BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016E03 648 bp,

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757482.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    220   2e-67   Nicotiana sylvestris
emb|CDP08198.1|  unnamed protein product                                222   4e-66   Coffea canephora [robusta coffee]
ref|XP_009758764.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    221   1e-65   Nicotiana sylvestris
ref|XP_009603443.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    221   1e-65   Nicotiana tomentosiformis
ref|XP_009602786.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    218   1e-64   Nicotiana tomentosiformis
ref|XP_010095449.1|  6-phosphofructokinase 3                            218   2e-64   Morus notabilis
ref|XP_004253102.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    217   3e-64   Solanum lycopersicum
ref|XP_007137260.1|  hypothetical protein PHAVU_009G112500g             213   4e-64   Phaseolus vulgaris [French bean]
gb|EYU29302.1|  hypothetical protein MIMGU_mgv1a005820mg                216   4e-64   Erythranthe guttata [common monkey flower]
ref|XP_011094240.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    216   1e-63   Sesamum indicum [beniseed]
gb|EYU20401.1|  hypothetical protein MIMGU_mgv1a005493mg                215   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_011081730.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    216   2e-63   Sesamum indicum [beniseed]
gb|EYU20400.1|  hypothetical protein MIMGU_mgv1a005493mg                215   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_006342512.1|  PREDICTED: 6-phosphofructokinase 3-like            214   3e-63   Solanum tuberosum [potatoes]
gb|KJB83095.1|  hypothetical protein B456_013G229200                    214   5e-63   Gossypium raimondii
ref|XP_003522720.1|  PREDICTED: 6-phosphofructokinase 3-like            214   5e-63   Glycine max [soybeans]
gb|KDO55889.1|  hypothetical protein CISIN_1g0098041mg                  207   6e-63   Citrus sinensis [Valencia orange]
gb|AFK48605.1|  unknown                                                 205   9e-63   Lotus japonicus
ref|XP_007012967.1|  6-phosphofructokinase 3                            215   2e-62   Theobroma cacao [chocolate]
gb|KHG01593.1|  6-phosphofructokinase 3 -like protein                   213   2e-62   Gossypium arboreum [tree cotton]
gb|KHG29071.1|  6-phosphofructokinase 3 -like protein                   213   2e-62   Gossypium arboreum [tree cotton]
gb|KCW79592.1|  hypothetical protein EUGRSUZ_C00952                     204   4e-62   Eucalyptus grandis [rose gum]
ref|XP_008337072.1|  PREDICTED: