct  228  EQTEHLMKVILKIQIPGWRFLPTKTHRRMKEIDREIKASLKNMINKREKALKSGEATKND  287

Query  181  LLGILLESNLQEIRQQG---GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  351
            LLGILLESN +EI++ G    K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+
Sbjct  288  LLGILLESNHKEIQEHGNRNSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRY  347

Query  352  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  531
             DWQARAREE  QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM+R   ++ KLG 
Sbjct  348  PDWQARAREEAFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGN  407

Query  532  IVLPRGALLMLPTLLMHVDSEIWGED  609
            + LP G  + LPT+L+H DSE+WGED
Sbjct  408  LTLPAGVQVFLPTVLIHHDSELWGED  433



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + I + R VY+PG RF+PTKRN+RM  IEK+V+++IR IIDKR++AM+ GET+ DD
Sbjct  230  EQAEYVINIIRSVYIPGTRFLPTKRNKRMLEIEKQVQTTIRRIIDKRLRAMEAGETSKDD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q   K+FG++  ++IEECK+FYFAGQET SV+LVWTMILLS   +W
Sbjct  290  LLGILLESNMREIEQHRSKDFGITTIEMIEECKLFYFAGQETASVLLVWTMILLSLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+P +    RR   E KLGE+ L
Sbjct  350  QARAREEVLQVFGNEKPNSEGLSHLKIMTMILHETLRLFPSVPTYRRRNKHEVKLGELSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL++PT+L+H D E+WGED
Sbjct  410  PAGVLLIIPTILIHYDKELWGED  432



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +  +R  YVPGWRFVPTKRN+RM  I KEV+S +  +I+ R+KAM+ GE  NDD
Sbjct  228  EQAELILLAARSPYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDD  287

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LL ILLESN +EI+Q G K+FGM++++VIEECK+FYFAGQETTS +LVWT+ILLS+ QDW
Sbjct  288  LLDILLESNFKEIQQHGDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDW  347

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAR+EV QVFG ++P+FE LN LKV+TMIL E LRLYPP   + R T E TKLGE+ L
Sbjct  348  QDRARDEVQQVFGSKKPEFEDLNHLKVITMILNEVLRLYPPGVMLGRMTTETTKLGELTL  407

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+LP +L+H DS+IWG+D
Sbjct  408  PAGVQLLLPAILLHHDSKIWGDD  430



>ref|XP_006362153.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=392

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 161/203 (79%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + I ++  +++PG RF+PTK NRRM  IEKE++++IR IIDKR+ AMQ GETNN+D
Sbjct  105  EQAEYVIRIACSIHIPGSRFLPTKMNRRMLKIEKEIQTTIRRIIDKRLMAMQAGETNNED  164

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FG++  +VIEECK+FYFAGQ+TTSV+LVWT ILL    +W
Sbjct  165  LLGILLESNTKEIEQHGSKDFGLTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEW  224

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVL VFG+++PDFEGL+ LK++TMILYE+LRL+PP     RR  +E KLGE+ L
Sbjct  225  QVRAREEVLNVFGNEKPDFEGLSRLKIVTMILYETLRLFPPAPIYGRRNKDEVKLGELSL  284

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   LL++P +L+H + E+WGED
Sbjct  285  PAEVLLVIPAILVHYNKELWGED  307



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  +  +++R +Y+PG RF+PTKR +RM  IEK+V+++I+ IIDKR++AM+ GET+ +D
Sbjct  230  EQAEYVTDINRSIYIPGSRFLPTKRYKRMLEIEKQVQTTIKRIIDKRLRAMEAGETSKND  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGM+  +VI+ECK FYFAGQETT+V+LVWTMILL    +W
Sbjct  290  LLGILLESNMKEIEQHGSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREE LQVFG+++P+ EGL+ LK++TMIL+E+LRL+PP+    RR   E KLGE+ L
Sbjct  350  QARAREEALQVFGNEKPNLEGLSRLKIVTMILHETLRLFPPVPTYRRRNKHEVKLGELSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL++P +L+H D E+WGED
Sbjct  410  PAGVLLVIPAILIHYDKELWGED  432



>ref|XP_009796906.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=446

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  +  E  R +YVP  RF+PTK N+RM  IEKE++++IR IIDKR++ M+ GE NN+D
Sbjct  159  EQVEYVTEKGRSIYVPRSRFLPTKTNKRMLEIEKEIQTTIRRIIDKRLRVMKAGEKNNED  218

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL+EI   G KEFGM+  +VIEECK+FYFAGQE TSV+LVWTMILL    +W
Sbjct  219  LLGILLESNLEEIELHGSKEFGMTTSEVIEECKLFYFAGQEITSVLLVWTMILLCLHPEW  278

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVF  ++PDFEGLN LK++TMILYE+LRL+PP+    RRT EE KLGE+ L
Sbjct  279  QVRAREEVLQVFRIEKPDFEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNL  338

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G ++++P + +H D EIW ED
Sbjct  339  PDGVVVLIPAVFVHYDKEIWSED  361



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +  +R  YVPGWRFVPTKRN+RM  I KEV+S +  +I+ R+KAM+ GE  NDD
Sbjct  228  EQAELILLAARSPYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDD  287

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LL ILLESN +EI++   K+FGM++++VIEECK+FYFAGQETTS +LVWT+ILLS+ QDW
Sbjct  288  LLAILLESNFKEIQEHEDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDW  347

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAR+EV QVFG ++P+FE LN LKV+TMIL E LRLYPP+  + R T E TKLGE+ L
Sbjct  348  QDRARDEVQQVFGSKKPEFEDLNHLKVITMILNEVLRLYPPVVMLGRMTPETTKLGELTL  407

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+LP +L+H DS+IWG+D
Sbjct  408  PAGVQLLLPAILLHHDSKIWGDD  430



>ref|XP_010324391.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Solanum 
lycopersicum]
Length=472

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG-ETNND  177
            EQ  HFI+  R V +P WRF+PTKRNRRM  I+ EV++S++GIIDKRMKAM+ G + +N+
Sbjct  184  EQAQHFIDTVRSVNIPRWRFLPTKRNRRMKEIKNEVRTSMKGIIDKRMKAMKAGHDADNE  243

Query  178  DLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            DLLG+LLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQET +V+LVWT++LLSR+QD
Sbjct  244  DLLGVLLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETIAVLLVWTLVLLSRYQD  303

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY P+   +R+  E+T L E+ 
Sbjct  304  WQTQAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPLFTHNRQASEDTVLVELC  363

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP   L+ LPT+++H D +IWGED
Sbjct  364  LPADVLVSLPTIILHHDKDIWGED  387



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 164/206 (80%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V  ++ +PGWRF+PTK +RRM  I++E+K+S++ +I+KR KA++ GE   +D
Sbjct  228  EQTELLMKVILKIQIPGWRFLPTKTHRRMKEIDREIKASLKNMINKREKALKSGEATKND  287

Query  181  LLGILLESNLQEIRQQG---GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  351
            LLGILLESN +EI++ G    K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+
Sbjct  288  LLGILLESNHKEIQEHGNRNSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRY  347

Query  352  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  531
             DWQARAREE  QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM+R   ++ KLG 
Sbjct  348  PDWQARAREEAFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGN  407

Query  532  IVLPRGALLMLPTLLMHVDSEIWGED  609
            + LP G  + LPT+L+H DSE+WGED
Sbjct  408  LTLPAGVQVFLPTVLIHHDSELWGED  433



>emb|CDP15980.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H ++    +++PGWRF+PTKRNRRM  IEKEV  SIR I++ R+KAM+ GE+ +DD
Sbjct  230  EQLEHCVKAVWSMFIPGWRFLPTKRNRRMRQIEKEVDDSIRRIVNSRLKAMRAGESCDDD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
             LG LLESN QEI + G K  GMS ++V+EECK+FYFAGQETTSV+L+WTMILLSR+Q+W
Sbjct  290  FLGRLLESNSQEIHKHGSKGVGMSTQEVVEECKLFYFAGQETTSVLLLWTMILLSRYQNW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQ+FG  +PD++GLN LKV+TMILYE LRLYPP+    RRT EE +LG + +
Sbjct  350  QKRAREEVLQLFGTNKPDYDGLNRLKVVTMILYEVLRLYPPLPVNSRRTAEEARLGNLSI  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L++    L+H D E+WG+D
Sbjct  410  PAGILILKHIALIHHDPELWGDD  432



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEV--SRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  174
            EQ  H +E   S  +Y+PG+RF+PTKR+RRM  I KEV  SIR +ID R KAM+ GE   
Sbjct  232  EQAEHIVEAGGSVYIYIPGFRFLPTKRHRRMKQITKEVNDSIREMIDTRKKAMRAGEART  291

Query  175  DDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            D+LLG++L+SN QEI + G K++GM+ E++I+ECK+FY AGQETTS +LVWTMI LSR+ 
Sbjct  292  DNLLGLMLQSNSQEIEKHGNKDYGMTTEEIIDECKLFYLAGQETTSALLVWTMIYLSRYP  351

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            DWQARAREEVLQ FG  +P+F+GLN LK++ MIL+E LRL PPIT   RR  EETKLG +
Sbjct  352  DWQARAREEVLQHFGANDPEFDGLNQLKIVNMILHEVLRLCPPITATARRIAEETKLGNL  411

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             +P G LL+LP +LMH D +IWGED
Sbjct  412  TIPVGVLLVLPIMLMHHDPDIWGED  436



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG-ETNND  177
            EQ  HFI+  R V +P WRF+PTKRNRRM  I+ EV++S++GIIDKRMKAM+ G + +N+
Sbjct  225  EQAQHFIDTVRSVNIPRWRFLPTKRNRRMKEIKNEVRTSMKGIIDKRMKAMKAGHDADNE  284

Query  178  DLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            DLLG+LLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQET +V+LVWT++LLSR+QD
Sbjct  285  DLLGVLLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETIAVLLVWTLVLLSRYQD  344

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY P+   +R+  E+T L E+ 
Sbjct  345  WQTQAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPLFTHNRQASEDTVLVELC  404

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP   L+ LPT+++H D +IWGED
Sbjct  405  LPADVLVSLPTIILHHDKDIWGED  428



>emb|CDP11335.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + ++  + VY PGWRF+PTKRNRRM  I K+V  SIR II+ R++AM+ G+   DD
Sbjct  238  EQAQYHLKAVQSVYFPGWRFLPTKRNRRMKQIAKDVHESIRKIINARLEAMEAGDACADD  297

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LL ILLESN +EI   G K FGMSI +VIEECK+FYFAGQETTSV+LVWTMILLSR+ +W
Sbjct  298  LLSILLESNSKEIDYHGNKGFGMSIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPNW  357

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQ FG  +PD +GLN LK++TMIL+E LRLYPP+  + R+  EET+LG + L
Sbjct  358  QARAREEVLQHFGTNKPDLDGLNHLKLVTMILHEVLRLYPPVPELARKAAEETQLGNLTL  417

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P    + LP +L+H   EIWG+D
Sbjct  418  PSQVQVSLPAMLLHYAPEIWGDD  440



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++    +Y+PG RF+PTK N++M   EKEV+ SIR +ID R+KA + G+   DD
Sbjct  231  EQAEIIMKQFNSIYIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG LLESN  EI +QG KEFG++I++VI ECK+FYFAGQETTSV LVWTMILLSR QDW
Sbjct  291  LLGTLLESNSNEIEEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QA+AREEVLQ FG  +P F+ L+ LK++TMILYESLRLYPP+    RRT EET+LG + L
Sbjct  351  QAKAREEVLQAFGSDQPAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETRLGNLYL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G+L+ +PT+L+H D EIWGED
Sbjct  411  PNGSLIFIPTILLHHDKEIWGED  433



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ +R +Y+PGWRFVPTKRN+RM  I KEV+S + GII+KR++ M+ GE   DD
Sbjct  230  EQAELILQAARWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI+  G K FGM+I++VIEECK+FYFAGQETTSV+LVWT+ILLS+  DW
Sbjct  290  LLGILLESNFKEIQMHGNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEV QVFG  +PD++ LN LKV+TMI  E LRLYPP   + R   E+TKLG + L
Sbjct  350  QERAREEVHQVFGSNKPDYDALNQLKVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+LP + +H D+EIWG+D
Sbjct  410  PAGIQLVLPAIWLHHDNEIWGDD  432



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ +R +Y+PGWRFVPTKRN+RM  I KEV+S + GII+KR++ M+ GE   DD
Sbjct  230  EQAELILQAARWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI+  G K FGM+I++VIEECK+FYFAGQETTSV+LVWT+ILLS+  DW
Sbjct  290  LLGILLESNFKEIQMHGNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEV QVFG  +PD++ LN LKV+TMI  E LRLYPP   + R   E+TKLG + L
Sbjct  350  QERAREEVHQVFGSNKPDYDALNQLKVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+LP + +H D+EIWG+D
Sbjct  410  PAGIQLVLPAIWLHHDNEIWGDD  432



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++    +Y+PG RF+PTK N++M   EKEV+ SIR +ID R+KA + G+   DD
Sbjct  231  EQAEIIMKQFNSIYIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG LLESN  EI +QG KEFG++I++VI ECK+FYFAGQETTSV LVWTMILLSR Q+W
Sbjct  291  LLGTLLESNSNEIEEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQNW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QA+AREEVLQ FG  +P F+ L+ LK++TMILYESLRLYPP+    RRT EETKLG + L
Sbjct  351  QAKAREEVLQAFGSDQPAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETKLGNMYL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G+LL +PT+L+H D EIWGED
Sbjct  411  PNGSLLFIPTILLHHDKEIWGED  433



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 162/203 (80%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            E   H IE +R +Y+PG RF+PTK+NRRM  I+K+V++ IRGIIDKR+KA++ GE N DD
Sbjct  231  ELAQHVIEATRTLYIPGSRFLPTKKNRRMKEIDKKVQAMIRGIIDKRVKALKAGEANTDD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG+LLESN ++I Q G K+FGM+  ++IEECK+FYFAGQETTSV+L W MILLS+  DW
Sbjct  291  LLGMLLESNFKQIEQHGNKDFGMTTREIIEECKLFYFAGQETTSVLLGWAMILLSKHPDW  350

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QA AREEVLQVFGD + +F+GLN LK++TMIL E+LRLYPP+    R+T   TKLGE+ L
Sbjct  351  QAHAREEVLQVFGDGKLEFDGLNRLKIVTMILNETLRLYPPVDATSRKTTTNTKLGELSL  410

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L+LP +L+H D EIWGED
Sbjct  411  PAGVMLLLPIILLHHDKEIWGED  433



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++V R V++PGWRF+PTKRNRRM  I+KE+++S+ GII  R KAM+ GE  NDDLLGIL+
Sbjct  235  MQVFRSVHIPGWRFLPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAGEAANDDLLGILM  294

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            E++ +EI + G  K  G S+ DVIEECK+FYFAGQETTSV+L WTM+LLS+ QDWQ RAR
Sbjct  295  ETSFREIEEHGNNKNVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERAR  354

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            +EVLQVFG+ +PD++GLN LK++ MILYE LRLYPP+T + R   +ETKLG + LP G  
Sbjct  355  QEVLQVFGNNKPDYDGLNHLKIVQMILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQ  414

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP +L+H D E+WG+D
Sbjct  415  IGLPMILVHQDPELWGDD  432



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 162/203 (80%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + I++ R VY+PG RF+PTKRN+RM  IE +V+++IR IIDKR++AM+ GE +  D
Sbjct  230  EQAEYVIDIIRSVYIPGTRFLPTKRNKRMLEIENKVQTTIRSIIDKRLRAMEAGEASKTD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI+Q    +FG++  ++IEECK+FYFAGQETTSV+L WTMILLS   +W
Sbjct  290  LLGILLESNMREIKQHRSNDFGITTAEMIEECKLFYFAGQETTSVLLAWTMILLSLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+P +    RR   E KLGE+ L
Sbjct  350  QARAREEVLQVFGNEKPNSEGLSRLKIVTMILHETLRLFPSVPTYRRRNKHEVKLGELSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L++PT+L+H D E+WGED
Sbjct  410  PAGVQLIIPTILIHYDKELWGED  432



>gb|AFS28689.1| putative secologanin synthase, partial [Olea europaea]
Length=302

 Score =   257 bits (657),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++    VYVPGWRF PTKRN+RM  I KEV+SS+  II KR+KAM+ GE ++DD
Sbjct  82   EQAELVVQGRNSVYVPGWRFFPTKRNKRMRRIAKEVESSVMRIIQKRIKAMEAGEASSDD  141

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN  EI QQ G++ GMS+++VIEECK+FYFAGQETTS +LVWT+ILLS+  DW
Sbjct  142  LLGILLESNFTEI-QQHGRKSGMSLKEVIEECKLFYFAGQETTSSLLVWTLILLSKHLDW  200

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q+RAREEVLQVF   +P+F+ LN LK++TMI +E LRLYPP T + R   +ET +G++ L
Sbjct  201  QSRAREEVLQVFRSGKPNFDQLNRLKIVTMIFHEVLRLYPPATLLSRMIYKETTIGKLXL  260

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L++P LL+H DS+IWG+D
Sbjct  261  PAGVQLIMPALLLHHDSKIWGDD  283



>gb|AFS28688.1| putative secologanin synthase, partial [Olea europaea]
Length=302

 Score =   257 bits (657),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++    VYVPGWRF PTKRN+RM  I KEV+SS+  II KR+KAM+ GE ++DD
Sbjct  82   EQAELVVQGRNSVYVPGWRFFPTKRNKRMRRIAKEVESSVMXIIQKRIKAMEAGEASSDD  141

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN  EI QQ G++ GMS+++VIEECK+FYFAGQETTS +LVWT+ILLS+  DW
Sbjct  142  LLGILLESNFTEI-QQHGRKSGMSLKEVIEECKLFYFAGQETTSSLLVWTLILLSKHLDW  200

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q+RAREEVLQVF   +P+F+ LN LK++TMI +E LRLYPP T + R   +ET +G++ L
Sbjct  201  QSRAREEVLQVFRSGKPNFDQLNRLKIVTMIFHEVLRLYPPATLLSRMIYKETTIGKLXL  260

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L++P L +H DS+IWG+D
Sbjct  261  PAGVQLIMPALJLHHDSKIWGDD  283



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ +R +Y+PGWRFVPTKRN+RM  I KEV+S + GII+KR++ M+ GE   DD
Sbjct  229  EQAELILQAARWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDD  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI+    K FGM+I++VIEECK+FYFAGQETTSV+LVWT+ILLS+  DW
Sbjct  289  LLGILLESNFKEIQMHRNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEV QVFG  +PD+E L  LKV+TMI  E LRLYPP   + R   EETKLG + L
Sbjct  349  QERAREEVRQVFGSNKPDYETLKQLKVVTMIFNEVLRLYPPGIMIGRTVHEETKLGNLSL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LLMLP + +H D+EIWG+D
Sbjct  409  PAGMLLMLPAIWLHHDNEIWGDD  431



>gb|AGX93056.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Lonicera japonica]
Length=519

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V + VY+PGWRF+PTKRN R+  I+K+V+ SI  II+ +MKAM+ GE+++ D LGILL
Sbjct  238  IQVIQSVYIPGWRFMPTKRNNRIKKIDKDVRVSITEIINNKMKAMKAGESSSSDFLGILL  297

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            E N+ EI Q   K  G+SIE++I ECK+FYFAGQ+TTS +L WTM++LSRF DWQARARE
Sbjct  298  ECNMTEIEQTKNKNAGLSIEEIIGECKLFYFAGQDTTSTLLCWTMVILSRFPDWQARARE  357

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EVLQVFGD +PD++G+N LK +TMILYE LRLYPP+  + +   E+TKLG++ +P G  +
Sbjct  358  EVLQVFGDGKPDYDGINRLKTVTMILYEVLRLYPPVVELTKVAHEDTKLGDLTIPAGVQV  417

Query  559  MLPTLLMHVDSEIWGED  609
            MLPT+L+H + +IWGED
Sbjct  418  MLPTILLHHNPDIWGED  434



>emb|CBI39912.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+  VY+PGWRF+PTK NRRM  I KEV + +RGII+KR KAM+ GET N D
Sbjct  150  EQTHLAIQVTMSVYIPGWRFLPTKTNRRMKQISKEVYALLRGIINKREKAMKAGETANSD  209

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI++ Q  K+  MS++DVIEECK+FY AGQETTSV+LVWTM+LLS   +
Sbjct  210  LLGILMESNFREIQEHQNNKKIRMSVKDVIEECKLFYLAGQETTSVLLVWTMVLLSEHPN  269

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++P+  GLN LK++TMI +E LRLYPP+  + R   ++T++G++ 
Sbjct  270  WQARAREEVLQVFGNKKPEAAGLNHLKIVTMIFHEVLRLYPPVAMLARAVYKDTQVGDMC  329

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P G  ++LPT+L+H D EIWG+D
Sbjct  330  FPAGVQVVLPTILVHHDHEIWGDD  353



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  ++++V + V +PGWRFVPTKRNRRM  I K V+ +I  II+ R+KA++ G+   DD
Sbjct  229  EQSEYWLKVVQSVDIPGWRFVPTKRNRRMKQIAKAVQDTILEIINSRIKAVREGKAYGDD  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI   G    GM+I +VIEECK+FYFAGQETTSV+LVWTMILLSR+ DW
Sbjct  289  LLGILLESNFKEINNHGQDGAGMTIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPDW  348

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVLQ+FG ++PDF+GLN L ++TMIL+E LRLY P+  + RR  EETKLG + L
Sbjct  349  QARAREEVLQLFGTRKPDFDGLNRLNLVTMILHEVLRLYAPVPALSRRVAEETKLGSMRL  408

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   LL LP +++H D+EIWG+D
Sbjct  409  PADVLLSLPVMVLHHDTEIWGDD  431



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++V R V++PGWRF+PTKRNRRM  I+KE+++S+ GII  R KAM+ GE  N+DLLGIL+
Sbjct  235  MQVFRSVHIPGWRFLPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAGEAANNDLLGILM  294

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            E++ +EI + G  K  G S+ DVIEECK+FYFAGQETTSV+L WTM+LLS+ QDWQ RAR
Sbjct  295  ETSFREIEEHGNNKNVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERAR  354

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            +EVLQVFG+ +PD++GLN LK++ MILYE LRLYPP+T + R   +ETKLG + LP G  
Sbjct  355  QEVLQVFGNNKPDYDGLNHLKIVQMILYEVLRLYPPVTVLSRAVFKETKLGNLTLPAGVQ  414

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP +L+H D E+WG+D
Sbjct  415  IGLPMILVHQDPELWGDD  432



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 162/206 (79%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V  ++ +PGWRF+PT  +RRM  I++++K+S++ +I+KR KA++ GE   +D
Sbjct  228  EQAELLIKVLLKIQIPGWRFLPTNTHRRMKEIDRDIKASLKDMINKREKALKAGEATKND  287

Query  181  LLGILLESNLQEIRQQGG---KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  351
            LLGILLESN +EI++ G    K  GMS+E+VIEECK+FYFAGQETTSV+LVWTM+LLSR+
Sbjct  288  LLGILLESNHKEIQEHGNRNNKNVGMSLEEVIEECKLFYFAGQETTSVLLVWTMVLLSRY  347

Query  352  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  531
             DWQARAREEV QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM R   ++ KLG 
Sbjct  348  PDWQARAREEVFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPVAGMTRSIEKDVKLGT  407

Query  532  IVLPRGALLMLPTLLMHVDSEIWGED  609
            + LP G  ++LPT+L+H D + WGED
Sbjct  408  LTLPAGVHVLLPTILIHHDRKFWGED  433



>ref|XP_010644766.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=460

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+  VY+PGWRF+PTK NRRM  I KEV + +RGII+KR KAM+ GET N D
Sbjct  170  EQTHLAIQVTMSVYIPGWRFLPTKTNRRMKQISKEVYALLRGIINKREKAMKAGETANSD  229

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI++ Q  K+  MS++DVIEECK+FY AGQETTSV+LVWTM+LLS   +
Sbjct  230  LLGILMESNFREIQEHQNNKKIRMSVKDVIEECKLFYLAGQETTSVLLVWTMVLLSEHPN  289

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++P+  GLN LK++TMI +E LRLYPP+  + R   ++T++G++ 
Sbjct  290  WQARAREEVLQVFGNKKPEAAGLNHLKIVTMIFHEVLRLYPPVAMLARAVYKDTQVGDMC  349

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P G  ++LPT+L+H D EIWG+D
Sbjct  350  FPAGVQVVLPTILVHHDHEIWGDD  373



>ref|XP_004488665.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=524

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 163/204 (80%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V  + ++P WRFVPT  +RRMN ++K++KSS++ +I+KR K ++ GE N +D
Sbjct  234  EQAELITKVVMKSFIPLWRFVPTIVHRRMNEVDKDIKSSLKDMINKREKTLKAGEANKND  293

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ G  K  GM+IEDVIEECK+FYFAGQETTSV+LVWTMILLSR+ D
Sbjct  294  LLGILLESNHKEIKEHGNNKNAGMNIEDVIEECKLFYFAGQETTSVLLVWTMILLSRYPD  353

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEV  VFG+++PDF+GL++LK++TM+LYE LRLYPP+ G+ R+  ++ KLG + 
Sbjct  354  WQARAREEVFHVFGNKKPDFDGLSNLKIVTMVLYEVLRLYPPVIGLARKIDKDMKLGNLT  413

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP +L+H D+++WG+D
Sbjct  414  LPAGVEVFLPIILLHHDTQLWGDD  437



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ--GGETNN  174
            EQ  +  +    VY+PG RF P K N+RM   EKEV+ +I  +ID R+KA +   G+  N
Sbjct  232  EQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALN  291

Query  175  DDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            DDLLGILLESN  EI + G K+FGMSI +VIEECK+FYFAGQETTSV+LVWT+ILL R  
Sbjct  292  DDLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNP  351

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQ RAREEV Q FG  +P F+ L  LK++TMILYESLRLYPPI    RRT EETKLGE+
Sbjct  352  EWQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGEL  411

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP+GALL +PT+L+H+D EIWGED
Sbjct  412  DLPKGALLFIPTILLHLDKEIWGED  436



>gb|KEH38477.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=353

 Score =   256 bits (655),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     ++  +VY+PGWRF+PT   RRM  I++++K+S+  +I+ R +A++ GE   DD
Sbjct  63   EQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRDIKASLTDMINNRERALKAGEATKDD  122

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +E+ + G  K+ GMS++DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ D
Sbjct  123  LLGILLESNHKEMEEHGNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  182

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + RR  ++ KLG + 
Sbjct  183  WQARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLA  242

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + L  +++H D E+WGED
Sbjct  243  LPAGVQVFLSIIMVHHDIELWGED  266



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ--GGETNN  174
            EQ  +  +    VY+PG RF P K N+RM   EKEV+ +I  +ID R+KA +   G+  N
Sbjct  232  EQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALN  291

Query  175  DDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            DDLLGILLESN  EI + G K+FGMSI +VIEECK+FYFAGQETTSV+LVWT+ILL R  
Sbjct  292  DDLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNP  351

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQ RAREEV Q FG  +P F+ L  LK++TMILYESLRLYPPI    RRT EETKLGE+
Sbjct  352  EWQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGEL  411

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP+GALL +PT+L+H+D EIWGED
Sbjct  412  DLPKGALLFIPTILLHLDREIWGED  436



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + I   R VY+PGWR+VPTKRN+RM  I KEV+S I+ +ID+R++AM   E  ++D
Sbjct  230  EQAGYAIHALRSVYIPGWRYVPTKRNKRMKEIAKEVRSIIQQLIDRRVEAMGREEGKHED  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LL +LLESN QEI + G K FGMS++DV+EECK+FYFAGQETT+ +LVW ++LLS+   W
Sbjct  290  LLSMLLESNSQEIEEHGSKSFGMSMDDVVEECKLFYFAGQETTASLLVWALVLLSKHPHW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG Q P F+GLN LK++TMILYE LRLY PI    RR  ++TK+GE+ L
Sbjct  350  QTRAREEVLQVFGHQTPHFDGLNQLKIVTMILYEVLRLYSPIVAQRRRLSKDTKVGELAL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G   +LP++L+H D EIWG+D
Sbjct  410  PAGVEFILPSILLHHDREIWGDD  432



>ref|XP_006377681.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP55478.1| cytochrome P450 family protein [Populus trichocarpa]
Length=410

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = +1

Query  25   VSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLES  204
            + + + +PG+RF+P   NRR+ AI+KE+K+S+  +I+KR KAM  GE    DLLG+LLES
Sbjct  130  IIKAIVIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREKAMSAGEDAKKDLLGLLLES  189

Query  205  NLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREE  381
            N +EI++ G  K  GMSIEDVI+ECK+FYFAGQETT V+L WTMILL+++ +WQARAREE
Sbjct  190  NFREIQEHGNTKSVGMSIEDVIDECKIFYFAGQETTLVLLTWTMILLAQYPNWQARAREE  249

Query  382  VLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLM  561
            V+QVFG+++PDF+GLN LKV+TMILYE LRLYPP+  ++R   EE KLG ++LP G  + 
Sbjct  250  VVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVITLNRDVHEEIKLGNLLLPAGVQVS  309

Query  562  LPTLLMHVDSEIWGED  609
            LPT+L+H D E+WG+D
Sbjct  310  LPTILLHQDHELWGDD  325



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ--GGETNN  174
            EQ  +  +    VY+PG RF P K N+RM   EKEV+ +I  +ID R+KA +   G+  N
Sbjct  242  EQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITRLIDNRLKAKEEGNGKALN  301

Query  175  DDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            DDLLGILLESN  EI + G K+FGMSI +VIEECK+FYFAGQETTSV+LVWT+ILL R  
Sbjct  302  DDLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNP  361

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQ RAREEV Q FG  +P F+ L  LK++TMILYESLRLYPPI    RRT EETKLGE+
Sbjct  362  EWQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGEL  421

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP+GALL +PT+L+H+D EIWGED
Sbjct  422  DLPKGALLFIPTILLHLDKEIWGED  446



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + ++++  VY+PG RF+PTKRN+RM  IEK+++++IR IIDKR++AM+ GE + +D
Sbjct  230  EQAEYVMDMTHSVYIPGSRFLPTKRNKRMLEIEKQIQTTIRHIIDKRLRAMEAGEASKND  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGM+  ++IEECK+FYFAGQE  SV+LVWTMILL    +W
Sbjct  290  LLGILLESNMKEIEQHGNKDFGMTTTELIEECKLFYFAGQEGNSVLLVWTMILLCLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQV G++ P+ EGLN L ++TMIL E+LR++PP+    RR  +E KLGE+ L
Sbjct  350  QVRAREEVLQVLGNERPNLEGLNRLHIVTMILNETLRVFPPVAMFRRRIKDEVKLGELSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL +PT+L+H D ++WGED
Sbjct  410  PAGVLLFIPTVLIHYDKKLWGED  432



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 161/206 (78%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V  ++ +PGWRF+PT  +RRM  I++++K+S++ +I+KR KA++ GE   +D
Sbjct  228  EQAELLIKVLLKIQIPGWRFLPTNTHRRMKEIDRDIKASLKDMINKREKALKAGEATKND  287

Query  181  LLGILLESNLQEIRQQGG---KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  351
            LLGILL SN +EI++ G    K  GMS+E+VIEECK+FYFAGQETTSV+LVWTM+LLSR+
Sbjct  288  LLGILLASNHKEIQEHGNRNNKNVGMSLEEVIEECKLFYFAGQETTSVLLVWTMVLLSRY  347

Query  352  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  531
             DWQARAREEV QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM R   ++ KLG 
Sbjct  348  PDWQARAREEVFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPVAGMTRSIEKDVKLGT  407

Query  532  IVLPRGALLMLPTLLMHVDSEIWGED  609
            + LP G  ++LPT+L+H D + WGED
Sbjct  408  LTLPAGVHVLLPTILIHHDRKFWGED  433



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V  ++ +PGWRF+PTK +RRM  I++++K+S++ +I KR KA++ GE  NDD
Sbjct  228  EQAKLALQVILKIQIPGWRFLPTKSHRRMKEIDRDIKASLKDMIYKREKALKKGEAINDD  287

Query  181  LLGILLESNLQEIRQQG---GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  351
            LLGILLESN +EI++      K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+
Sbjct  288  LLGILLESNHKEIQEHAKGDNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRY  347

Query  352  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  531
             DWQ RAREEVLQVFG+Q+P F+GLN LK++TMIL E LRLYPP  GM+R    + KLG 
Sbjct  348  PDWQERAREEVLQVFGNQKPSFDGLNRLKIVTMILNEVLRLYPPALGMNRLAKRDLKLGN  407

Query  532  IVLPRGALLMLPTLLMHVDSEIWGED  609
            I+LP G  + LPT+L+H + E WGED
Sbjct  408  IILPAGVQIFLPTVLVHHNCEFWGED  433



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 159/206 (77%), Gaps = 3/206 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V  +V +PGWRF+PTK +RRM  I++++K+S++ +I KR KA++ GE  NDD
Sbjct  228  EQTKLALQVILKVQIPGWRFLPTKSHRRMKEIDRDIKASLKDMIYKREKALKKGEAINDD  287

Query  181  LLGILLESNLQEIRQQG---GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  351
            LLGILLESN +EI++      K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+
Sbjct  288  LLGILLESNHKEIQEHAKGDNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRY  347

Query  352  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  531
             DWQ RAREEVLQVFG+Q+P F+GLN LK++TMIL E LRLYPP  GM+R    + KLG 
Sbjct  348  PDWQERAREEVLQVFGNQKPSFDGLNRLKIVTMILNEVLRLYPPALGMNRLAKRDLKLGN  407

Query  532  IVLPRGALLMLPTLLMHVDSEIWGED  609
            I LP G  + LPT+L+H D E WGED
Sbjct  408  ITLPAGVQIFLPTVLVHHDCEFWGED  433



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 154/203 (76%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ +  I+ S+ VY+PG RF+PTK N+RM  I++E+K+SI+ IIDKR+ AM+  ET+NDD
Sbjct  229  EQAVLIIKASQSVYIPGLRFLPTKSNKRMKEIDREIKASIKNIIDKRVVAMKAKETSNDD  288

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILL+SN +EI+Q G K +G+SIEDVIEECK+FYFAGQETT  MLVWTMILL    DW
Sbjct  289  LLGILLDSNDKEIKQHGSK-YGLSIEDVIEECKLFYFAGQETTGTMLVWTMILLGHHTDW  347

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVL VFGD+ PD +GL+ LKV+ +I +E LRLYPP   + R   EETKLG + L
Sbjct  348  QRRAREEVLHVFGDKTPDIDGLSHLKVINIIFHEVLRLYPPAQLLRRMIHEETKLGNLTL  407

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+ L  LL H D + WGED
Sbjct  408  PAGTLVQLNILLSHHDKDTWGED  430



>ref|XP_010644760.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
 emb|CBI39892.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+  VY+PGWRF PTK N+RM  I KEV + + GII+KR KAM+ GET N D
Sbjct  120  EQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSD  179

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI++ Q   + GMS +DVI+ECK+FY AGQETTSV+L+WTM+LLS+  D
Sbjct  180  LLGILMESNFREIQEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHTD  239

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +P+ +GLN LK++TMI +E LRLYPP+T + R   ++T++G++ 
Sbjct  240  WQARAREEVLQVFGNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMY  299

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P G  + LPT+L+H D EIWG+D
Sbjct  300  FPAGVQVSLPTILVHHDHEIWGDD  323



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 164/204 (80%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGE-TNND  177
            EQ    I+ S+ +Y+PG RF+PTKRN+RM  I KEVK +++ II+KR+KAM+ GE +++D
Sbjct  229  EQAELIIQASQTIYLPGMRFLPTKRNKRMKEIAKEVKIALKSIINKRLKAMEAGERSSHD  288

Query  178  DLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            DLLGILLESN +EI+Q G   FG+++++VIEECK+F+FAGQETTS +LVWTMILLS+ QD
Sbjct  289  DLLGILLESNSKEIKQHGNTNFGLTVDEVIEECKLFFFAGQETTSNLLVWTMILLSQHQD  348

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RA+EEVL+ FG+ +PDF+GLN LKV+ MIL E LRLYPPI  +DR   EE KLGEI 
Sbjct  349  WQKRAKEEVLRTFGNNKPDFDGLNHLKVVNMILLEVLRLYPPILSLDRTIYEEIKLGEIS  408

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G +L+LP +L+H D EIWG+D
Sbjct  409  LPAGVILLLPIILLHYDQEIWGDD  432



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 161/203 (79%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + ++++  VY+PG RF+PTKRN+RM  IEK+++++IR II+KR++AM+ GET+ +D
Sbjct  230  EQAEYVMDMTHSVYIPGSRFLPTKRNKRMKEIEKQIQTTIRRIINKRLRAMEAGETSKND  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN++EI Q G K+FGM+  ++IEECK+FYFAGQE  SV+L+WTMILL    +W
Sbjct  290  LLGILLESNMKEIEQHGNKDFGMTTIELIEECKLFYFAGQEGNSVLLIWTMILLCLHPEW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG+++ + EGL+ L ++TMIL E+LRL+PP+    RR  EE KLG++ L
Sbjct  350  QVRAREEVLQVFGNEKTNLEGLSRLNIVTMILNETLRLFPPVATFRRRIKEEVKLGDLSL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L +PT+L+H D E+WGED
Sbjct  410  PAGVQLFIPTVLIHYDKELWGED  432



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +   R +Y+PGWRF+PTK NRRM +I K V +SI  I+ +R+KAM+ G    DD
Sbjct  232  EQAELVVIALRSLYIPGWRFLPTKMNRRMKSISKVVNNSIGIIVSERIKAMEAGVACEDD  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG LLESN +E+ + G KE G+SI+DVIEECK+FYFAGQETTS +LVWTM+LLS++  W
Sbjct  292  LLGTLLESNFKEMDEHGKKEVGLSIQDVIEECKLFYFAGQETTSTLLVWTMVLLSKYSHW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q  AREEVLQ FG ++PD++GL+ LK ++MILYE LRLYPP+  + RR+ +E KLG++ L
Sbjct  352  QTLAREEVLQHFGTKKPDYDGLHHLKTVSMILYEVLRLYPPVPVIARRSTQEIKLGKMTL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL LP +L+H D+E+WGED
Sbjct  412  PAGGLLSLPIMLLHRDTELWGED  434



>gb|AGX93048.1| secologanin synthase-like protein [Tabernaemontana elegans]
Length=524

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            IE  R VY+PGW ++PTKRN+RM  I KE+   +  II+KRMKAM+ GE + DDLLG+LL
Sbjct  240  IECMRDVYIPGWSYLPTKRNKRMKEINKEITDMLSKIINKRMKAMKAGEPSEDDLLGVLL  299

Query  199  ESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN QEI +QG K + GM+I DVIEECK+FYFAGQETT V+L WT ILLS+  +WQ  AR
Sbjct  300  ESNFQEIEKQGNKKDVGMTIHDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQKLAR  359

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG ++PDFE LN LK ++MILYE LRLYPP+  + +   E+TKLG   +P G L
Sbjct  360  EEVLQVFGKKKPDFERLNHLKYVSMILYEVLRLYPPVIDLTKIVHEDTKLGPYTIPAGTL  419

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  420  VMLPTVMLHREKSIWGED  437



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + I+ S+ +Y+PGWRF+PTK N RM  IEKEV+SSIRG+I+KR+KAM+ GE +N+D
Sbjct  232  EQAEYIIKASQTIYIPGWRFMPTKGNNRMKEIEKEVQSSIRGMINKRVKAMKAGEASNED  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG+LLESN +EI Q G K FGM+I++V+EECK+FYFAGQETTSV+LVW ++LLS++ +W
Sbjct  292  LLGLLLESNYKEIEQYGNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWALVLLSQYPEW  351

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q +AREEVLQ FG+Q P+F+GLN LK++ MILYE LRLYPP+  + R   EETKLG++ L
Sbjct  352  QTKAREEVLQSFGNQIPEFDGLNHLKIVNMILYEVLRLYPPVVALGRIVSEETKLGKLTL  411

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  + LP + +H + EIWG+D
Sbjct  412  PAGVQVSLPIIFLHHNREIWGDD  434



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++V +  Y+PGWR++PTK NR+M  I K++K S++G+I KR +A +  E +NDDLLGIL+
Sbjct  236  MQVVQSAYIPGWRYLPTKTNRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILV  295

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN++EI++QG  K  GMSIEDVIEECK+FYFAGQETTSV+LVWTMILL+R   WQ +AR
Sbjct  296  ESNIREIQEQGDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAR  355

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVL+VFGD +PD +GLN LKV+TMILYE LRLYP    + R   ++TKLG+++LP GA 
Sbjct  356  EEVLEVFGDSKPDSDGLNRLKVVTMILYEVLRLYPAGVALGRSVPKDTKLGKLLLPAGAE  415

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP LL+H D E+WG+D
Sbjct  416  ITLPVLLIHHDQELWGDD  433



>gb|AJD25171.1| cytochrome P450 CYP72A330 [Salvia miltiorrhiza]
Length=517

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNND-  177
            EQ  H I+  R +YVPGWRFVPTKRNRRM  IE+EV+S+IRG+I KR++AM+ GE  +D 
Sbjct  229  EQVEHIIQALRSIYVPGWRFVPTKRNRRMKQIEREVQSTIRGLISKRIEAMKTGEARHDE  288

Query  178  DLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            DLL ILL SN QEI + G K FGM+I+ V+EECK+FYFAGQETTSV+LVWT++LLSR+ D
Sbjct  289  DLLSILLASNFQEIEKGGNKSFGMTIDAVVEECKLFYFAGQETTSVLLVWTLVLLSRYPD  348

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEV+QV G++ PDF+ LN LK++TMILYE LRLYPP+  + RR  EETKLG+  
Sbjct  349  WQTRAREEVMQVIGNRTPDFDSLNQLKIVTMILYEVLRLYPPVVALGRRASEETKLGKYT  408

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L L  +++H D++IWG+D
Sbjct  409  LPAGVQLSLSIIVLHHDTKIWGDD  432



>ref|XP_006377690.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP55487.1| cytochrome P450 family protein [Populus trichocarpa]
Length=353

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 155/196 (79%), Gaps = 1/196 (1%)
 Frame = +1

Query  25   VSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLES  204
            + + + +PG+RF+P   NRR+ AI+KE+K+S+  +I+KR KAM  GE    DLLG+LLES
Sbjct  73   IIKAIVIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREKAMSAGEEAKKDLLGLLLES  132

Query  205  NLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREE  381
            N +EI++ G  K  GMSIEDVI+ECK+FYFAGQETT V+L WTM+LL+++ +WQARAREE
Sbjct  133  NFREIQEHGNTKSVGMSIEDVIDECKLFYFAGQETTLVLLTWTMVLLAQYPNWQARAREE  192

Query  382  VLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLM  561
            V+QVFG+++PDF+GLN LKV+TMILYE LRLYPP+  ++R   EE KLG ++LP G  + 
Sbjct  193  VVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVS  252

Query  562  LPTLLMHVDSEIWGED  609
            LP +L+H D E+WG+D
Sbjct  253  LPIILLHQDHELWGDD  268



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++V +  Y+PGWR++PTK NR+M  I K++K S++G+I KR +A +  E +NDDLLGIL+
Sbjct  236  MQVVQSAYIPGWRYLPTKTNRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILV  295

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN++EI++QG  K  GMSIEDVIEECK+FYFAGQETTSV+LVWTMILL+R   WQ +AR
Sbjct  296  ESNIREIQEQGDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAR  355

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVL+VFGD +PD +GLN LKV+TMIL+E LRLYP +  + R   ++T+LG+++LP GA 
Sbjct  356  EEVLEVFGDSKPDSDGLNRLKVVTMILHEVLRLYPAVVALGRSVPKDTRLGKLLLPAGAE  415

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP LL+H D E+WG+D
Sbjct  416  ITLPVLLIHHDQELWGDD  433



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ S   ++PGWRF+PTK N+RM  I KEV + + GIIDKR KAM+ GET NDD
Sbjct  230  EQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDD  289

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ +  K  GMSI+DVIEECK+FYFAGQETTSV+L+WTM+LLS+  +
Sbjct  290  LLGILLESNFKEIQEHENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPN  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G++ 
Sbjct  350  WQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMY  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPT+L+H D EIWGED
Sbjct  410  LPAGVDVSLPTILVHHDHEIWGED  433



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ S   ++PGWRF+PTK N+RM  I KEV + + GIIDKR KAM+ GET NDD
Sbjct  230  EQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDD  289

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ +  K  GMSI+DVIEECK+FYFAGQETTSV+L+WTM+LLS+  +
Sbjct  290  LLGILLESNFKEIQEHENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPN  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G++ 
Sbjct  350  WQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMY  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPT+L+H D EIWGED
Sbjct  410  LPAGVDVSLPTILVHHDHEIWGED  433



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 153/193 (79%), Gaps = 1/193 (1%)
 Frame = +1

Query  34   QVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQ  213
            QV++PGWRF+PT  +RRM  I++E+K+S+  +I+KR  A++ GE   DDLLGILLE N +
Sbjct  239  QVFIPGWRFLPTSTHRRMKEIDREIKASLTDMINKREIALKAGEATKDDLLGILLELNHK  298

Query  214  EIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQ  390
            E+ +    K+ GMS++DVIEECK+FYFAGQETTSV+LVW M+LLSR+ DWQARAREEVLQ
Sbjct  299  EMEEHDNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWAMMLLSRYPDWQARAREEVLQ  358

Query  391  VFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPT  570
            VFG+++PDF+GLN LK++TMILYE LRLYPP     R T ++ KLG + LP G  + LP 
Sbjct  359  VFGNKKPDFDGLNQLKIVTMILYEVLRLYPPAIATSRSTHKDVKLGNLTLPAGVQITLPI  418

Query  571  LLMHVDSEIWGED  609
            +L+H DSE+WGED
Sbjct  419  VLVHHDSELWGED  431



>gb|KEH38476.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=493

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     ++  +VY+PGWRF+PT   RRM  I++++K+S+  +I+ R +A++ GE   DD
Sbjct  203  EQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRDIKASLTDMINNRERALKAGEATKDD  262

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +E+ + G  K+ GMS++DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ D
Sbjct  263  LLGILLESNHKEMEEHGNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  322

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + RR  ++ KLG + 
Sbjct  323  WQARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLA  382

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + L  +++H D E+WGED
Sbjct  383  LPAGVQVFLSIIMVHHDIELWGED  406



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ S   ++PGWRF+PTK N+RM    KEV   + GIIDKR KAM+ GET NDD
Sbjct  230  EQAQLLVQFSESAFIPGWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDD  289

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ G  K  GMSI+DVI+ECK+FYFAGQETTSV+L+WTMILLS+  +
Sbjct  290  LLGILLESNFKEIQEHGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMILLSKHPN  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G++ 
Sbjct  350  WQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMY  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPT+L+H D EIWGED
Sbjct  410  LPAGVDVSLPTILVHHDHEIWGED  433



>gb|KEH38472.1| cytochrome P450 family protein [Medicago truncatula]
Length=353

 Score =   251 bits (641),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    + V  +VY+PGWRF+PT  +RRM  I+++VK+S+  +I+KR +A++ GE   DD
Sbjct  63   EQAKLTMSVMTKVYIPGWRFLPTTTHRRMKEIDRDVKASLTDMINKRERALKAGEATKDD  122

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +E+ + G  K  GMS++DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ D
Sbjct  123  LLGILLESNHKEMEEHGNNKNVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  182

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP   + R   ++  LG + 
Sbjct  183  WQERAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPAIALARSVHKDVILGNLA  242

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + L  +L+H D E+WG+D
Sbjct  243  LPAGVQVFLSIILVHHDIELWGDD  266



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     ++  +VY+PGWRF+PT   RRM  I++++K+S+  +I+ R +A++ GE   DD
Sbjct  228  EQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRDIKASLTDMINNRERALKAGEATKDD  287

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +E+ + G  K+ GMS++DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ D
Sbjct  288  LLGILLESNHKEMEEHGNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  347

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + RR  ++ KLG + 
Sbjct  348  WQARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLA  407

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + L  +++H D E+WGED
Sbjct  408  LPAGVQVFLSIIMVHHDIELWGED  431



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            +Q   F +  + +YVPGWRF+PTKRN++M  I K+V+S I GII+KR++AMQ GE  + D
Sbjct  228  QQSELFEQAIQSIYVPGWRFLPTKRNKKMKKIFKDVRSLILGIINKRVRAMQEGEATHSD  287

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG+LLESN +EI++ G + FGM+ E+VI+ECK+FYFAG ETT+++LVWT+ILLS+  DW
Sbjct  288  LLGLLLESNFKEIQEHGNERFGMTSEEVIQECKLFYFAGHETTAILLVWTLILLSKHSDW  347

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAR+EVLQVFG+  PDFE LN LK++TMIL E LRLY P   + RR  E+TKLGE+ L
Sbjct  348  QARARDEVLQVFGNNIPDFEELNRLKIVTMILNEVLRLYTPGVMISRRVNEDTKLGELSL  407

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  +++P++L+H D  +WG+D
Sbjct  408  PSGMFVLMPSILLHHDPSLWGDD  430



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   256 bits (653),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++VS+ +Y+PGWRFVPTK N+RM  I  EV + ++GII++R KAM+ GET NDD
Sbjct  227  EQAHLAVQVSQSIYIPGWRFVPTKTNKRMRQISNEVNALLKGIIERREKAMKVGETANDD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++ G  K  GMS +DVIEECK+FYFAGQETTSV+L+WTM+LLS+  +
Sbjct  287  LLGLLMESNYKEMQEHGERKNVGMSNKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++PD +GLN LK++TMI +E LRLYPP + + R    +T++G + 
Sbjct  347  WQARAREEVLQVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRSVYADTEVGGMY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D EIWG+D
Sbjct  407  LPDGVQVSLPILLLHHDHEIWGDD  430



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     ++  +VY+PGWRF+PT   RRM  I++++K+S+  +I+ R +A++ GE   DD
Sbjct  228  EQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRDIKASLTDMINNRERALKAGEATKDD  287

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +E+ + G  K+ GMS++DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ D
Sbjct  288  LLGILLESNHKEMEEHGNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  347

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + RR  ++ KLG + 
Sbjct  348  WQARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLA  407

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + L  +++H D E+WGED
Sbjct  408  LPAGVQVFLSIIMVHHDIELWGED  431



>emb|CBI39916.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++VS+ +Y+PGWRFVPTK N+RM  I  EV + ++GII++R KAM+ GET NDD
Sbjct  227  EQAHLAVQVSQSIYIPGWRFVPTKTNKRMRQISNEVNALLKGIIERREKAMKVGETANDD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++ G  K  GMS +DVIEECK+FYFAGQETTSV+L+WTM+LLS+  +
Sbjct  287  LLGLLMESNYKEMQEHGERKNVGMSNKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++PD +GLN LK++TMI +E LRLYPP + + R    +T++G + 
Sbjct  347  WQARAREEVLQVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRSVYADTEVGGMY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D EIWG+D
Sbjct  407  LPDGVQVSLPILLLHHDHEIWGDD  430



>emb|CBI39929.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ +  ++V+R VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAMQ GET NDD
Sbjct  168  EQALLTVQVTRSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDD  227

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++    K  GMSI+DVIEECK+FY AGQETTS +L+WTM+LLS+  +
Sbjct  228  LLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSN  287

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP   + R    ++++G + 
Sbjct  288  WQARAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPAPMLTRAVFADSQVGGLY  347

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D +IWG+D
Sbjct  348  LPDGVQIALPILLIHHDDKIWGDD  371



>ref|XP_010092744.1| Secologanin synthase [Morus notabilis]
 gb|EXB52089.1| Secologanin synthase [Morus notabilis]
Length=558

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 153/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+  + VYVPGWRF PT  N+RM  ++ EV+  ++ II KR KAM+ GE  NDD
Sbjct  270  EQAELAIKAIQTVYVPGWRFAPTTLNKRMKEVDHEVQGLLKDIIHKREKAMRAGEAPNDD  329

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI++ G  K  G+SI DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ D
Sbjct  330  LLGILMESNFKEIQEHGNNKNMGISIRDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPD  389

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG   PDF+GL  LK++TMILYE LR YPP+  + R   ++T+LG + 
Sbjct  390  WQARAREEVLQVFGYNNPDFDGLGHLKIVTMILYEVLRFYPPVILLTRTVQKQTQLGNLS  449

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP +L+H D+ +WGED
Sbjct  450  LPPGVQISLPVILVHRDTNLWGED  473



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 161/205 (79%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET--NN  174
            EQ  + +E    +Y+PG RF+P+K+ +RM  IEKE++++IR II+KR+  M+ GET  NN
Sbjct  234  EQAEYVMEQIFSIYIPGSRFLPSKKKKRMVEIEKEIQTTIRRIIEKRLMTMKAGETSNNN  293

Query  175  DDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            +DLLGILLESN +EI Q G K+FGM+I +VI+ECK+FYFAGQ+TTSV+LVWTMILL +  
Sbjct  294  EDLLGILLESNTKEIEQHGNKDFGMTITEVIDECKLFYFAGQDTTSVLLVWTMILLCQHP  353

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQ RAREEVL VFG+++PDFEGL+ LK++TMILYE+LRL+PP     R   +E KLGE+
Sbjct  354  EWQVRAREEVLNVFGNEKPDFEGLSRLKIVTMILYETLRLFPPALLYGRTNKDEVKLGEL  413

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP   LL++P +L+H + E+WGED
Sbjct  414  SLPAEVLLIIPAILVHYNKELWGED  438



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+ +R +Y+PGWRFVPTKRN+R+  I  EV+S + GII+ R+K M+ GE   DD
Sbjct  229  EQADLIIQAARWIYIPGWRFVPTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDD  288

Query  181  LLGILLESNLQEIR-QQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI+     K FGM+I++VIEECK+FYFAGQETTSV+LVWT+ILLS+  D
Sbjct  289  LLGILLESNFKEIQIHHENKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLD  348

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAR+EV QVFG  +PD++ LN LKV+TMI  E LRLYPP   + RR  +ETKLG + 
Sbjct  349  WQERARQEVHQVFGSNKPDYDMLNQLKVVTMIFNEVLRLYPPGAMIGRRVQKETKLGNLS  408

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G LL+LPT+ +  D+EIWG+D
Sbjct  409  LPAGMLLLLPTIYLQHDNEIWGDD  432



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+  VY+PGWRF PTK N+RM  I KEV + + GII+KR KAM+ GET N D
Sbjct  227  EQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSD  286

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI++ Q   + GMS +DVI+ECK+FY AGQETTSV+L+WTM+LLS+  D
Sbjct  287  LLGILMESNFREIQEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPD  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +P+ +GLN LK++TMI +E LRLYPP+T + R   ++T++G++ 
Sbjct  347  WQARAREEVLQVFGNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P G  + LPT+L+H D EIWG+D
Sbjct  407  FPAGVQVSLPTILVHHDHEIWGDD  430



>ref|XP_006348982.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=860

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +E    +Y+PG RF+P+K+ +RM  IEKE++++IR IIDKR+ AMQ GETNN+D
Sbjct  573  EQAEYVMEQVFSIYIPGSRFLPSKKKKRMLEIEKEIQTTIRRIIDKRLMAMQAGETNNED  632

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FG++  +VIEECK+FYFAGQ+TTSV+LVWT ILL    +W
Sbjct  633  LLGILLESNTKEIEQHGSKDFGLTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEW  692

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVL VFG+++PDFEGL+ LK++TMILYE+LRL+PP     RR  +E KLGE+ L
Sbjct  693  QVRAREEVLNVFGNEKPDFEGLSRLKIVTMILYETLRLFPPAPIYGRRNKDEVKLGELSL  752

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P   LL++P +L+H + E+WGED
Sbjct  753  PAEVLLVIPAILVHYNKELWGED  775


 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +E    +Y+PG RF+P+K+ +RM  IEKE++++IR IIDKR+ AMQ GETNN+D
Sbjct  251  EQAEYVMEQVFSIYIPGSRFLPSKKKKRMLEIEKEIQTTIRCIIDKRLMAMQAGETNNED  310

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FG++  +VIEECK+FYFAGQ+TTSV+LVWT ILL    +W
Sbjct  311  LLGILLESNTKEIEQHGSKDFGLTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEW  370

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            Q RAREEVL VFG+++PDFEGL+ LK++TMILYE+LRL+PP     RR  +E KLGE+
Sbjct  371  QVRAREEVLNVFGNEKPDFEGLSRLKIVTMILYETLRLFPPAPIYGRRNKDEVKLGEL  428



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = +1

Query  22   EVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLE  201
            ++  +VY+PGWRF+PT  ++RM  I++++K+S+  +I+KR KA++ GE   DDLLGILLE
Sbjct  236  QIMMKVYIPGWRFLPTTTHKRMKEIDRDIKASLTDMINKREKALKAGEATKDDLLGILLE  295

Query  202  SNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            SN +E+ + G  K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+ LSR+ DWQARARE
Sbjct  296  SNHREMEEHGNNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVCLSRYPDWQARARE  355

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFG+++PDF+GL+ LK++TMIL E LRLYPP+  + R   ++ KLG I LP G  +
Sbjct  356  EVFQVFGNKKPDFDGLSHLKIVTMILNEVLRLYPPVIALARSVHKDVKLGNITLPAGVQV  415

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+H D E+WG+D
Sbjct  416  SLPVVLVHHDCELWGDD  432



>ref|XP_006477950.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Citrus 
sinensis]
Length=420

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V R VY+PGWRF+PTKRN+RM  ++KE+ +++ GII  R KAM+ GE  NDDLLGIL+
Sbjct  138  IQVIRSVYIPGWRFLPTKRNKRMKELDKEISTALMGIIKNREKAMKAGEAANDDLLGILM  197

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ++N +EI + G  K  GMS  DV+EECK+FYFAGQETTSV+L WTM+LLS+ QDWQ RAR
Sbjct  198  DTNFREIEEHGNNKNVGMSFNDVMEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERAR  257

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            +EVLQVFG+ +PD++GLN LK++ MI  E LRLYPP   + R   +ETKLG ++L  G  
Sbjct  258  QEVLQVFGNNKPDYDGLNHLKIVQMIFNEVLRLYPPAVMLARAVNKETKLGNLILLAGVQ  317

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP +++H D E+WG+D
Sbjct  318  ISLPVIMVHHDPELWGDD  335



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ S+   +PGWRF+PTK N+RM    KEV   + GIIDKR KAM+ GET NDD
Sbjct  230  EQAQLLVQFSQSACIPGWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDD  289

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ G  K  GMSI+DVI+ECK+FYFAGQETTSV+L+WTM+LLS+  +
Sbjct  290  LLGILLESNFKEIQEHGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMVLLSKHPN  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G++ 
Sbjct  350  WQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMY  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPT+L+H D EIWGED
Sbjct  410  LPAGVDVSLPTILVHHDHEIWGED  433



>gb|AGX93061.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Vinca minor]
Length=520

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V R VY+PG RF+PTKRN RM AI+KEV+  I  II+K+MK M+ GET  DD LGILL
Sbjct  238  IDVIRSVYIPGQRFLPTKRNNRMRAIDKEVRVRITEIINKKMKIMKAGETAADDFLGILL  297

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            E+NL EIR+QG  +  GM+IE +I ECK+FYFAGQ+TTS ++VWTM+LLSRF +WQ RAR
Sbjct  298  ENNLNEIREQGNNRNAGMTIEQIIGECKLFYFAGQDTTSTLIVWTMVLLSRFPEWQTRAR  357

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG++ PD++G++ LKV+TMILYE LRLY P+  + +   E+T+LG+  +P G  
Sbjct  358  EEVLQVFGNKPPDYDGISRLKVITMILYEVLRLYTPVAELTKVAHEDTQLGKYFIPAGVQ  417

Query  556  LMLPTLLMHVDSEIWGED  609
            LM+P  L+H D EIWGED
Sbjct  418  LMMPQALLHHDPEIWGED  435



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+ +R +Y+PGWRFVPTKRN+R+  I  EV+S + GII+ R+K M+ GE   DD
Sbjct  229  EQADLIIQAARWIYIPGWRFVPTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDD  288

Query  181  LLGILLESNLQEIR-QQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI+     K FGM+I++VIEECK+FYFAGQETTSV+LVWT+ILLS+  D
Sbjct  289  LLGILLESNFKEIQIHHENKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLD  348

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AR+EV QVFG  +P+++ LN LKV+TMI  E LRLYPP T + RR  +ETKLG + 
Sbjct  349  WQEKARQEVHQVFGSNKPNYDMLNQLKVVTMIFNEVLRLYPPGTMIGRRVQKETKLGHLS  408

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G LL+LPT+ +  D+EIWG+D
Sbjct  409  LPAGMLLLLPTIYLQHDNEIWGDD  432



>ref|XP_007211745.1| hypothetical protein PRUPE_ppa006307mg [Prunus persica]
 gb|EMJ12944.1| hypothetical protein PRUPE_ppa006307mg [Prunus persica]
Length=418

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  31   RQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNL  210
            R VY+PGWRF+PTK+N++   I  E+K  ++GII+KR +AM+ GE   DDLLGIL+ESN 
Sbjct  140  RSVYIPGWRFLPTKQNKKTKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNF  199

Query  211  QEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVL  387
            +EI++ G  K  GMSIEDVI ECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAREEVL
Sbjct  200  REIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVL  259

Query  388  QVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLP  567
            QVFG   P +E L+ LKV+TMIL E LRLYP +  + R T ++T+LG++ LP G  + LP
Sbjct  260  QVFGSNIPTYEELSHLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLP  319

Query  568  TLLMHVDSEIWGED  609
             LL+H D E+WGED
Sbjct  320  ILLVHHDKELWGED  333



>ref|XP_011460847.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Fragaria vesca subsp. vesca]
Length=523

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ ++ ++  + VY+PGWRFVPTK N+RM  I+KE+++ + GII KR +A++ GE   DD
Sbjct  234  EQAVYAMKSIQSVYIPGWRFVPTKMNKRMKQIDKEIRNLLMGIISKREQAIEAGEATKDD  293

Query  181  LLGILLESNLQEIRQQG--GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            LLG L+ESNL+EIR  G   K+ GMSIEDVIEECK+FYFAGQETTSV+LVWTM+LL + Q
Sbjct  294  LLGALMESNLKEIRDHGKNNKDVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQ  353

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
             WQ RAREEVLQ+FG  +PDF+GL  LKV+TMIL E LRLYP +  + R T +E +LG+ 
Sbjct  354  IWQDRAREEVLQIFGMNKPDFDGLTHLKVVTMILLEVLRLYPAVVVLSRTTHKEIQLGKF  413

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP G  + LPTLL+H D E+WG+D
Sbjct  414  SLPAGVEVGLPTLLIHHDKELWGDD  438



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQG   I+  + VY+PGWRFVPTK NRRM  I  E+++ ++ II KR  AM+ GE  NDD
Sbjct  230  EQGELAIKSLQTVYIPGWRFVPTKLNRRMKKIYNEIEALVKNIIHKREGAMRAGEAPNDD  289

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESNL+EI++ G  K  G+SI DVIEECK+FY AGQETTS +LVWTM+LLSRF  
Sbjct  290  LLGILMESNLKEIQEHGNNKNMGISIRDVIEECKLFYIAGQETTSTLLVWTMVLLSRFPS  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEVLQ+FG+ +P F+GL  LKV+TMI YE LRLYPP+    R+  ++T+LG + 
Sbjct  350  WQDRAREEVLQIFGNNKPGFDGLTQLKVVTMIFYEVLRLYPPLILFTRKVEKKTQLGNLS  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + +PT+L+H D+E+WGED
Sbjct  410  LPAGVEVSIPTILVHRDTELWGED  433



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H + V  +VY+PGWRF+PT  +RRM  I++E+K+S++ +I+KR +A++ GE   ++
Sbjct  232  EQVEHTMSVLVKVYIPGWRFLPTTTHRRMKKIDREIKASLKEMINKRERALKAGEATKNN  291

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LL ILLESN +E+ + G  +  GMS+EDVIEECK+FYFAGQETTS +LVWTM+LLSR+ D
Sbjct  292  LLDILLESNHKEVEEHGNNRNVGMSLEDVIEECKLFYFAGQETTSGLLVWTMVLLSRYPD  351

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++PDF+GL+ LK++TMILYE LRLYPP+  + R   ++ KLG   
Sbjct  352  WQARAREEVLQVFGNKKPDFDGLSHLKIVTMILYEVLRLYPPVIALARTVHKDVKLGNRT  411

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L LP +L H D E+WG+D
Sbjct  412  LPAGVQLYLPIVLFHHDRELWGDD  435



>emb|CBI39917.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ +  ++V+R VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAMQ GET NDD
Sbjct  168  EQALLAVQVTRSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDD  227

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS+  +
Sbjct  228  LLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSN  287

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQA AREEVL+VFG+++PD + LN LK++TMI +E LRLYPP+  + R    ++++G + 
Sbjct  288  WQACAREEVLRVFGNKKPDGDDLNHLKIVTMIFHEVLRLYPPVPMLTRAVFADSQVGGLY  347

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D +IWGED
Sbjct  348  LPDGVQIALPILLIHHDDKIWGED  371



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+  VY+PGWRF PTK N+RM  I KEV + + GII+KR KAM+ GET N D
Sbjct  227  EQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSD  286

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI++ Q   + GMS +DVI+ECK+FY AGQETTSV+L+WTM+LLS+  D
Sbjct  287  LLGILMESNFREIQEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPD  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +P+ +GLN LK++TMI +E LRLYPP+T + R   ++T++G++ 
Sbjct  347  WQARAREEVLQVFGNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P G  + LPT+L+H D EIWG+D
Sbjct  407  FPAGVQVSLPTILVHHDHEIWGDD  430



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V R VY+PGWRFVPTK N+RM  I  EV + ++GII++R KAM+ GET NDD
Sbjct  227  EQAHLAVKVFRSVYIPGWRFVPTKTNKRMRQISNEVHALLKGIIERREKAMKVGETANDD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LL +L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTS +L+WTM+LLS+  +
Sbjct  287  LLSLLMESNFREMQEHDERKNVGMSIKDVIEECKLFYFAGQETTSDLLLWTMVLLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++PD +GLN LK++T+I +E LRLYPP++ + R  V ++++G   
Sbjct  347  WQARAREEVLQVFGNKKPDGDGLNHLKIVTIIFHEVLRLYPPVSMLIRTVVADSQVGGWY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P GAL+ LP LL+H D EIWGED
Sbjct  407  FPDGALITLPILLIHHDHEIWGED  430



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 158/203 (78%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ I  II+KRM+ ++ GE++ DD
Sbjct  231  EQIQLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRTLILEIINKRMRMIEAGESH-DD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILL SNL+EI+Q G K+FGMSI++VIEECK+FYFAGQETTS +LVWTMILLS+  +W
Sbjct  290  LLGILLSSNLKEIQQHGNKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQHPNW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG  E D++ LN LKV+TMIL E LRLYP    M R    +TKLG + L
Sbjct  350  QDRAREEVLQVFGSNEVDYDKLNQLKVVTMILNEVLRLYPAGYMMTRMVKTKTKLGNLCL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+LPT+L+  D++IWG+D
Sbjct  410  PGGVQLLLPTILLQHDTKIWGDD  432



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ +  ++V+R VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAMQ GET NDD
Sbjct  227  EQALLTVQVTRSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++    K  GMSI+DVIEECK+FY AGQETTS +L+WTM+LLS+  +
Sbjct  287  LLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP   + R    ++++G + 
Sbjct  347  WQARAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPAPMLTRAVFADSQVGGLY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D +IWG+D
Sbjct  407  LPDGVQIALPILLIHHDDKIWGDD  430



>ref|XP_006377676.1| hypothetical protein POPTR_0011s10150g [Populus trichocarpa]
 gb|ERP55473.1| hypothetical protein POPTR_0011s10150g [Populus trichocarpa]
Length=492

 Score =   253 bits (645),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = +1

Query  25   VSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLES  204
            + + + +PG+RF+P   NRR+ AI+KE+K+S+  +I+KR +AM  GE   +DLLG+LLES
Sbjct  212  IIKTIVIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREQAMSAGEDAKNDLLGLLLES  271

Query  205  NLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREE  381
            N +EI++ G  K  GMSIEDVI+ECK+FY AGQETTSV+L WTM+LL+++ +WQARAREE
Sbjct  272  NFREIQEHGNTKSVGMSIEDVIDECKIFYVAGQETTSVLLTWTMVLLAQYPNWQARAREE  331

Query  382  VLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLM  561
            V+QVFG+++PDF+GLN LKV+TMILYE LRLYPP+  ++R   EE KLG ++LP G  + 
Sbjct  332  VVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQIS  391

Query  562  LPTLLMHVDSEIWGED  609
            +PT+L+H D E+WG+D
Sbjct  392  VPTILLHQDHELWGDD  407



>emb|CAN72865.1| hypothetical protein VITISV_029731 [Vitis vinifera]
Length=502

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ S   ++PGWRF PTK N+RM  I KEV + + GIIDKR KAM+ GET NDD
Sbjct  214  EQAQLLVQFSESAFIPGWRFXPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDD  273

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ +  K  GMSI+DVIEECK+FYFAG ETTS +L+WTM+LLS+  +
Sbjct  274  LLGILLESNFKEIQEHENDKNVGMSIKDVIEECKLFYFAGXETTSALLLWTMVLLSKHPN  333

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREE+L VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G++ 
Sbjct  334  WQARAREEILHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPFLARSVYEDIQVGDMY  393

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPT+L+H D EIWGED
Sbjct  394  LPAGVDVSLPTILVHHDHEIWGED  417



>gb|AAA17732.1| cytochrome P450 [Catharanthus roseus]
Length=524

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R VY+PGW ++PTKRN+RM  I KE+   +R II+KRMKA++ GE   DDLLG+LL
Sbjct  240  IDCMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRFIINKRMKALKAGEPGEDDLLGVLL  299

Query  199  ESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN+QEI++QG K + GMSI DVIEECK+FYFAGQETT V+L WT ILLS+  +WQ RAR
Sbjct  300  ESNIQEIQKQGNKKDGGMSINDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERAR  359

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQ FG  +P+FE LN LK ++MILYE LRLYPP+  + +   E+TKLG   +P G  
Sbjct  360  EEVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPVIDLTKIVHEDTKLGPYTIPAGTQ  419

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  420  VMLPTVMLHREKSIWGED  437



>dbj|BAP90521.1| secologanin synthase [Ophiorrhiza pumila]
Length=520

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            IE  R VY+PGW ++PTKRN+RM  I  E+   +R II+KR+KAM+ GE N DDLLG+LL
Sbjct  237  IETMRDVYIPGWSYLPTKRNKRMKQINHEITEMLRNIINKRLKAMKAGEPNEDDLLGVLL  296

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN QEI+ QG  K  G+SI+DVIEECK+FYFAGQETT V+L WT ILLS+  +WQ RAR
Sbjct  297  ESNFQEIKDQGNEKNVGLSIDDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQDRAR  356

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQ FG  +P+F+ LN LK ++MILYE LRLYPP+  + +   ++TKLG  ++P G  
Sbjct  357  EEVLQTFGKNKPEFDKLNQLKYVSMILYEVLRLYPPVIDLTKIVHKDTKLGPYIIPAGTQ  416

Query  556  LMLPTLLMHVDSEIWGED  609
            +M+PT+++H +  IWGED
Sbjct  417  VMMPTVMLHREKSIWGED  434



>gb|AGX93057.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Cinchona calisaya]
Length=519

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V R VY+PG RF+PTKRN RM AI++EV+  I  II+K+M+AM+ GE   DD LGILL
Sbjct  237  IDVIRSVYIPGQRFLPTKRNNRMRAIDREVRVRITEIINKKMRAMKAGEATGDDFLGILL  296

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            E NL EI++QG  K  GMSIE++I ECK+FYFAGQ+TTS ++VWTM+LLSRF +WQ  AR
Sbjct  297  ECNLNEIKEQGNNKSAGMSIEEIIGECKLFYFAGQDTTSTLIVWTMVLLSRFPEWQQHAR  356

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFGD++PD++G++ LK++TMILYE LR+Y P++ + +   E+T+LG+  +P G  
Sbjct  357  EEVLQVFGDRKPDYDGISRLKIVTMILYEVLRIYTPVSELTKVAHEDTQLGKYFIPAGVQ  416

Query  556  LMLPTLLMHVDSEIWGED  609
            LM+P +L+H D EIWG+D
Sbjct  417  LMMPQILLHHDPEIWGDD  434



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = +1

Query  25   VSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLES  204
            + + V +PG+RF+P   NRR+ AI+KE+K+S+  +I+KR KAM  GE   +DLL +LLES
Sbjct  262  IIKAVVIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREKAMSAGEDAKNDLLDLLLES  321

Query  205  NLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREE  381
            N +EI++ G  K  GMSIEDVI+ECK+FYFAGQETTSV+L WTM+LL+++ +WQARAREE
Sbjct  322  NFREIQEHGNSKSAGMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARAREE  381

Query  382  VLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLM  561
            V+QVFG+++PDF+GLN LKV+TMILYE LRLYPP+  ++R   EE KLG +++P G  + 
Sbjct  382  VVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLVPAGVQIS  441

Query  562  LPTLLMHVDSEIWGED  609
            +PT+L+H D E+WG+D
Sbjct  442  VPTILLHQDRELWGDD  457



>emb|CDP15979.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+    + +PGWRF+PTKRNRRM  I K+V  SIR II+ R+  ++ GE  +DD
Sbjct  236  EQCELCIKALWSMLIPGWRFLPTKRNRRMGQIFKDVTDSIREIINSRLNEIRAGEFGDDD  295

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
             LG+LL+SN QEI + G K+FGM+IE+VIEEC++FY AGQETTSV+LVWT+ILLS  Q+W
Sbjct  296  FLGLLLQSNSQEIDRHGNKDFGMTIEEVIEECRLFYVAGQETTSVLLVWTLILLSVHQEW  355

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAR+EVLQVFG + PDF+GLN LK++TM+LYE LRLYPPI    R T  ETKLG + L
Sbjct  356  QTRARDEVLQVFGTRIPDFDGLNHLKLVTMVLYEVLRLYPPIPVNGRITAAETKLGNLSL  415

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G L+++ TLL+H D  IWGED
Sbjct  416  PSGVLVLIQTLLVHHDQAIWGED  438



>ref|XP_002526971.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF35458.1| cytochrome P450, putative [Ricinus communis]
Length=413

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = +1

Query  37   VYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQE  216
            VY+PGWRF+PTK NRR+  I++E+++S+R IIDKR KAM+ GE  NDDLLGIL+ESNL+E
Sbjct  141  VYLPGWRFMPTKTNRRIKQIDREIQASLRSIIDKREKAMKAGEATNDDLLGILMESNLRE  200

Query  217  IRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVF  396
            I +      G+SI++V++EC++FYFAGQETTSV+LVWTMILLS++  WQ +AR+EVLQVF
Sbjct  201  IEENS---MGLSIQEVMDECRLFYFAGQETTSVLLVWTMILLSKYPHWQEQARQEVLQVF  257

Query  397  GDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLL  576
            G + P+F+GLN LKV+TMIL+E LRLYPP+  + R   E+ +L +++LP G  + LPT+L
Sbjct  258  GGKMPEFDGLNRLKVVTMILHEVLRLYPPVPVLSRSVDEDIRLDDVMLPAGVYVSLPTIL  317

Query  577  MHVDSEIWGED  609
            +H D E+WG+D
Sbjct  318  IHQDPELWGDD  328



>gb|EYU30753.1| hypothetical protein MIMGU_mgv1a004802mg [Erythranthe guttata]
Length=509

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = +1

Query  25   VSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLES  204
             S+ VY+PGWRF+PTK N+RM  I KEV+S + GII+KRM+ M+ GE N+DDLL ILLES
Sbjct  233  ASQSVYIPGWRFLPTKINKRMKEIAKEVQSCVLGIINKRMREMETGEANSDDLLSILLES  292

Query  205  NLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEV  384
            N +EI QQ G ++GMS E+VIEECK+FYFAGQETTS +L WTMILLS+  DWQ+RAR+EV
Sbjct  293  NSKEI-QQNGNKYGMSCEEVIEECKLFYFAGQETTSALLAWTMILLSKHLDWQSRARDEV  351

Query  385  LQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLML  564
            L+ FG ++P F+ LN LK++TMI +E LRLYPP+  + + T +ET +GE  +P G  +++
Sbjct  352  LRAFGTRKPTFDELNQLKIVTMIFHEVLRLYPPVPTLTKMTQKETSMGEEKIPAGVKIII  411

Query  565  PTLLMHVDSEIWGED  609
            P++L+H D EIWG+D
Sbjct  412  PSILIHTDKEIWGDD  426



>gb|AGX93049.1| secologanin synthase-like protein [Vinca minor]
Length=524

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            IE  R VY+PGW ++PTKRN+RM  I KE+   +R II+KR KA++ GE   DDLLG+LL
Sbjct  240  IECMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRHIINKRNKAIKAGEPGEDDLLGVLL  299

Query  199  ESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESNLQ I+ QG K + GMSI DVI+ECK+FYFAGQETT V+L WT ILLS+  +WQ RAR
Sbjct  300  ESNLQAIKNQGNKKDGGMSINDVIDECKLFYFAGQETTGVLLTWTTILLSKHPEWQERAR  359

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG  +P+F+ LN LK ++MILYE LRLYPP+  + +   E+TKLG   +P GA 
Sbjct  360  EEVLQVFGKNKPEFDRLNHLKYISMILYEVLRLYPPVIDLTKIVHEDTKLGSYTIPAGAQ  419

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  420  VMLPTVMLHREKSIWGED  437



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++  + VY+PGWR+VPTKRNRRM  ++KE++  +  II KR  AM+ GE   DDLLG+L+
Sbjct  254  LQALQSVYIPGWRYVPTKRNRRMKELDKEIRVRLADIIRKREIAMKTGEAAKDDLLGLLM  313

Query  199  ESNLQEIRQQGGKEF-GMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESNL+EI++ G  +  G+S +DVI+ECK+FYFAGQETTSV+L+WTM+LLS+ QDWQA AR
Sbjct  314  ESNLKEIKEHGNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAR  373

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFGD++PDF+GLN LK++ MI YE LRLYPP+  + R   +ETK+G+++LP  ++
Sbjct  374  EEVLQVFGDKKPDFDGLNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESV  433

Query  556  LMLPTLLMHVDSEIWGED  609
            + L TLL+H D ++WG+D
Sbjct  434  IALQTLLVHHDKKLWGDD  451



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 153/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+  + +Y+PG RF+PTKRN RM  I  E +  +R I++KR KAM+ GE +NDD
Sbjct  230  EQAGLVIKALQSIYIPGLRFLPTKRNNRMKEIYGEARVLLRDIVNKREKAMKIGEAHNDD  289

Query  181  LLGILLESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +EI      K FGM+I++VI+ECK+FYFAGQETTS +LVWTM++LS   D
Sbjct  290  LLGLLMESNFKEITDNVNSKNFGMTIDEVIDECKLFYFAGQETTSTLLVWTMVVLSMHPD  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVFG ++PDF+GLN LK++TMILYE LRLYPP   M R T +  KLGEI 
Sbjct  350  WQEKAREEVLQVFGGKDPDFDGLNHLKIVTMILYEVLRLYPPAVLMARGTYKTMKLGEIT  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L +PTLL+H D E+WGED
Sbjct  410  LPAGVHLAMPTLLVHHDRELWGED  433



>gb|AGX93045.1| secologanin synthase-like protein, partial [Cinchona calisaya]
Length=518

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = +1

Query  13   HFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGI  192
            H I   R+ Y+PGW ++PTKRNRRM  I+ +V+  IR II+KR+KAM+ GE + DDLLG+
Sbjct  234  HTIAAVREFYIPGWSYLPTKRNRRMKNIDSDVRGMIRNIINKRLKAMKSGEPSEDDLLGV  293

Query  193  LLESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  369
            LLESN +EI++QG K+  GM+I+DVIEECK+FYFAGQETT V+L WTMI+LS+  +WQ R
Sbjct  294  LLESNFKEIQKQGNKKNVGMTIDDVIEECKLFYFAGQETTGVLLTWTMIMLSKHPEWQDR  353

Query  370  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRG  549
            AREEVL  FG   P+F+ LN LK ++MILYE LRLYPP+  +++   E+TKLG   +P G
Sbjct  354  AREEVLHAFGKNTPEFDKLNHLKYVSMILYEVLRLYPPVFDLNKVVYEDTKLGTYTIPAG  413

Query  550  ALLMLPTLLMHVDSEIWGED  609
              + LP++++H D  IWGED
Sbjct  414  TQIELPSVMIHRDKTIWGED  433



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = +1

Query  25   VSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLES  204
            + + + +PG+RF+P   NRR+ AI+KE+K+S+  +I+KR +AM  GE   +DLLG+LLES
Sbjct  238  IIKAIVIPGYRFLPIPSNRRLKAIDKEIKASLNALINKREQAMSAGEDAKNDLLGLLLES  297

Query  205  NLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREE  381
            N +EI++ G  K  GMSIEDVI+EC++FYFAGQETT+V+L WTM+LL+++ +WQARAREE
Sbjct  298  NFREIQEHGNTKSVGMSIEDVIDECRIFYFAGQETTTVLLTWTMVLLAQYPNWQARAREE  357

Query  382  VLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLM  561
            V+QVFG+++PDF+GLN LKV+TMI YE LRLYPP+  ++R   EE KLG ++LP G  + 
Sbjct  358  VVQVFGNKKPDFDGLNHLKVVTMIFYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVS  417

Query  562  LPTLLMHVDSEIWGED  609
            +PT+L+H D E+WG+D
Sbjct  418  VPTILLHQDHELWGDD  433



>ref|XP_009594692.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Nicotiana 
tomentosiformis]
Length=408

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NNDDLLGIL  195
            ++V+   Y+    F+PTK NRRM  I +EV+S + GII+KRM A++  E  NNDDLLGIL
Sbjct  129  LKVTESSYI---MFLPTKENRRMKQIYQEVRSLVLGIINKRMDAIEAREAFNNDDLLGIL  185

Query  196  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            L+SNL+EI++ G K+FGMS+++VIEECK+FYFAGQETTS +L W+MI+LS+  DWQARAR
Sbjct  186  LDSNLKEIKEHGNKKFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQARAR  245

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG+  PD++ LN LKV+TMI+ E LRLYPP+  M R   +ETKLG + LP G  
Sbjct  246  EEVLQVFGNNRPDYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHKETKLGNLSLPGGVQ  305

Query  556  LMLPTLLMHVDSEIWGED  609
            L+LPT+++H D EIWGED
Sbjct  306  LLLPTIMLHHDQEIWGED  323



>emb|CBI39923.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+R +YVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET N D
Sbjct  168  EQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHD  227

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +++++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS+  +
Sbjct  228  LLGLLMESNYRDMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSN  287

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP++ + R    ++++G + 
Sbjct  288  WQTRAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLY  347

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D EIWGED
Sbjct  348  LPDGVQIALPILLLHHDHEIWGED  371



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = +1

Query  43   VPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQG--GETNNDDLLGILLESNLQE  216
            +PGWRF+PTK N RM  I KEV+SSIRGIIDKRMK M+   G  ++DDLLGILL+SN +E
Sbjct  244  IPGWRFLPTKMNIRMKQIVKEVESSIRGIIDKRMKEMEAREGSYSSDDLLGILLDSNFRE  303

Query  217  IRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVF  396
            I+Q G K FGMS+++VIEECK+FYFAGQETTS +LVWTMILLS+  DWQ+RARE+VLQ F
Sbjct  304  IKQNGNK-FGMSLDEVIEECKLFYFAGQETTSSLLVWTMILLSKHSDWQSRAREDVLQTF  362

Query  397  GDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLL  576
            G ++PDF+ LN LK++TMIL+E LRLYP    + R T +ET LG+  LP G  L+LP LL
Sbjct  363  GTRKPDFQELNHLKIVTMILHEVLRLYPAGVNLGRTTRKETPLGKSTLPAGVQLILPVLL  422

Query  577  MHVDSEIWGED  609
            +H DS++WG+D
Sbjct  423  LHHDSKMWGDD  433



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ +  ++V+R VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAMQ GET NDD
Sbjct  238  EQALLAVQVTRSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDD  297

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS+  +
Sbjct  298  LLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSN  357

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQA AREEVL+VFG+++PD + LN LK++TMI +E LRLYPP+  + R    ++++G + 
Sbjct  358  WQACAREEVLRVFGNKKPDGDDLNHLKIVTMIFHEVLRLYPPVPMLTRAVFADSQVGGLY  417

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D +IWGED
Sbjct  418  LPDGVQIALPILLIHHDDKIWGED  441



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++  + VY+PGWR+VPTKRNRRM  ++KE++ S+  II KR  AM+ GE   DDLLG+L+
Sbjct  236  LQALQSVYIPGWRYVPTKRNRRMKELDKEIRVSLADIIRKREIAMKTGEAAKDDLLGLLM  295

Query  199  ESNLQEIRQQGGKEF-GMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESNL+EI++ G  +  G+S +DVI+ECK+FYFAGQETTSV+L+WTM+LLS+ QDWQA AR
Sbjct  296  ESNLKEIKEHGNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAR  355

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQV GD++PDF+GLN LK++ MI YE LRLYPP+  + R   +ETK+G+++LP  ++
Sbjct  356  EEVLQVLGDKKPDFDGLNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESV  415

Query  556  LMLPTLLMHVDSEIWGED  609
            + L TLL+H D ++WG+D
Sbjct  416  IALQTLLVHHDKKLWGDD  433



>sp|Q05047.1|C72A1_CATRO RecName: Full=Secologanin synthase; Short=SLS; AltName: Full=CYPLXXII; 
AltName: Full=Cytochrome P450 72A1 [Catharanthus roseus]
 gb|AAA33106.1| cytochrome P-450 protein [Catharanthus roseus]
 prf||1909351A cytochrome P450 [Catharanthus roseus]
Length=524

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R VY+PGW ++PTKRN+RM  I KE+   +R II+KRMKA++ GE   DDLLG+LL
Sbjct  240  IDCMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRFIINKRMKALKAGEPGEDDLLGVLL  299

Query  199  ESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN+QEI++QG K + GMSI DVIEECK+FYFAGQETT V+L WT ILLS+  +WQ RAR
Sbjct  300  ESNIQEIQKQGNKKDGGMSINDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERAR  359

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQ FG  +P+FE LN LK ++MILYE LRLYPP+  + +   ++TKLG   +P G  
Sbjct  360  EEVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPVIDLTKIVHKDTKLGSYTIPAGTQ  419

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  420  VMLPTVMLHREKSIWGED  437



>gb|AGX93046.1| secologanin synthase-like protein [Amsonia hubrichtii]
Length=524

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            IE  R VY+PGW ++PTKRN+RM  I KE+   +R II+KR KA++ GE   DDLLG+LL
Sbjct  240  IECMRDVYIPGWSYLPTKRNKRMREINKELTDMLRNIINKRTKALKAGEPGEDDLLGVLL  299

Query  199  ESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN QEI++QG K+  GM+I DVIEECK+FYFAGQETT V+L W  ILLS+  +WQ RAR
Sbjct  300  ESNFQEIQKQGNKKNVGMTINDVIEECKLFYFAGQETTGVLLTWATILLSKHPEWQERAR  359

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQ FG  +PDFE LN LK ++MILYE LRLYPP+  + +   E+TKLG   +P G  
Sbjct  360  EEVLQAFGKNKPDFERLNHLKYVSMILYEVLRLYPPVIDLTKIVHEDTKLGPYTIPAGTQ  419

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  420  VMLPTVILHREKSIWGED  437



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V R VY+PGWRF+PTKRN+RM  ++KE+ +++ GII  R KAM+ GE  NDDLLGIL+
Sbjct  235  IQVIRSVYIPGWRFLPTKRNKRMKELDKEISTALMGIIKNREKAMKAGEAANDDLLGILM  294

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ++N +EI + G  K  GMS  DV+EECK+FYFAGQETTSV+L WTM+LLS+ QDWQ RAR
Sbjct  295  DTNFREIEEHGNNKNVGMSFNDVMEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERAR  354

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            +EVLQVFG+ +PD++GLN LK++ MI  E LRLYPP   + R   +ETKLG ++L  G  
Sbjct  355  QEVLQVFGNNKPDYDGLNHLKIVQMIFNEVLRLYPPAVMLARAVNKETKLGNLILLAGVQ  414

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP +++H D E+WG+D
Sbjct  415  ISLPVIMVHHDPELWGDD  432



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 155/196 (79%), Gaps = 1/196 (1%)
 Frame = +1

Query  25   VSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLES  204
            + + + +PG+RF+P   NRR+ AI+KE+K+S+  +I KR KAM  GE   +DLL +LLES
Sbjct  267  IMKAIVIPGYRFLPIPSNRRLKAIDKEIKASLNALISKREKAMSAGEDAKNDLLDLLLES  326

Query  205  NLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREE  381
            N +EI++ G  K  GMSIEDVI+ECK+FYFAGQETTSV+L WTM+LL+++ +WQAR REE
Sbjct  327  NFREIQEHGNTKSVGMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARGREE  386

Query  382  VLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLM  561
            V+QVFG+++PDF+GLN LKV+TMILYE LRLYPP+  ++R   EE KLG ++LP G  + 
Sbjct  387  VVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQIS  446

Query  562  LPTLLMHVDSEIWGED  609
            +PT+L+H D E+WG+D
Sbjct  447  VPTILLHQDRELWGDD  462



>gb|AAA17746.1| cytochrome P450, partial [Catharanthus roseus]
Length=516

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R VY+PGW ++PTKRN+RM  I KE+   +R II+KRMKA++ GE   DDLLG+LL
Sbjct  229  IDCMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRFIINKRMKALKAGEPGEDDLLGVLL  288

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN+QEI++QG  K+ GM+I DVIEECK+FYFAGQETT V+L WT ILLS+  +WQ RAR
Sbjct  289  ESNIQEIQKQGNRKDGGMTINDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERAR  348

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQ FG  +P+FE LN LK ++MILYE LRLYPP+  + +   E+TKLG   +P G  
Sbjct  349  EEVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPVIDLTKIIHEDTKLGPYTIPAGTQ  408

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  409  VMLPTVMLHREKSIWGED  426



>ref|XP_006407057.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum]
 gb|ESQ48510.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum]
Length=404

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+ ++PG+ ++PTK NRRM A  +E++  +RGI++KR+ A + GE  NDDLLGILL
Sbjct  128  IQAFRKAFIPGYIYLPTKGNRRMKAAAREIQIILRGIVNKRLTAREAGEAPNDDLLGILL  187

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL +      K  GMS E+V+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  188  ESNLGQ-----AKGNGMSTEEVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  242

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  243  EVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPVTQVTRAIHKEMKLGDLTLPGGVQI  302

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG+D
Sbjct  303  SLPILLVQRDTELWGDD  319



>ref|XP_010487265.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=461

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+   +VY+PG+R++PTK NRRM A   E++  +RGI++KR++A + G+  NDDLLGILL
Sbjct  185  IQAFWKVYIPGYRYLPTKSNRRMKAAAGEIQVILRGIVNKRLRAREAGKAPNDDLLGILL  244

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL E      K  GMS EDV+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  245  ESNLGE-----AKGNGMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  299

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LK +TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  300  EVKQVFGDKEPDTEGLNQLKAMTMILYEVLRLYPPVTHLTRAIHKEMKLGDLTLPGGVHI  359

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+  D+++WG D
Sbjct  360  SLPVMLVQRDTKLWGND  376



>ref|XP_004294187.1| PREDICTED: cytochrome P450 CYP72A219-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ ++ ++  + VY+PGWRFVPTK N+RM  I+KE+++ + GII KR +A++ GE   DD
Sbjct  234  EQAVYAMKSIQSVYIPGWRFVPTKMNKRMKQIDKEIRNVLMGIISKREQAIEVGEAIKDD  293

Query  181  LLGILLESNLQEIRQQG--GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            LLG L+ESNL+EIR  G   K+ GMSIEDVIEECK+FYFAGQETTSV+LVWTM+LL + Q
Sbjct  294  LLGALMESNLKEIRDHGKNNKDVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQ  353

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQ  AREEVLQVFG  +P+F+GL  LKV+TMIL E LRLYP +  + R T ++T+LG+ 
Sbjct  354  NWQHLAREEVLQVFGMNKPEFDGLTHLKVVTMILLEVLRLYPAVVVLSRTTHKKTQLGKF  413

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP G  + LPTLL+H D E+WG+D
Sbjct  414  SLPAGVEVELPTLLIHHDKELWGDD  438



>gb|AGX93064.1| secologanin synthase [Catharanthus roseus]
 gb|AHK60848.1| secologanin synthase-like protein [Catharanthus roseus]
Length=527

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R VY+PGW ++PTKRN+RM  I KE+   +R II+KRMKA++ GE   DDLLG+LL
Sbjct  240  IDCMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRFIINKRMKALKAGEPGEDDLLGVLL  299

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN+QEI++QG  K+ GM+I DVIEECK+FYFAGQETT V+L WT ILLS+  +WQ RAR
Sbjct  300  ESNIQEIQKQGNRKDGGMTINDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERAR  359

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQ FG  +P+FE LN LK ++MILYE LRLYPP+  + +   E+TKLG   +P G  
Sbjct  360  EEVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPVIDLTKIIHEDTKLGPYTIPAGTQ  419

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  420  VMLPTVMLHREKSIWGED  437



>emb|CBI39938.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V++ VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET N D
Sbjct  168  EQAHLVAQVTQSVYVPGWRFFPTKINRRMRQIRNEVNALLKGIIEKREKAMKVGETANHD  227

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTSV+L+WTM+LLS+  +
Sbjct  228  LLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSN  287

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++PD +GLN LK++TMI +E LRLYPP + + R    ++++G + 
Sbjct  288  WQARAREEVLQVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRTVFADSQVGGLY  347

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            L  G L+ LP LL+H + EIWGED
Sbjct  348  LSDGVLIALPILLIHHNHEIWGED  371



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   252 bits (643),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+   +V +PGWRFVPT  +RRM  I K++++S+  +I+KR  A++ GE   ++LL ILL
Sbjct  254  IQTFLKVNIPGWRFVPTTTHRRMKEINKDIEASLMDMINKRETALKAGEATKNNLLDILL  313

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESN +EI++QG K  GM++E+VIEECK+FYFAGQETTSV+LVWTMILLS + DWQ RARE
Sbjct  314  ESNHKEIQEQGNKNVGMNLEEVIEECKLFYFAGQETTSVLLVWTMILLSMYPDWQTRARE  373

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EVLQVFG+++P+FEGLN LK++TMIL E LRLYPP+ G+ R+  E+ KLG + LP G  +
Sbjct  374  EVLQVFGNRKPNFEGLNHLKIVTMILNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQI  433

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+H D E+WG+D
Sbjct  434  SLPIVLVHHDCELWGDD  450



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  31   RQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNL  210
            R VY+PGWRF+PTK+N++   I  E+K  ++GII+KR +AM+ GE   DDLLGIL+ESN 
Sbjct  240  RSVYIPGWRFLPTKQNKKAKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNF  299

Query  211  QEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVL  387
            +EI++ G  K  GMSIEDVI ECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAREEVL
Sbjct  300  REIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVL  359

Query  388  QVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLP  567
            QVFG   P +E L+ LKV+TMIL E LRLYP +  + R T ++T+LG++ LP G  + LP
Sbjct  360  QVFGSNIPTYEELSQLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLP  419

Query  568  TLLMHVDSEIWGED  609
             LL+H D E+WGED
Sbjct  420  ILLVHHDKELWGED  433



>emb|CBI22133.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V R VY+PGWRFVPTK N+RM  I  EV + ++GII++R KAM+ GET NDD
Sbjct  297  EQAHLAVKVFRSVYIPGWRFVPTKTNKRMRQISNEVHALLKGIIERREKAMKVGETANDD  356

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LL +L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTS +L+WTM+LLS+  +
Sbjct  357  LLSLLMESNFREMQEHDERKNVGMSIKDVIEECKLFYFAGQETTSDLLLWTMVLLSKHSN  416

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++PD +GLN LK++T+I +E LRLYPP++ + R  V ++++G   
Sbjct  417  WQARAREEVLQVFGNKKPDGDGLNHLKIVTIIFHEVLRLYPPVSMLIRTVVADSQVGGWY  476

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P GAL+ LP LL+H D EIWGED
Sbjct  477  FPDGALITLPILLIHHDHEIWGED  500



>gb|AGX93060.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Tabernaemontana 
elegans]
Length=519

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V R VY+PG RF+PTKRN +M AI+KEV+  I+ IID +MK ++ G+T  DD LGILL
Sbjct  237  IDVIRSVYIPGQRFLPTKRNNKMRAIDKEVRVRIKEIIDNKMKILKAGKTAGDDFLGILL  296

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            E NL EIR+QG  K  GM+IE +I ECK+FYFAGQ+TTS +LVWTM+LLSRF +WQ RAR
Sbjct  297  ECNLNEIREQGNNKNAGMTIEQIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQNRAR  356

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG++ PD++G++ LK +TMILYE LR+Y P+  + +   E+T+LG+  +P G  
Sbjct  357  EEVLQVFGNKTPDYDGISHLKTVTMILYEVLRIYTPVAELTKVAHEDTQLGKYFIPAGVQ  416

Query  556  LMLPTLLMHVDSEIWGED  609
            LM+P +L+H D +IWGED
Sbjct  417  LMMPQMLLHHDPQIWGED  434



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+   +V +PGWRFVPT  +RRM  I K++++S+  +I+KR  A++ GE   ++LL ILL
Sbjct  254  IQTFLKVNIPGWRFVPTTTHRRMKEINKDIEASLMDMINKRETALKAGEATKNNLLDILL  313

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESN +EI++QG K  GM++E+VIEECK+FYFAGQETTSV+LVWTMILLS + DWQ RARE
Sbjct  314  ESNHKEIQEQGNKNVGMNLEEVIEECKLFYFAGQETTSVLLVWTMILLSMYPDWQTRARE  373

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EVLQVFG+++P+FEGLN LK++TMIL E LRLYPP+ G+ R+  E+ KLG + LP G  +
Sbjct  374  EVLQVFGNRKPNFEGLNHLKIVTMILNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQI  433

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+H D E+WG+D
Sbjct  434  SLPIVLVHHDCELWGDD  450



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +1

Query  31   RQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNL  210
            R VY+PGWRF+PTK+N++   I  E+K  ++GII+KR +AM+ GE   DDLLGIL+ESN 
Sbjct  243  RSVYIPGWRFLPTKQNKKAKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNF  302

Query  211  QEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVL  387
            +EI++ G  K  GMSIEDVI ECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAREEVL
Sbjct  303  REIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVL  362

Query  388  QVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLP  567
            QVFG   P +E L+ LKV+TMIL E LRLYP +  + R T ++T+LG++ LP G  + LP
Sbjct  363  QVFGSNIPTYEELSQLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLP  422

Query  568  TLLMHVDSEIWGED  609
             LL+H D E+WGED
Sbjct  423  ILLVHHDKELWGED  436



>ref|XP_009394210.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V + +YVPG+RF+PT +N+R+ AI++E++S +RGII KR + ++ G+ +NDD
Sbjct  235  EQAELLIQVVQNLYVPGYRFLPTPKNKRIRAIDREIRSILRGIIKKREQDIKTGKASNDD  294

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG+L+ESN++ +++ G K  GM+ EDVIEECK+FYFAGQETTSV+L WTMI LS    W
Sbjct  295  LLGLLMESNMKHLQEDGNKNAGMTTEDVIEECKLFYFAGQETTSVLLTWTMICLSMHPTW  354

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVL+VFGD +PDF+GLN LK++TMILYE LRLYPP   + R+T +  KLG++V 
Sbjct  355  QIRAREEVLRVFGDDKPDFDGLNHLKIVTMILYEVLRLYPPFILLRRQTYKPMKLGDVVY  414

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL+L  + +H D  +WG+D
Sbjct  415  PPGVLLLLHVIFVHHDPNLWGKD  437



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++VSR VY+PGWRF+PTKRN+RM  I  EV++ I  II+KRM+ ++ GE++ DD
Sbjct  231  EQIQLILQVSRTVYIPGWRFLPTKRNKRMKQIFNEVRTLIFEIINKRMRMIEAGESH-DD  289

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILL SNL+EI+Q G K+F MSI++VIEECK+FYFAGQETTS +LVWTMILLS+  +W
Sbjct  290  LLGILLSSNLKEIQQHGNKKFSMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQHPNW  349

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQVFG  E D++ LN LKV+TMIL E LRLYP    M R    +T LG + L
Sbjct  350  QDRAREEVLQVFGSNEVDYDKLNQLKVVTMILNEVLRLYPAGYMMTRMVQTKTNLGNLCL  409

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+LPT+L+  D+EIWG+D
Sbjct  410  PGGVQLLLPTILLQHDTEIWGDD  432



>gb|AGX93047.1| secologanin synthase-like protein [Rauvolfia serpentina]
Length=524

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            IE  R VY+PGW ++PTKRN+RM  I KE+   +R II+KR KAM+ GE   DDLLG+LL
Sbjct  240  IECMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRFIINKRTKAMKAGEPMEDDLLGVLL  299

Query  199  ESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN QEI++QG K + GMSI DVIEECK+FYFAGQETT V+L WT ILLS+  +WQ RAR
Sbjct  300  ESNYQEIQKQGNKKDGGMSINDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERAR  359

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEV Q FG  +P+FE LN LK ++MILYE LRLYPP+  + +   E+TKLG   +P G  
Sbjct  360  EEVFQAFGKDKPEFERLNHLKYISMILYEVLRLYPPVIDLTKIVHEDTKLGPYTIPAGTQ  419

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H +  IWGED
Sbjct  420  VMLPTVMLHREKSIWGED  437



>ref|XP_008345110.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=300

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = +1

Query  22   EVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLE  201
            +V + VY+PGWRF+PTK N++M  I++E+++ + GII+KR +A++ GE   DDLLG+L+E
Sbjct  19   KVVQSVYIPGWRFLPTKTNKKMKGIDREIRALLMGIINKREEAIKAGEATKDDLLGVLME  78

Query  202  SNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            SNL+EI++ G  K+ GMS+ DVIEECK+FY AGQETTS +LVWTMILL ++Q+WQ  ARE
Sbjct  79   SNLKEIKEHGSNKKVGMSMHDVIEECKLFYLAGQETTSGLLVWTMILLGQYQNWQDHARE  138

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EVL+VFG  +PDF+GL  LKV+TMIL+E LRLYP +  + R T ++T+L    LP G  +
Sbjct  139  EVLEVFGSNKPDFDGLIHLKVVTMILHEVLRLYPALALIARITSKKTQLANYSLPAGVEV  198

Query  559  MLPTLLMHVDSEIWGED  609
             LPTLL+H D ++WG+D
Sbjct  199  ALPTLLVHHDKQLWGDD  215



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ ++F +V + +Y+PGW FVPTKRN+RM  I KEV S + GII++R+K +Q GE  +DD
Sbjct  228  EQALYFEQVMQSIYLPGWSFVPTKRNKRMQKIFKEVNSLVMGIINERLKEIQTGEATSDD  287

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESNL EIRQ G K  G+S+E+VIEECK+FY AGQETTS +LVWT+ILLS+  DW
Sbjct  288  LLGILLESNLNEIRQHGNKN-GLSLEEVIEECKLFYLAGQETTSGLLVWTLILLSQHFDW  346

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAR+EVLQVF + EPD   LN LK++TMIL E LRLYPP     R   EETKLG++ L
Sbjct  347  QARARDEVLQVFDNNEPDISKLNHLKIVTMILNEVLRLYPPAANFFRMNPEETKLGDLSL  406

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  + +  +L+  D ++WG+D
Sbjct  407  PEGMFIFVAPILLQQDKDLWGDD  429



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++V  +VY+PGWRFVPT  NRRM  I++ +K+S+  +I KR KA + GE   DDLLGILL
Sbjct  212  MKVIMKVYIPGWRFVPTATNRRMKEIDRYIKASLMDMIKKREKAPKTGEATRDDLLGILL  271

Query  199  ESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN +EI++    K  GM++ DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DWQ+RAR
Sbjct  272  ESNHKEIQEHRNNKNVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAR  331

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG Q P+F+GL+ LK++TMILYE LRLYPP  G+ R    + KLG + LP G  
Sbjct  332  EEVLQVFGKQAPNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQ  391

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP +++H D E+WG+D
Sbjct  392  VSLPIIMVHHDRELWGDD  409



>emb|CBI39937.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+R +YVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET N D
Sbjct  168  EQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHD  227

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +++++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS+  +
Sbjct  228  LLGLLMESNYRDMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSN  287

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ  AREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP++ + R    ++++G + 
Sbjct  288  WQTHAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLY  347

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D EIWGED
Sbjct  348  LPDGVQIALPILLLHHDHEIWGED  371



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 158/204 (77%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ + GII KRM  ++ GE   DD
Sbjct  232  EQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALVFGIIKKRMSMIENGEA-PDD  290

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAGQETTS +LVWTMILL ++ +
Sbjct  291  LLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKYPN  350

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLYP    ++R   +ETKLG + 
Sbjct  351  WQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLYPAGYVINRMVNKETKLGNLC  410

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L+LPT+L+  D+EIWG+D
Sbjct  411  LPAGVQLVLPTMLLQHDTEIWGDD  434



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+R +YVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET N D
Sbjct  227  EQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +++++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS+  +
Sbjct  287  LLGLLMESNYRDMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP++ + R    ++++G + 
Sbjct  347  WQTRAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D EIWGED
Sbjct  407  LPDGVQIALPILLLHHDHEIWGED  430



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     ++  +VY+PGWRF+PT   RRM  IE++V++S+  +I+ R +A+  GE   DD
Sbjct  228  EQAELTTKIIEKVYIPGWRFLPTTTPRRMKEIERDVRASLTDMINTRERALMAGEATKDD  287

Query  181  LLGILLESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +E+ +    K  GMS++DVIEECK+FYFAG ETTSV+LVWT++LLSR+ D
Sbjct  288  LLGILLESNHKEMEEHDNNKNVGMSLDDVIEECKLFYFAGAETTSVLLVWTIVLLSRYPD  347

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + R   ++ KLG + 
Sbjct  348  WQARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIELARSVHKDVKLGNLT  407

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP +L+H DSE+WG+D
Sbjct  408  LPAGVQITLPIVLVHHDSELWGDD  431



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 158/204 (77%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ + GII KRM  ++ GE   DD
Sbjct  232  EQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALVFGIIKKRMSMIENGEA-PDD  290

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAGQETTS +LVWTMILL ++ +
Sbjct  291  LLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKYPN  350

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLYP    ++R   +ETKLG + 
Sbjct  351  WQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLYPAGYVINRMVNKETKLGNLC  410

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L+LPT+L+  D+EIWG+D
Sbjct  411  LPAGVQLVLPTMLLQHDTEIWGDD  434



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +++  +VY+PGWRFVPT  +RRM AI+KE+K+S+  II+ + KA++ GE   +D
Sbjct  233  EQTELTVQLMLKVYIPGWRFVPTPTHRRMKAIDKEIKASLMDIINNKEKALKAGEATKND  292

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ G  K  GM+IEDVI ECK+FYFAGQETTS +LVWTMILLS + D
Sbjct  293  LLGILLESNHKEIQEHGNNKNVGMNIEDVIGECKLFYFAGQETTSSLLVWTMILLSMYPD  352

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEVLQVFG+++PDF+GLN LK++TMIL E  RLYPP+ G+ R+  ++ KLG + 
Sbjct  353  WQTRAREEVLQVFGNRKPDFDGLNHLKIVTMILNEVFRLYPPVIGLARKVSKDVKLGNLS  412

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            L  G  + +P +L+H D E+WG+D
Sbjct  413  LVAGMQVSIPIILVHHDCELWGDD  436



>emb|CBI22129.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ S   Y+PGW F+PTK N+RM  I KEV + + GIIDKR KAM+ GET NDD
Sbjct  230  EQAQLLVQFSDSAYIPGWWFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDD  289

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +EI++ +  K  GM I+DVIEECK+FYFAGQETTS +L+WTM+LLS+  +
Sbjct  290  LLGILLESNFKEIQEHENDKNVGMCIKDVIEECKIFYFAGQETTSALLLWTMVLLSKHPN  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
             QARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G++ 
Sbjct  350  LQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMY  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPT+L+H D EIWGED
Sbjct  410  LPAGVDVSLPTILVHHDHEIWGED  433



>gb|KHG20903.1| Secologanin synthase [Gossypium arboreum]
Length=314

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V + VY+PGWRF+PTK NR +    K++K S+R +I +R KA++ GE +N+DLL IL+
Sbjct  33   IKVFQSVYIPGWRFLPTKTNRELKMKHKDIKESLREMIKRREKAIKAGEESNEDLLDILV  92

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESN   IR+   K  GMSIEDVIEECK+FYFAGQETTSV+LVWTM+LL+R+ DWQ +AR+
Sbjct  93   ESN---IREMEAKHMGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQTKARD  149

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EVL V GD++PD +GLN LKV+TMILYE LRLYPP+  + R   +E K+G ++LP G  +
Sbjct  150  EVLHVLGDRKPDADGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEV  209

Query  559  MLPTLLMHVDSEIWGED  609
            ++P L +H D + WG+D
Sbjct  210  LIPILQIHHDKDHWGDD  226



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 150/203 (74%), Gaps = 4/203 (2%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +E +R +Y+PG RF+PTKRNRRM  I KEV+ SIR II+ R+KA++ GE  + D
Sbjct  232  EQARHLVEATRSIYIPGSRFLPTKRNRRMKQIAKEVEGSIREIINARLKALRAGEAIDAD  291

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            +LGILLES  QE       E GM+  ++I+ECK+FYFAGQETT+V+LVWTMILLS   DW
Sbjct  292  MLGILLESTSQET----DGESGMTTGEIIQECKLFYFAGQETTAVLLVWTMILLSMHPDW  347

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQ FG   P+F+GLN LK++TMIL+E LRLYPP   + R   EETK+G + +
Sbjct  348  QERAREEVLQHFGTDMPNFDGLNQLKIVTMILHEVLRLYPPFPNIGRSVAEETKIGNLTI  407

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL LP +L+H D EIWG+D
Sbjct  408  PAGQLLTLPMILLHHDPEIWGQD  430



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ + GII KR+  ++ GE   DD
Sbjct  232  EQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALVLGIIKKRLSMIENGEA-PDD  290

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAGQETTS +LVWTMILL +   
Sbjct  291  LLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKHPS  350

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLYP    ++R   +ETKLG + 
Sbjct  351  WQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLYPAGYAINRMVTKETKLGNLC  410

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L+LPT+L+  D+EIWG+D
Sbjct  411  LPAGVQLLLPTILLQHDTEIWGDD  434



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ + GII KR+  ++ GE   DD
Sbjct  232  EQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALVLGIIKKRLSMIENGEA-PDD  290

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAGQETTS +LVWTMILL +   
Sbjct  291  LLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKHPS  350

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLYP    ++R   +ETKLG + 
Sbjct  351  WQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLYPAGYAINRMVTKETKLGNLC  410

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L+LPT+L+  D+EIWG+D
Sbjct  411  LPAGVQLLLPTILLQHDTEIWGDD  434



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 154/196 (79%), Gaps = 1/196 (1%)
 Frame = +1

Query  22   EVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLE  201
            +++  +Y+PGWRFVPTK+N+RM  I  EVK+ I GII+KRM+ ++ GE++ DDLL ILL 
Sbjct  239  KMTHSIYIPGWRFVPTKKNKRMMQIFYEVKALILGIINKRMRMIEAGESH-DDLLSILLT  297

Query  202  SNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREE  381
            SNL+EI+Q G K+FGMSI++VIEECK+FYFAGQETTS +LVWTMILL ++  WQ RAREE
Sbjct  298  SNLKEIQQHGNKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQERAREE  357

Query  382  VLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLM  561
            VLQVF   E D++ LN LKV+TMIL E LRLY  +  ++R    ETKLG++ LP G  L+
Sbjct  358  VLQVFASDELDYDKLNQLKVVTMILNEVLRLYTSVYAINRMVNTETKLGDLCLPSGVQLI  417

Query  562  LPTLLMHVDSEIWGED  609
            L T+L+H D+EIWG+D
Sbjct  418  LATMLVHHDTEIWGDD  433



>gb|AGX93059.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Rauvolfia serpentina]
Length=520

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN-DDLLGIL  195
            I+V R VY+PG RF+PTKRN RM AI+KEV+  I  II+K+ K M+ GE    DD LGIL
Sbjct  237  IDVIRSVYIPGHRFLPTKRNNRMRAIDKEVRVRITEIINKKTKIMKAGEAAAADDFLGIL  296

Query  196  LESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARA  372
            LE NL EIR+QG  K  GM+IE++I ECK+FYFAGQ+TTS +LVWTM+LLSRF +WQ RA
Sbjct  297  LECNLNEIREQGHNKTAGMTIEEIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRA  356

Query  373  REEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGA  552
            REEV QVFG++ PD++G++ LKV+TMILYE LRLY P+  + +   E+T+LG+ ++P G 
Sbjct  357  REEVFQVFGNKTPDYDGISHLKVITMILYEVLRLYTPVAELTKVAHEDTQLGKYLIPAGV  416

Query  553  LLMLPTLLMHVDSEIWGED  609
             LM+P +L+H D EIWGED
Sbjct  417  QLMMPQVLLHHDPEIWGED  435



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V++ VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET N D
Sbjct  227  EQAHLVAQVTQSVYVPGWRFFPTKINRRMRQIRNEVNALLKGIIEKREKAMKVGETANHD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTSV+L+WTM+LLS+  +
Sbjct  287  LLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG+++PD +GLN LK++TMI +E LRLYPP + + R    ++++G + 
Sbjct  347  WQARAREEVLQVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRTVFADSQVGGLY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            L  G L+ LP LL+H + EIWGED
Sbjct  407  LSDGVLIALPILLIHHNHEIWGED  430



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V  +  +P W F+PT  +R+MN I+KE+ SS++ +I+KR KA++ GE   +D
Sbjct  226  EQAELIVKVVTKSIIPLWMFLPTIVHRKMNKIDKEITSSLKDMINKREKALKAGEPTRND  285

Query  181  LLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LL ILLESN +EI + +  K+ GMS++DV+EECK+F+FAGQETTSV+LVWTMILLSR+ D
Sbjct  286  LLSILLESNRKEIDENENNKDVGMSLDDVVEECKLFHFAGQETTSVLLVWTMILLSRYPD  345

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEVL VFG+++PDF+GLN+LK++TMILYE LRLYPP+ G+ R   ++ KLG + 
Sbjct  346  WQTRAREEVLHVFGNRKPDFDGLNNLKIVTMILYEVLRLYPPVIGLARNVEKDVKLGNLT  405

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D E+WG+D
Sbjct  406  LPAGVEIFLPILLIHHDCELWGDD  429



>gb|AGX93058.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Amsonia hubrichtii]
Length=518

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+V R VY+PG RF+PTKRN RM  I+KEV+  I  II+ +MK M+ GE   DD LGILL
Sbjct  236  IDVIRSVYIPGQRFLPTKRNNRMRTIDKEVRVRITEIINNKMKIMKTGEAAGDDFLGILL  295

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            E N  EIR+QG  K  GM+IE +I ECK+FYFAGQ+TTS +LVWTM+LLSRF +WQ RAR
Sbjct  296  ECNQNEIREQGNNKNAGMTIEQIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAR  355

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFGD+ PD++G++ LK++TMILYE LRLY P+  + +   E+T+LG+  +P G  
Sbjct  356  EEVLQVFGDKTPDYDGISHLKIVTMILYEVLRLYTPVAELTKVAHEDTQLGKYFIPAGVQ  415

Query  556  LMLPTLLMHVDSEIWGED  609
            LM+P +L+H D +IWGED
Sbjct  416  LMMPQMLLHHDPQIWGED  433



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++V  +VY+PGWRFVPT  NRRM  I++ +K+S+  +I KR KA + GE   DDLLGILL
Sbjct  239  MKVIMKVYIPGWRFVPTATNRRMKEIDRYIKASLTDMIKKREKAPKTGEATRDDLLGILL  298

Query  199  ESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN +EI++    E  GM++ DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DWQ+RAR
Sbjct  299  ESNHKEIQEHRNNENVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAR  358

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG Q P+F+GL+ LK++TMILYE LRLYPP  G+ R    + KLG + LP G  
Sbjct  359  EEVLQVFGKQAPNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQ  418

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP +++H D E+WG+D
Sbjct  419  VSLPIIMVHHDRELWGDD  436



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++   ++Y+PGWRF+PT  +RRM  I++E+K+S+  +I  R KA++ GE   +D
Sbjct  228  EQAELAMKAIMKLYIPGWRFLPTANHRRMKEIDREIKASLTDMISNREKALKAGEATEND  287

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESN +E  + G  K  GMS+EDVIEECK+FYFAGQETTS +LVWTM+LLSR+ D
Sbjct  288  LLGILLESNHKETEEHGNSKNVGMSLEDVIEECKLFYFAGQETTSALLVWTMVLLSRYPD  347

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQVFG Q+P+F+GL+ LK+++MIL E LRLYPP  G++R    + KLG + 
Sbjct  348  WQARAREEVLQVFGKQKPNFDGLSHLKIVSMILNEVLRLYPPAVGLNRNVDRDMKLGNLS  407

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPT ++H D E+WG+D
Sbjct  408  LPAGVQVSLPTTMVHHDRELWGDD  431



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+ ++PG+ ++PTK NRRM A  +E++  +RGI++KR++A + GE  +DDLLGILL
Sbjct  236  IQAFRKAFIPGYSYLPTKSNRRMKAAAREIQVILRGIVNKRLRAREAGEAPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL   RQ  G   GMS ED++EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  296  ESNL---RQTEGN--GMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKELKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D E+WG D
Sbjct  411  SLPILLVQHDIELWGND  427



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 162/203 (80%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  + +  +R VY PG RF+PT+RN+RM  IEKE+++ IR II+KR+KA++ GET+NDD
Sbjct  233  EQAQYAVRATRSVYFPGLRFLPTRRNKRMKDIEKEIQAKIRDIINKRVKALKAGETSNDD  292

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGI+LESN +EI   G K FGM+++DVI+ECK+FYFAGQE++S +LVWT++LL R ++W
Sbjct  293  LLGIMLESNFKEIDLHGDKSFGMTMQDVIDECKLFYFAGQESSSTLLVWTLVLLGRHREW  352

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q++AR+EV QVFG  +P FEGLN LK++TMIL E LRLYPP   ++RR  +ETK+G++ L
Sbjct  353  QSKARDEVSQVFGRNKPHFEGLNHLKIVTMILNEVLRLYPPAVALNRRVHQETKVGKLSL  412

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G +L LP +L+H D EIWG+D
Sbjct  413  PAGVMLWLPVILLHHDREIWGDD  435



>ref|XP_010465355.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+   +VY+PG+R++PTK NRRM A  KE++  +RGI++KR++A   G+  NDDLLGILL
Sbjct  236  IQAFWKVYIPGYRYLPTKNNRRMKAASKEIQDILRGIVNKRLRARDAGKAPNDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL +      K  GMS EDV+EECK+FYFAGQETTSV+LVWTM+LLS+ Q WQARAR+
Sbjct  296  ESNLGQ-----AKGNGMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQAWQARARD  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVTHLTRAIHKEMKLGDLTLPGGVHI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+  D+++WG D
Sbjct  411  SLPVMLVQRDTKLWGND  427



>ref|XP_008364401.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Malus domestica]
Length=429

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQG    +V + VY+PGWRF+PTK N++M  I++E+++ + GII+KR +A++ GE   DD
Sbjct  141  EQGQLVTKVVQSVYIPGWRFLPTKTNKKMKGIDREIRALLMGIINKREEAIKAGEATKDD  200

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESNL+EI++ G  K+ GMS+ DVIEECK+FY AGQETTS +LVWTMILL ++Q+
Sbjct  201  LLGVLMESNLKEIKEHGSNKKVGMSMHDVIEECKLFYLAGQETTSGLLVWTMILLGQYQN  260

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ  AREEVL+VFG  +PDF+GL  LKV+TMIL+E LRLYP +  + R T ++T+L    
Sbjct  261  WQDHAREEVLEVFGSNKPDFDGLIHLKVVTMILHEVLRLYPALALIARITSKKTQLANYS  320

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPTLL+H D ++WG+D
Sbjct  321  LPAGVEVALPTLLVHHDKQLWGDD  344



>ref|XP_006364091.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=510

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = +1

Query  55   RFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN-DDLLGILLESNLQEIRQQG  231
            RF+PTK  RRMN + +EV+S +  II+KRM  ++ GET+N DDLLGILLESNL+EI++ G
Sbjct  240  RFLPTKEKRRMNRLHQEVRSLVLRIINKRMNEIEAGETSNSDDLLGILLESNLKEIQEHG  299

Query  232  GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEP  411
             K+FGMSI++VIEECK+FY AGQETTS +LVW+MILLS+  DWQARAREEVLQVFG+  P
Sbjct  300  NKKFGMSIDEVIEECKLFYLAGQETTSALLVWSMILLSKHSDWQARAREEVLQVFGNNIP  359

Query  412  DFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDS  591
            D++ L+ LKV+TMI+ E LRLYPPI  M R   +ETKLG + +P G  L+LPT+L+H D 
Sbjct  360  DYDKLSQLKVVTMIMQEVLRLYPPIFLMGREVHKETKLGNLSIPSGVQLLLPTILLHHDQ  419

Query  592  EIWGED  609
            EIWGED
Sbjct  420  EIWGED  425



>ref|XP_009147883.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=356

 Score =   244 bits (622),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  ++ Y+PG+R++PTK NRR+ A  +E +  +RG+++KR+ A + GE  ++DLLGILL
Sbjct  70   IQAVQKSYIPGYRYLPTKDNRRIKAAAREAQVILRGLVNKRLSAREAGEAPHEDLLGILL  129

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL++      K  GMSI+DVIEECK+FYFAGQETTSV+LVWTMI+LS+ QDWQARARE
Sbjct  130  ESNLEQ-----AKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMIMLSQHQDWQARARE  184

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LK++TMI+ E LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  185  EVKQVFGDKEPDTEGLNHLKIMTMIINEVLRLYPPVTHVKRAIHKEMKLGDLTLPGGVHI  244

Query  559  MLPTLLMHVDSEIWGED  609
             LPT+L+  D+++WG D
Sbjct  245  SLPTMLVQRDTQLWGND  261



>ref|XP_010487263.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=404

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+ ++PG+R++PT+ NRRMNA  +E+K  +RGI+DKR++A + GE  +DDLLGILL
Sbjct  128  IQAFRKAFIPGYRYLPTQSNRRMNATAREIKVILRGIVDKRLRAREDGEVPSDDLLGILL  187

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL + +  G     MS E+++EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  188  ESNLGQTKGNG-----MSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  242

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFG +EP+ EGLN LKV+T ILYE LRLYPP++ + R   +E KLG++ LP G  +
Sbjct  243  EVKQVFGVKEPNTEGLNQLKVMTTILYEVLRLYPPVSQLTRAINKEMKLGDLTLPSGVQI  302

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  303  TLPILLVQRDTELWGND  319



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V+R +YVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET N D
Sbjct  227  EQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN +++++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS+  +
Sbjct  287  LLGLLMESNYRDMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ  AREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP++ + R    ++++G + 
Sbjct  347  WQTHAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D EIWGED
Sbjct  407  LPDGVQIALPILLLHHDHEIWGED  430



>emb|CDP15974.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   246 bits (629),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +   R +Y+PG RF+PTKRNRRM  IEK V+++IR IID+++KAM+ GE   DD
Sbjct  168  EQVDHVVTAERSLYIPGMRFLPTKRNRRMKEIEKVVQATIRDIIDRKVKAMKAGEGRRDD  227

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K+FGMSI+D+IEECK+FYF GQ+TTS +LVW +ILLS+ QDW
Sbjct  228  LLGILLESNFKEIDQYGSKDFGMSIKDIIEECKLFYFGGQDTTSTLLVWALILLSKHQDW  287

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q+ AREEVLQ FG +E DF+ L+ LK +TMIL E LRLYPP+  + RR  EETK+G+  L
Sbjct  288  QSLAREEVLQAFGREEIDFDRLSRLKTVTMILNEVLRLYPPVVVLARRLHEETKVGKFSL  347

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL L  +L++ D EIWG D
Sbjct  348  PAGVLLNLQLMLLNHDCEIWGND  370



>gb|KJB26994.1| hypothetical protein B456_004G270700 [Gossypium raimondii]
Length=521

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     E  + +YVPGWRF+PTK N+++  ++KE+K S+RG++  R KA++ G+  NDD
Sbjct  232  EQTNLLTEAVQSLYVPGWRFLPTKTNKKLKLMDKEIKDSLRGLVKNREKAVKAGQVKNDD  291

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI +QG  K  G+SI+DV++ECK+FY AGQETTSV+LVWTM+LL+R  D
Sbjct  292  LLGILVESNFKEIEEQGDRKNMGLSIQDVVDECKLFYIAGQETTSVLLVWTMVLLARNPD  351

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEVLQVF D +PD +GL+ LKV+TMIL E LRLYPP+  + R   ++ KLG+++
Sbjct  352  WQTKAREEVLQVFSDGKPDPDGLSHLKVMTMILNEVLRLYPPVVMLGRSVAKDMKLGKLL  411

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP  A++ +P LL+H D EIWG+D
Sbjct  412  LPARAVISIPVLLIHHDQEIWGDD  435



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 149/197 (76%), Gaps = 2/197 (1%)
 Frame = +1

Query  22   EVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ-GGETNNDDLLGILL  198
            +V + VYVPGWR+VPTKRNRR+  I  ++ S +RGII +R  AMQ G  T +DDLLGILL
Sbjct  236  QVLQSVYVPGWRYVPTKRNRRLKEINDDLCSLLRGIIKQRQTAMQTGNSTEDDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            +SN +E+++ G K  GMSIE+VIEECK FYF+GQE+TS +L WTM LLS  QDWQ RARE
Sbjct  296  KSNEKEMKENGKKS-GMSIEEVIEECKTFYFSGQESTSNLLSWTMFLLSIHQDWQKRARE  354

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            E+ QVFGD  PDF+GLN LK++TMILYE LRLYPP    +R   +ETKLGE+ LP G  L
Sbjct  355  ELFQVFGDSAPDFDGLNRLKIVTMILYEVLRLYPPAIIFNRIIHKETKLGEVTLPAGVHL  414

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+H D  +WGED
Sbjct  415  QLPIILLHHDQNLWGED  431



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NNDDLLGIL  195
            I+ S  VY+PG RF+PTK N RM  I KE+K+ +  +IDKR + M+ GET  +DDLLGIL
Sbjct  238  IQASNIVYIPGRRFLPTKSNNRMKKITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGIL  297

Query  196  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            LESN  EI++ G    GMSI D+IEECK+FYFAGQETT+V+LVWTMILL  +  WQ RAR
Sbjct  298  LESNFNEIKEHGNVNLGMSINDLIEECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRAR  357

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE-ETKLGEIVLPRGA  552
             EVLQVFG+ +PDF+GLN LK++TMIL E LRLY P + + R+ V+ ETKLG    P G 
Sbjct  358  AEVLQVFGNNKPDFDGLNRLKIVTMILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGV  417

Query  553  LLMLPTLLMHVDSEIWGED  609
            +L  P +L+H+D EIWGED
Sbjct  418  MLSFPVILIHLDKEIWGED  436



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NNDDLLGIL  195
            ++V+   Y+    F+PTK NRRM  I +EV+S + GII+KRM A++  E  NNDDLLGIL
Sbjct  234  LKVTESSYI---MFLPTKENRRMKQIYQEVRSLVLGIINKRMDAIEAREAFNNDDLLGIL  290

Query  196  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            L+SNL+EI++ G K+FGMS+++VIEECK+FYFAGQETTS +L W+MI+LS+  DWQARAR
Sbjct  291  LDSNLKEIKEHGNKKFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQARAR  350

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG+  PD++ LN LKV+TMI+ E LRLYPP+  M R   +ETKLG + LP G  
Sbjct  351  EEVLQVFGNNRPDYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHKETKLGNLSLPGGVQ  410

Query  556  LMLPTLLMHVDSEIWGED  609
            L+LPT+++H D EIWGED
Sbjct  411  LLLPTIMLHHDQEIWGED  428



>ref|XP_006348402.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=466

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 157/200 (79%), Gaps = 6/200 (3%)
 Frame = +1

Query  22   EVSRQ----VYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  189
            E++RQ    VY+PGWRF+PT+RNRRM  I+ E+K ++R I++KR ++M  GET  +DLLG
Sbjct  184  ELTRQAFQSVYIPGWRFLPTRRNRRMKGIDNELKHTLRKIVNKRDRSMNLGETQ-EDLLG  242

Query  190  ILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  369
            ILL+SN++EI QQ G +FGM+ ++VIEECKVFYFAGQET+S +LVWTM+LLS  Q+WQ R
Sbjct  243  ILLKSNMKEI-QQNGSKFGMTTDEVIEECKVFYFAGQETSSNLLVWTMVLLSVHQNWQTR  301

Query  370  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRG  549
            AREEV QVF +  PDFEGLN LK++TMIL E LRLYPP     R+  +ETKLG++ +P  
Sbjct  302  AREEVQQVFHNNNPDFEGLNRLKIVTMILNEVLRLYPPAPYFLRKANQETKLGKMNIPPE  361

Query  550  ALLMLPTLLMHVDSEIWGED  609
             +LM+PT+ +H + E+WG+D
Sbjct  362  VILMIPTIFIHHNEELWGDD  381



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+ ++PG+ ++PTK NRRM A  +E++  +RGI++KR++A + GE  +DDLLGILL
Sbjct  236  IQAFRKAFIPGFSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL   RQ  G   GMS ED++EECK+FYFAGQETTSV+LVWTMILLS+ QDWQARARE
Sbjct  296  ESNL---RQTEGN--GMSTEDLMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV++MILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPDAEGLNQLKVMSMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  411  SLPILLVQRDTELWGND  427



>gb|AGX93062.1| CYP72A224 7-deoxyloganic acid 7-hydroxylase [Catharanthus roseus]
 gb|AHK60834.1| 7-deoxyloganic acid hydroxylase [Catharanthus roseus]
Length=521

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 153/200 (77%), Gaps = 3/200 (2%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN--DDLLGI  192
            I+V R VY+PG RF+PTKRN RM AI+KEV+  I  II+K+MK M+ GE  +  DD LGI
Sbjct  237  IDVIRSVYIPGQRFLPTKRNNRMRAIDKEVRVRITEIINKKMKVMKSGEAASAADDFLGI  296

Query  193  LLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  369
            LLE NL EI++QG  K  GM+I ++I ECK+FYFAGQ+TTS +LVWTM+LLSRF +WQ R
Sbjct  297  LLECNLNEIKEQGNNKSAGMTIGEIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTR  356

Query  370  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRG  549
            AREEV QVFG++ PD++G++ LKV+TMILYE LRLY P+  + +   E T+LG+  +P G
Sbjct  357  AREEVFQVFGNKTPDYDGISHLKVITMILYEVLRLYTPVAELTKVAHEATQLGKYFIPAG  416

Query  550  ALLMLPTLLMHVDSEIWGED  609
              LM+P +L+H D EIWGED
Sbjct  417  VQLMMPQILLHHDPEIWGED  436



>ref|NP_188083.1| cytochrome P450, family 72, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
 sp|Q9LUC9.1|C7A11_ARATH RecName: Full=Cytochrome P450 72A11 [Arabidopsis thaliana]
 dbj|BAB02397.1| cytochrome P450 [Arabidopsis thaliana]
 dbj|BAF00623.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEE75551.1| cytochrome P450, family 72, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
Length=512

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+ ++PG+ ++PTK NRRM A  +E++  +RGI++KR++A + GE  NDDLLGILL
Sbjct  236  IQTVRKAFIPGYSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPNDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL + +  G     MS ED++EECK+FYF GQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  296  ESNLGQTKGNG-----MSTEDLMEECKLFYFVGQETTSVLLVWTMVLLSQHQDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE LRLYPPI  + R   +E +LG++ LP G L+
Sbjct  351  EVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPIPQLSRAIHKEMELGDLTLPGGVLI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  411  NLPILLVQRDTELWGND  427



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     E  + +YVPGWRF+PTK N+++  ++KE+K S+R ++  R KA++ GE  NDD
Sbjct  232  EQTNLLTETVQSLYVPGWRFLPTKTNKKLKLMDKEIKDSLRELVKNREKAVKAGEVKNDD  291

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+ESN +EI + G  K  GMSI+DV++ECK+FY AGQETTSV+LVWTM+LL+R  D
Sbjct  292  LLGILVESNFKEIEEHGDRKNMGMSIQDVVDECKLFYIAGQETTSVLLVWTMVLLARNPD  351

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ +AREEV QVF D +PD +GL+ LKV+TMIL E LRLYPP+  + R   ++ KLG+++
Sbjct  352  WQTKAREEVFQVFSDGKPDPDGLSHLKVMTMILNEVLRLYPPVVMLGRSMAKDMKLGKLL  411

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP GA++ +P LL+H D EIWG+D
Sbjct  412  LPAGAVISIPVLLIHHDQEIWGDD  435



>gb|KFK38821.1| hypothetical protein AALP_AA3G164800 [Arabis alpina]
Length=512

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            ++  R+ ++PG+ ++PT  NRRM A  +E++  +RGII+KR++A + GE  +DDLLGILL
Sbjct  236  VQAFRKAFIPGYMYLPTNCNRRMKAAAREIQGILRGIINKRLRAREAGEAPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL +      K  GMSIEDV+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  296  ESNLGQ-----AKGNGMSIEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE LRLYP +T + R   +E KLG++ LP G  +
Sbjct  351  EVRQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPAVTQLARAVNKEMKLGDLTLPAGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  411  SLPILLVQRDTELWGND  427



>gb|AGX93044.1| secologanin synthase-like protein, partial [Lonicera japonica]
Length=520

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I V R VY+PGW ++PTK N RM  I  E+KS +R II+KR+KAM+ GE + DDLLG+LL
Sbjct  238  IMVMRDVYIPGWSYLPTKTNNRMKEINNELKSMLRKIINKRVKAMKAGEASEDDLLGVLL  297

Query  199  ESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            +SN +EI++ G K+  GM+I+DVIEECK+FYFAGQETT ++L WTM++LS+  +WQ RAR
Sbjct  298  DSNFKEIQRLGNKKNAGMTIDDVIEECKLFYFAGQETTGILLTWTMVMLSKHPEWQDRAR  357

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEV+  FG  +PDFE LN LKV+ MILYE LRLYPP+  + +   EETKLG++ +P G  
Sbjct  358  EEVISAFGKSKPDFERLNQLKVVGMILYEVLRLYPPVIDLTKIVHEETKLGDLSIPPGVQ  417

Query  556  LMLPTLLMHVDSEIWGED  609
            +MLPT+++H + +IWG+D
Sbjct  418  IMLPTVMLHREKKIWGDD  435



>ref|XP_004295683.1| PREDICTED: cytochrome P450 CYP72A219-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 155/205 (76%), Gaps = 2/205 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ ++ ++  ++VY+PGWRFVPTK N+RM  I +E++  + GII+KR +A++ GE   DD
Sbjct  234  EQAVYAMKTVQRVYIPGWRFVPTKMNKRMKQIHEEIRGLVEGIINKREQAIKAGEATKDD  293

Query  181  LLGILLESNLQEIRQQG--GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQ  354
            LLG LLESN+++I+  G   K  GMSIEDVIEECK+FYFAGQETTSV+LVWTM+LL + Q
Sbjct  294  LLGALLESNMKDIQDHGKNNKNVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQ  353

Query  355  DWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEI  534
            +WQ +AREEVLQVFG  +PDF+GL  LK +TM+L E LRLYP +  + R T ++T+ G+ 
Sbjct  354  NWQDQAREEVLQVFGMNKPDFDGLTHLKAVTMVLLEVLRLYPALVVVSRTTRKKTQFGKF  413

Query  535  VLPRGALLMLPTLLMHVDSEIWGED  609
             LP G  + LP LL+H D E+WG+D
Sbjct  414  SLPAGVQVGLPALLIHHDKELWGDD  438



>ref|XP_010502025.1| PREDICTED: cytochrome P450 72A13-like isoform X1 [Camelina sativa]
Length=425

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+   + ++PG+R++PTK NRRMNA  +E+K  +RGI+DKR++  +GGE  +DDLLGILL
Sbjct  149  IQAFGKAFIPGYRYLPTKGNRRMNATAREIKVILRGIVDKRLRGREGGEVPSDDLLGILL  208

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL + +  G     MS E+++EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  209  ESNLGQTKGNG-----MSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  263

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFG++EP+ EGLN LKV+T ILYE LRLYPP++ + R   +E KLG++ LP G  +
Sbjct  264  EVKQVFGNKEPNTEGLNQLKVMTTILYEVLRLYPPVSQLTRAINKEMKLGDLTLPGGVQI  323

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+++WG D
Sbjct  324  TLPILLVQRDTDLWGND  340



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NNDDLLGIL  195
            I+ S  VY+PG RF+PTK N RM  I KE+K+ +  +IDKR + M+ GET  +DDLLGIL
Sbjct  304  IQASNIVYIPGRRFLPTKSNNRMKKITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGIL  363

Query  196  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            LESN  EI++ G    GMSI D+IEECK+FYFAGQETT+V+LVWTMILL  +  WQ RAR
Sbjct  364  LESNFNEIKEHGNVNLGMSINDLIEECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRAR  423

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE-ETKLGEIVLPRGA  552
             EVLQVFG+ +PDF+GLN LK++TMIL E LRLY P + + R+ V+ ETKLG    P G 
Sbjct  424  AEVLQVFGNNKPDFDGLNRLKIVTMILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGV  483

Query  553  LLMLPTLLMHVDSEIWGED  609
            +L  P +L+H+D EIWGED
Sbjct  484  MLSFPVILIHLDKEIWGED  502



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            +E+  +VY+PGWRFVPT + RRM AI+KE+K S+  II+ R+KA++ GE    DLLGILL
Sbjct  232  VEIISKVYIPGWRFVPTTKQRRMKAIDKEIKCSLTDIINNRVKALETGEATKMDLLGILL  291

Query  199  ESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN +EI +QG  K  GM+ EDVI ECK+FYFAG ET S +LVWTMILLS + DWQ RAR
Sbjct  292  ESNQKEIEEQGNNKNIGMNNEDVIAECKLFYFAGHETVSSLLVWTMILLSMYPDWQTRAR  351

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            +E+LQVFG+++PDF+GL+ LK++TMIL E LRLYPP+  + R+  ++ KLG + LP    
Sbjct  352  KEILQVFGNRKPDFDGLSHLKIVTMILNEVLRLYPPVLSLARKVRKDVKLGNLSLPSEVQ  411

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP LL+H D E+WG+D
Sbjct  412  VFLPILLVHHDCEVWGDD  429



>emb|CDX97591.1| BnaA05g24880D [Brassica napus]
Length=495

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = +1

Query  34   QVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQ  213
            + +VPG+ ++PTK NRR+ A  +E++  +RGI++KR++A + GE  +DDLLGILLESNL 
Sbjct  224  KAFVPGYLYLPTKGNRRIKAAAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLG  283

Query  214  EIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQV  393
               Q  G E  MS EDV+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAR+EV QV
Sbjct  284  ---QAKGNE--MSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARDEVKQV  338

Query  394  FGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTL  573
            FGD+EPD EGLN LKV+TMILYE LRLYPP+  + R   +E KLG++ LP GA + LP L
Sbjct  339  FGDKEPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPGGAQISLPIL  398

Query  574  LMHVDSEIWGED  609
            L+H D+++WGED
Sbjct  399  LVHRDTQLWGED  410



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V    Y+P WRFVPT  NRR+N I K++KSS++ +I+KR+K ++ G  N +D
Sbjct  226  EQAELMTKVQMNFYIPLWRFVPTMVNRRINEIGKDIKSSLKDMINKRVKILKEGGENKND  285

Query  181  LLGILLESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGIL+E+N +EI++ G     GM+IEDVI+ECK+FYFAGQETTS +LVWTM+LLSR+ +
Sbjct  286  LLGILIETNHKEIKEHGNNVNVGMNIEDVIQECKLFYFAGQETTSTLLVWTMVLLSRYPE  345

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREEVLQ+FG+++P+F+GLN+LK++TMILYE +RLYPPI  + R   +  KLG + 
Sbjct  346  WQARAREEVLQIFGNKKPNFDGLNNLKIVTMILYEVMRLYPPIIELSRNVEKNVKLGNLT  405

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            L  G  + +P +L+H D E+WG+D
Sbjct  406  LSAGVEVFMPIILLHHDCELWGDD  429



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V+R +Y+PGWRFVPTK NRRM  I  EV + I GII+KR+K ++ GE + DD
Sbjct  236  EQMELLLQVARSLYIPGWRFVPTKTNRRMKQIFNEVGALILGIINKRIKMIEDGEIH-DD  294

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LL ILL SNLQEI+Q G K+FGMSI++VIEECK+FY AGQETTS +LVWTMILLS++  W
Sbjct  295  LLSILLASNLQEIQQHGHKKFGMSIDEVIEECKLFYLAGQETTSALLVWTMILLSKYPIW  354

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAR+EVLQVF   E D++ LN LKV+TMIL E LRLYP    ++R   ++TKLG + L
Sbjct  355  QQRARQEVLQVFESDEFDYDKLNHLKVVTMILNEVLRLYPSAYFINRVVTKDTKLGNLCL  414

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+L T+L+H D+EIWG+D
Sbjct  415  PSGVQLLLGTILLHHDTEIWGDD  437



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 155/204 (76%), Gaps = 2/204 (1%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H ++  + +Y+PGWRF+PTKRNRRM  I KEV+S+I GII KRM+ ++ GE+N+DD
Sbjct  228  EQEEHLLQALQTLYIPGWRFLPTKRNRRMKEIVKEVESTILGIIKKRMQMIEAGESNSDD  287

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI QQ G + GMS+++VI+ECK+FY AGQETTS ++ WTMILLS+   W
Sbjct  288  LLGILLESNFREI-QQNGTQSGMSMKEVIDECKLFYIAGQETTSSLITWTMILLSKHSGW  346

Query  361  QARAREEVLQVFGDQ-EPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            QARAR+EVLQV G   +PDF+ LN LK++ MI +E +RLYPP   + R   +ET LG + 
Sbjct  347  QARARDEVLQVLGTAGKPDFQHLNRLKIVNMIFHEVMRLYPPAVMLGRAIHKETPLGNVT  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L+LPT+ +H D +IWG+D
Sbjct  407  LPAGLQLLLPTVAVHHDPKIWGDD  430



>ref|XP_009790241.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790242.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790243.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790246.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790247.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790248.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790249.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=458

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 156/198 (79%), Gaps = 4/198 (2%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGE-TNNDDLLGIL  195
            ++V+   Y+   +F+P K +RRM  I +EV+S + GII+KRM A++ GE +NNDDLLGIL
Sbjct  179  LKVTESSYI---KFLPNKEDRRMKQIYQEVRSLVLGIINKRMNAIEAGEASNNDDLLGIL  235

Query  196  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            LESNL+EI++   K+FGMS+++VIEECK+FYFAGQETTS +L W+MI+LS+  +WQARAR
Sbjct  236  LESNLKEIQEHRNKKFGMSMDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSEWQARAR  295

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG+ +PD++ LN LKV+TMI+ E LRLYPP+  M R    ETKLG + LP G  
Sbjct  296  EEVLQVFGNNKPDYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHTETKLGNLSLPSGVQ  355

Query  556  LMLPTLLMHVDSEIWGED  609
            L+LPT++++ D EIWGED
Sbjct  356  LLLPTIMLYHDQEIWGED  373



>emb|CDX97592.1| BnaA05g24870D [Brassica napus]
Length=512

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+  +PG+R++PTK NR M A  +EV+  +RGI++KR++A + GE  +DDLLGILL
Sbjct  236  IQAFRKHIIPGYRYLPTKENRMMKAKAREVQDILRGIVNKRLRAREAGEAPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL +++  G     MS EDVIEECK+FYFAGQETTSV+LVWTM+LLS+ QDWQA+ARE
Sbjct  296  ESNLGQVKGNG-----MSTEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+ PD +GLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKVPDIDGLNQLKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG+D
Sbjct  411  SLPILLVQHDTELWGDD  427



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V R VY+PGWRFVPTK N+R+  I  E+ + ++GII+KR KAM  GET NDD
Sbjct  227  EQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDD  286

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LL +L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTS +L+WTMILLS+  +
Sbjct  287  LLSLLMESNFREMQEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSN  346

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREE+LQVFG+++PD  GLN LK++TMI +E LRLYPP++ + R    ++++G   
Sbjct  347  WQARAREEILQVFGNKKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWY  406

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P G+ + LP LL+H D EIWGED
Sbjct  407  FPVGSHVALPILLIHHDHEIWGED  430



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V R VY+PGWRFVPTK N+R+  I  E+ + ++GII+KR KAM  GET NDD
Sbjct  240  EQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDD  299

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LL +L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTS +L+WTMILLS+  +
Sbjct  300  LLSLLMESNFREMQEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSN  359

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAREE+LQVFG+++PD  GLN LK++TMI +E LRLYPP++ + R    ++++G   
Sbjct  360  WQARAREEILQVFGNKKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWY  419

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
             P G+ + LP LL+H D EIWGED
Sbjct  420  FPVGSHVALPILLIHHDHEIWGED  443



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            E   H +E +R VY+PG+RF+PTK NRR+  I KEV+SS+ GII+ R KAM+ GE + +D
Sbjct  227  ELAQHVMEGNRSVYIPGYRFLPTKVNRRVKEITKEVRSSMLGIINTRSKAMEAGEASKED  286

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLGILLESN +EI Q G K  GMS+++VIEECK+FYFAG ETT+ +LVWTMILLS+ +DW
Sbjct  287  LLGILLESNSKEIEQHGSKH-GMSMDEVIEECKLFYFAGXETTASLLVWTMILLSKHEDW  345

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q+RAR+EVLQVF   E D++ LN+LK+L MIL+E LRLYPP   + R T  E +LG + L
Sbjct  346  QSRARDEVLQVFKRGESDYQELNNLKILGMILHEVLRLYPPGLVLLRFTPNECRLGNVNL  405

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  LMLP +L+H D +IWG+D
Sbjct  406  PAGVQLMLPLILLHHDPKIWGDD  428



>ref|XP_010275170.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++ +  +Y+PG+  +PTKRN RM  I++EV+  +RGII+KR KA++ GE + +D
Sbjct  229  EQAKLVVQAALSIYIPGYSLLPTKRNNRMKEIDREVRGLLRGIINKREKAIKLGEASQND  288

Query  181  LLGILLESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+LLESN +EI++    K  GM+I+DVIEECK+FYFAGQETT+ +LVWTM++LS   +
Sbjct  289  LLGLLLESNFKEIQEHDNAKNLGMNIDDVIEECKLFYFAGQETTANLLVWTMVVLSMHPE  348

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ R+REEVLQ FG  +PDF+GLN LKV+TMILYE LRLYPP   + R T ++ KLG I 
Sbjct  349  WQIRSREEVLQAFGKDKPDFDGLNHLKVVTMILYEVLRLYPPAVILTRHTYKKIKLGGIY  408

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  L+LPT+L+H   E+WGED
Sbjct  409  LPPGVELLLPTILIHHSRELWGED  432



>emb|CDX98486.1| BnaC05g38890D [Brassica napus]
Length=512

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 150/193 (78%), Gaps = 5/193 (3%)
 Frame = +1

Query  31   RQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNL  210
            R++++PG+R+ PTK NRRM A  +EV+  +RGI++KR++A + GE  +DDLLG LLESNL
Sbjct  240  RRIFIPGYRYYPTKGNRRMKAAAREVQDILRGIVNKRLRAREAGEAPSDDLLGTLLESNL  299

Query  211  QEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQ  390
             +      K  GMSIEDVIEECK+FYFAGQETTSV+LVWTM++LS+ QDWQA+AREEV Q
Sbjct  300  GQ-----AKGTGMSIEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQAKAREEVKQ  354

Query  391  VFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPT  570
            VFGD+EPD EGLN LK++TMILYE LRLYPP+  + R   +E KLG++ LP G  + LP 
Sbjct  355  VFGDKEPDTEGLNHLKIMTMILYEVLRLYPPVIQLTRAIHKEMKLGDLTLPGGIHISLPV  414

Query  571  LLMHVDSEIWGED  609
            +L+  D+ +WG D
Sbjct  415  MLVQRDTNLWGND  427



>ref|XP_009146335.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = +1

Query  34   QVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQ  213
            + +VPG+ ++PTK NRR+ A  +E++  +RGI++KR++A + GE  +DDLLGILLESNL 
Sbjct  241  KAFVPGYLYLPTKGNRRIKAAAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLG  300

Query  214  EIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQV  393
               Q  G E  MS EDV+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAR+EV QV
Sbjct  301  ---QAKGNE--MSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARDEVKQV  355

Query  394  FGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTL  573
            FGD+EPD EGLN LKV+TMILYE LRLYPP+  + R   +E KLG++ LP GA + LP L
Sbjct  356  FGDKEPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPGGAQISLPIL  415

Query  574  LMHVDSEIWGED  609
            L+H D+++WGED
Sbjct  416  LVHRDTQLWGED  427



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 150/198 (76%), Gaps = 5/198 (3%)
 Frame = +1

Query  16   FIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGIL  195
             I+  ++ ++PG+R++PTK NRRM    +EV+  +RGII+KR+ A + GE  ++DLLG L
Sbjct  235  LIQAVQRFFIPGYRYLPTKDNRRMKVAAREVQDILRGIINKRLAAREAGEAPSNDLLGTL  294

Query  196  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            LESNL E     GK  GMSIEDV+EECK+FYFAGQETTSV+LVWTMILLS+ QDWQARAR
Sbjct  295  LESNLGE-----GKGNGMSIEDVMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAR  349

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEV Q FGD+EPD EGLN LKV+TMI  E LRLYPP+  + R   +ETKLG++ LP G  
Sbjct  350  EEVKQAFGDKEPDTEGLNHLKVMTMIFNEVLRLYPPVIQLTRAIHKETKLGDMTLPSGVH  409

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP LL+  D+E+WG D
Sbjct  410  ITLPILLVQHDTELWGND  427



>ref|XP_003525967.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=518

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V + VY+PGWRFVPTK N+RM  I+ E+++ + GII K+  AM+  +  ND+
Sbjct  230  EQAELTAKVFQSVYIPGWRFVPTKLNKRMKEIDFEIRNVLSGIIQKQEAAMKTCKAPNDN  289

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+LLESN +EI  +G  K+ GM+ +DVI ECK+FYFAGQETTSV+L WTM+LLSRF +
Sbjct  290  LLGLLLESNQKEIEDRGHRKDVGMNTDDVINECKLFYFAGQETTSVLLNWTMVLLSRFPN  349

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ  AREEV+ +FG +EPD++GLN LKV+TMILYE LRLYPP+T + R   +E ++G + 
Sbjct  350  WQTLAREEVIGIFGTKEPDYDGLNRLKVVTMILYEVLRLYPPVTAITRVVRKEARVGNLT  409

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP GAL  +P +L+H DSE+WG D
Sbjct  410  LPAGALATIPIVLVHHDSELWGSD  433



>ref|XP_009146334.1| PREDICTED: cytochrome P450 72A15 [Brassica rapa]
Length=512

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+  +PG+R++PTK NR M A  +EV++ +RGI++KR++A + GE  +DDLLGILL
Sbjct  236  IQAFRKHIIPGYRYLPTKENRMMKAKAREVQAILRGIVNKRLRAREAGEAPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL +++  G     MS EDVIEECK+FYFAGQETTSV+LVWTM+LLS+ QDWQA+ARE
Sbjct  296  ESNLGQVKGNG-----MSNEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+ PD +GLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKVPDIDGLNQLKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  411  SLPILLVQHDTELWGND  427



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 148/203 (73%), Gaps = 1/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+     ++PGWRF+PTK NRRM  I  EV+S +  IIDKR KA++ GE  ++D
Sbjct  227  EQAALLIKAILSAFIPGWRFLPTKTNRRMKHIITEVESLLLAIIDKRTKAIEAGEATSND  286

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LL ILLESN +EI+Q G K FGMS++DVIEECK+FY AGQETTS +LVWTMILLS+  DW
Sbjct  287  LLDILLESNSKEIKQNGHK-FGMSLQDVIEECKLFYLAGQETTSSLLVWTMILLSKHLDW  345

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            QARAREEVL VF    PDF+ L+ LK+++MI  E LRLYPP   + R   +ET LG IVL
Sbjct  346  QARAREEVLHVFRSGTPDFQDLSRLKIVSMIFQEVLRLYPPGLLISRAVHKETALGNIVL  405

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L+LP +L+H D +IWGED
Sbjct  406  PAGVQLLLPVILLHHDCKIWGED  428



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 153/197 (78%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+  +PG+ ++PTK NRRM A  +E++  +RGI++KR++A + GE  +DDLLGILL
Sbjct  271  IQAFRKAIIPGFSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILL  330

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL + +  G     MS ED++EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  331  ESNLGQTKGNG-----MSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  385

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  386  EVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQI  445

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG+D
Sbjct  446  SLPILLVQRDTELWGKD  462



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 151/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  ++ ++PG+ ++PTK NRRMNA  +E+K  +RGIIDKR++  +GGE  +DDLLGILL
Sbjct  236  IQAVQKAFIPGYSYLPTKGNRRMNATAREMKVILRGIIDKRLRGREGGEVPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL + +  G     MS E+++EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  296  ESNLGQTKGNG-----MSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+T ILYE LRLYPP   + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPDAEGLNQLKVMTTILYEVLRLYPPPCQLTRTINKEMKLGDMTLPSGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  411  SLPVLLIQRDTELWGHD  427



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 158/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I   + VY+PGWRF+PT+ N+RM AI+KE+K S+R II  R +A++ GE   DD
Sbjct  231  EQAKLTIRALQSVYIPGWRFLPTRSNKRMKAIDKEIKGSLRDIISTREEAIRMGEATKDD  290

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLGILLESNL+EIR+ G  K  GMSIEDVIEECK+FYFAGQETTSV+L+WT++LLS+ Q+
Sbjct  291  LLGILLESNLKEIRENGNTKNVGMSIEDVIEECKLFYFAGQETTSVLLLWTLVLLSQNQN  350

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQARAR+EVLQVFG  +PDF+GLN LKV+TMIL E LRLYP +  + R T  +T LG++ 
Sbjct  351  WQARARDEVLQVFGSNKPDFDGLNHLKVVTMILLEVLRLYPSVVALPRTTHNKTHLGKLS  410

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LP LL+H D E+WGED
Sbjct  411  LPAGVEVSLPILLLHHDKELWGED  434



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V + VY+PGWRF+PTK N++M  I++E+++ + GII+KR  A++ G+   DD
Sbjct  228  EQVQLVTKVVQSVYIPGWRFLPTKTNKKMKGIDREIRALLMGIINKREGAIKAGKATKDD  287

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN++EIR+ G  K+ GMS+ DVIEECK+FYFAGQETTS +LVWTM+LL ++QD
Sbjct  288  LLGVLMESNVKEIREHGNNKKVGMSMHDVIEECKLFYFAGQETTSGLLVWTMVLLGQYQD  347

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ  AREEV++VFG  +PDF+GL  LKV+TMIL+E LRLYP ++ M R T ++T+L    
Sbjct  348  WQDHAREEVIEVFGSNKPDFDGLIHLKVVTMILHEVLRLYPALSLMTRITSKKTQLANYS  407

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPTLL+H D ++WG+D
Sbjct  408  LPAGVEVALPTLLVHHDKQLWGDD  431



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 150/193 (78%), Gaps = 5/193 (3%)
 Frame = +1

Query  31   RQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNL  210
            R++++PG+R+ PTK NRRM A  +EV+  +RGI++KR++A + GE  ++DLLG LLESNL
Sbjct  240  RRIFIPGYRYYPTKGNRRMKAAAREVQDILRGIVNKRLRAREAGEAPSEDLLGTLLESNL  299

Query  211  QEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQ  390
             +      K  GMSIEDVIEECK+FYFAGQETTSV+LVWTM++LS+ QDWQARAR+EV Q
Sbjct  300  GQ-----AKGTGMSIEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARARDEVKQ  354

Query  391  VFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPT  570
            VFGD+EPD EGLN LK++TMILYE LRLYPP+  + R   +E KLG++ LP G  + LP 
Sbjct  355  VFGDKEPDTEGLNHLKIMTMILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGTHISLPV  414

Query  571  LLMHVDSEIWGED  609
            +L+  D+ +WG D
Sbjct  415  MLVQRDTNLWGND  427



>ref|XP_004248201.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=510

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 1/186 (1%)
 Frame = +1

Query  55   RFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN-DDLLGILLESNLQEIRQQG  231
            RF+PTK  RRMN I +EV+S +  II+KRM  ++ G+T+N DDLLGILLESN++EI++ G
Sbjct  240  RFLPTKEKRRMNRIHQEVRSLVLRIINKRMNKIEAGDTSNSDDLLGILLESNMKEIQEHG  299

Query  232  GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEP  411
             K+FGMSI++VIEECK+FY AGQETTS +LVW+MILLS+  DWQARAREEV QVFG+  P
Sbjct  300  NKKFGMSIDEVIEECKLFYLAGQETTSALLVWSMILLSKHSDWQARAREEVSQVFGNNVP  359

Query  412  DFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDS  591
            D++ LN LKV+TMI+ E LRLYPP   M R   +ETKLG + +P G  L+LPT+L+H D 
Sbjct  360  DYDKLNQLKVVTMIIQEVLRLYPPNFLMGREVHKETKLGNLSIPSGVQLLLPTILLHHDQ  419

Query  592  EIWGED  609
            EIWGED
Sbjct  420  EIWGED  425



>emb|CDX98484.1| BnaC05g38910D [Brassica napus]
Length=512

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = +1

Query  34   QVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQ  213
            + ++PG+ ++PTK NRR+ A  +E+K  +RGI++KR++A + GE  +DDLLGILLESNL 
Sbjct  241  KAFIPGYLYLPTKGNRRIKAAAREIKVILRGIVNKRLRAREAGEAPSDDLLGILLESNLG  300

Query  214  EIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQV  393
               Q  G E  MS  DV+EECK+FYFAGQETTSV+LVWTM++LS+ QDWQARAR+EV QV
Sbjct  301  ---QAKGNE--MSTADVMEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARARDEVKQV  355

Query  394  FGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTL  573
            FGD+EPD EGLN LKV+TMILYE LRLYPP+  + R   +E KLG++ LPRGA + LP L
Sbjct  356  FGDKEPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPRGAQISLPIL  415

Query  574  LMHVDSEIWGED  609
            L+H D+++WGE+
Sbjct  416  LVHRDTQLWGEE  427



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    ++V+  +Y+PG+R +PTKRN RM  I++EV+  +R I++KR KA++ GE + DD
Sbjct  229  EQAKIVMDVALSIYIPGYRLLPTKRNNRMKEIDREVRGLLRRIVNKREKAIKLGEASKDD  288

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+LLESN +EIR+ G  K  GM++++VIEECK+FYFAGQETTS +LVWTM++LS   +
Sbjct  289  LLGLLLESNFKEIREHGNEKNIGMNVDEVIEECKLFYFAGQETTSNLLVWTMVVLSMHPE  348

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ RAREEVLQ FG  +PDF+G+N LKV++MILYE LRLYPP   + R+T ++ KLG++ 
Sbjct  349  WQMRAREEVLQSFGKDKPDFDGINHLKVVSMILYEVLRLYPPAVALTRQTYKKVKLGDVY  408

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP    L LPT+L+H   E+WGED
Sbjct  409  LPPRVELSLPTILIHHSRELWGED  432



>emb|CAN71061.1| hypothetical protein VITISV_032613 [Vitis vinifera]
Length=281

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = +1

Query  49   GWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQ-  225
            G  F+PTK N+RM  I KEV + + GIIDKR KAM+ GET NDDLLGILLESN +EI++ 
Sbjct  9    GVMFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEH  68

Query  226  QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQ  405
            +  K  GM I+DVIEECK+FYFAGQETTS +L+WTM+LLS+  +WQARAREEVL VFG+ 
Sbjct  69   ENDKNVGMCIKDVIEECKIFYFAGQETTSALLLWTMVLLSKHPNWQARAREEVLHVFGNN  128

Query  406  EPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHV  585
            +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G++ LP G  + LPT+L+H 
Sbjct  129  KPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTILVHH  188

Query  586  DSEIWGED  609
            D EIWGED
Sbjct  189  DHEIWGED  196



>ref|XP_009147881.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+ Y+PG+R++PTK NRR+ A  KE    +RG+++KR++A + GE  N+DLLGILL
Sbjct  236  IQAFRKSYIPGYRYLPTKDNRRIKAAAKETHDILRGLVNKRLRAREAGEAPNEDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL +      K  GMSI+DVIEECK+FYFAGQETTSV+LVWTMILLS+ QDWQARARE
Sbjct  296  ESNLGQ-----AKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LK++TMI+ E +RLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPDTEGLNHLKIMTMIINEVIRLYPPVTLLTRTIHKEMKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+  D+++WG D
Sbjct  411  NLPIMLVQRDTQLWGND  427



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            +++   VY+PGWRF+PTK N+R+  ++KE++    GII+KR +A++ GE   DDLLG+LL
Sbjct  237  VKMKHSVYIPGWRFLPTKTNKRLKEVDKEIRELFMGIINKREEAIKAGEAAKDDLLGLLL  296

Query  199  ESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            ESN +EI++ G K+  GMSI+DV+ ECK+FYFAGQETTS++LVWTM+LLS  Q+WQ RAR
Sbjct  297  ESNNKEIKEHGNKKKVGMSIQDVLGECKLFYFAGQETTSILLVWTMVLLSENQNWQDRAR  356

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEVLQVFG  +PDF+GLN LKV+TMIL E+LRLYP    + R   ++T+  E  LP G  
Sbjct  357  EEVLQVFGGNKPDFDGLNHLKVVTMILLEALRLYPSSFTLSRMIHKKTQFAEFSLPAGVG  416

Query  556  LMLPTLLMHVDSEIWGED  609
            + LPT+L+H D E+WG+D
Sbjct  417  ISLPTILIHHDKELWGDD  434



>ref|XP_004300362.1| PREDICTED: cytochrome P450 CYP72A219-like [Fragaria vesca subsp. 
vesca]
Length=517

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = +1

Query  37   VYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQE  216
            V +PGWRF+PTK N+RM  + KE+K S++GII  R KA++ GE   DDLL ILLESNL+ 
Sbjct  241  VNIPGWRFIPTKTNKRMREVNKEIKGSLKGIIHNREKAIKAGEPCKDDLLSILLESNLKV  300

Query  217  IRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQV  393
            I + G  K FGMS EDVIE CK+FYF GQET +V+LVWTM+LLS++Q+WQ  AREEVLQV
Sbjct  301  IHEHGNNKNFGMSTEDVIENCKLFYFTGQETITVLLVWTMVLLSQYQNWQTLAREEVLQV  360

Query  394  FGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTL  573
            FG  +PDF+GLN LK++TMIL E LRLYP    M R T +ET+LGE  +P G  + +P L
Sbjct  361  FGSNKPDFDGLNRLKIVTMILREVLRLYPSAVTMTRNTYKETQLGEKTIPAGVEITIPIL  420

Query  574  LMHVDSEIWGED  609
            L+  D E+WG+D
Sbjct  421  LVQHDEELWGDD  432



>ref|XP_010465360.1| PREDICTED: cytochrome P450 72A15 [Camelina sativa]
Length=512

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+  +PG+ ++PTK NRRM A  +E++  +RGI++KR++A + GE  +DDLLGILL
Sbjct  236  IQAFRKAIIPGFSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL + +  G     MS ED++EECK+FYFAGQETTSV+LVWTM+LLS+ +DWQARARE
Sbjct  296  ESNLGQTKGNG-----MSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHKDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEIKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  411  SLPILLVQRDTELWGND  427



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 149/191 (78%), Gaps = 5/191 (3%)
 Frame = +1

Query  37   VYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQE  216
             ++PG+RF+PTKRNRR+ A  +E++  + GII+KR++A + GE  ++DLLGILLESNL +
Sbjct  242  AFIPGYRFLPTKRNRRIKAAAREIQIILSGIINKRLRAREAGEAPSNDLLGILLESNLGQ  301

Query  217  IRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVF  396
                  K  GMS EDV+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAREEV QVF
Sbjct  302  -----AKGNGMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVF  356

Query  397  GDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLL  576
            GD+EPD EGLN LKV+TMI YE LRLYPP+  + R   +E KLG++ LP G  + LP LL
Sbjct  357  GDKEPDTEGLNQLKVMTMIFYEVLRLYPPVNQLTRAIHKEMKLGDLTLPGGVQISLPILL  416

Query  577  MHVDSEIWGED  609
            +  D+E+WG+D
Sbjct  417  VQRDTELWGKD  427



>ref|XP_009394217.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=538

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ    I+V + +YVPG+RF+PT +N+R+ AI++E++S +RGII KR + ++ G+ + DD
Sbjct  251  EQAELLIQVVQNLYVPGYRFLPTPKNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDD  310

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            LLG+L+ESN++ +++ G K  GM+ EDVIEECK+FYFAGQETTS +L WTMI LS    W
Sbjct  311  LLGLLMESNMKRLQEDGNKNAGMTTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTW  370

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVL+VFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + R+T +  KLG++V 
Sbjct  371  QVRAREEVLRVFGENKPDFDGLSHLKIVTMILYEVLRLYPPVIILRRQTYKTMKLGDVVY  430

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G LL+L  + +H D  +WG+D
Sbjct  431  PPGVLLLLHVIFVHHDPNLWGKD  453



>ref|XP_007133275.1| hypothetical protein PHAVU_011G166000g [Phaseolus vulgaris]
 gb|ESW05269.1| hypothetical protein PHAVU_011G166000g [Phaseolus vulgaris]
Length=339

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 150/204 (74%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V + VY+PGWRF+PT+ N RM  I  E+ + + GII K+   M+  E  ND+
Sbjct  51   EQAQLTAKVFQSVYIPGWRFLPTRLNNRMKKINYEIGNVLSGIIQKQEGIMKTCEAPNDN  110

Query  181  LLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+LLESN +EI   G  K+ GM+  DVI ECK+FYFAGQETTSV+L WTM+LLSRF +
Sbjct  111  LLGLLLESNQKEIEDGGVKKDVGMNTNDVINECKLFYFAGQETTSVLLNWTMVLLSRFPN  170

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ  AREEV+++FG +EPD+EGLN LKV+TMILYE LRLYPP+T + R   ++T++G + 
Sbjct  171  WQTLAREEVIEIFGTKEPDYEGLNRLKVVTMILYEVLRLYPPVTAITRVLRKKTRVGNMT  230

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP GAL+ +P +L+H D E+WG D
Sbjct  231  LPEGALVTIPIVLVHHDFELWGSD  254



>gb|KFK38825.1| hypothetical protein AALP_AA3G165400 [Arabis alpina]
Length=968

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 5/198 (3%)
 Frame = +1

Query  16   FIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGIL  195
             I+  R+V++PG+R++PTK NRRM A   E+++ +RGII+KR+ A + GE  +DDLLGIL
Sbjct  235  LIQALRKVFIPGYRYLPTKGNRRMKAAAAEIQAILRGIINKRLTAREAGEAPSDDLLGIL  294

Query  196  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  375
            LESNL++     GK  GMSIEDV+EECK+FYFAGQETTSV+LVWTMILL   QDWQARAR
Sbjct  295  LESNLEQ-----GKGNGMSIEDVMEECKLFYFAGQETTSVLLVWTMILLGHHQDWQARAR  349

Query  376  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  555
            EEV QVFGD+EPD EGLN LKV+ MI YE LRLYPP+  + R   +E KLG++ LP G  
Sbjct  350  EEVKQVFGDKEPDTEGLNQLKVMNMIFYEVLRLYPPVIQLTRAIHKEMKLGDMTLPGGVH  409

Query  556  LMLPTLLMHVDSEIWGED  609
            + LP LL+  D+++WG D
Sbjct  410  ISLPILLVQHDTKLWGND  427



>emb|CDY51036.1| BnaA06g02990D [Brassica napus]
Length=512

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+ Y+PG+R++PTK NRR+ A  KE    +RG+++KR++A + GE  N+DLLGILL
Sbjct  236  IQAFRKSYIPGYRYLPTKDNRRIKAAAKETHDILRGLVNKRLRAREAGEAPNEDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL +      K  GMSI+DVIEECK+FYFAGQETTSV+LVWTMILLS+ QDWQARARE
Sbjct  296  ESNLGQ-----AKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EP+ EGLN LK++TMI+ E +RLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPNTEGLNHLKIMTMIINEVIRLYPPVTQLSRTIHKEMKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP +L+  D+++WG D
Sbjct  411  NLPIMLVQRDTQLWGND  427



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ     +V + VY PGWRF+PTK N++M  I++E+++ + GII+KR  A++ G+   DD
Sbjct  228  EQVQLVTKVVQSVYTPGWRFLPTKTNKKMKGIDREIRALLMGIINKREGAIKAGKATKDD  287

Query  181  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  357
            LLG+L+ESN++EIR+ G  K+ GMS+ DVIEECK+FYFAGQETTS +LVWTM+LL ++QD
Sbjct  288  LLGVLMESNVKEIREHGNNKKVGMSMHDVIEECKLFYFAGQETTSGLLVWTMVLLGQYQD  347

Query  358  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  537
            WQ  AREEV++VFG  +PDF+GL  LKV+TMIL+E LRLYP ++ M R T ++T+L    
Sbjct  348  WQDHAREEVIEVFGSNKPDFDGLIHLKVVTMILHEVLRLYPALSLMTRITSKKTQLANYS  407

Query  538  LPRGALLMLPTLLMHVDSEIWGED  609
            LP G  + LPTLL+H D ++WG+D
Sbjct  408  LPAGVEVALPTLLVHHDKQLWGDD  431



>ref|XP_010502007.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  198
            I+  R+  +PG+ ++PTK NRRM A  +E++  +RGI++KR++A + GE  +DDLLGILL
Sbjct  236  IQAFRKAIIPGFSYLPTKGNRRMKATAREIQVILRGIVNKRLRAREAGEAPSDDLLGILL  295

Query  199  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  378
            ESNL + +  G     MS ED++EECK+FYFAGQETTSV+LVWTM+LLS+ +DWQARARE
Sbjct  296  ESNLGQTKGNG-----MSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHKDWQARARE  350

Query  379  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  558
            EV QVFGD+EPD EGLN LKV+TMILYE +RLYPP+T + R   +E KLG++ LP G  +
Sbjct  351  EVKQVFGDKEPDAEGLNQLKVMTMILYEVVRLYPPVTQLTRAIHKEIKLGDLTLPGGVQI  410

Query  559  MLPTLLMHVDSEIWGED  609
             LP LL+  D+E+WG D
Sbjct  411  SLPILLVQRDTELWGND  427



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 150/203 (74%), Gaps = 5/203 (2%)
 Frame = +1

Query  1    EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  180
            EQ  H +  +R +Y+PG RF+PTKRNRRM  I KEV+ SIR II+ R+KA++ GE  + D
Sbjct  231  EQAGHLVLATRSIYIPGSRFLPTKRNRRMKQIAKEVEGSIREIINARLKALRAGEAIDTD  290

Query  181  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  360
            +LG+LL ++     Q+ G E GM+  ++I+ECK+FY AGQETT+V+LVWTMILLS   DW
Sbjct  291  MLGLLLATS-----QETGGESGMTTGEIIQECKLFYVAGQETTAVLLVWTMILLSMHPDW  345

Query  361  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  540
            Q RAREEVLQ FG   P+F+GLN LK++TMIL+E LRLYPPI+ + R   EETK+G + +
Sbjct  346  QERAREEVLQHFGTNMPNFDGLNQLKIVTMILHEVLRLYPPISNIGRTVAEETKIGNLTI  405

Query  541  PRGALLMLPTLLMHVDSEIWGED  609
            P G  L LP +L+H D EIWGED
Sbjct  406  PAGQRLALPVILLHHDPEIWGED  428



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230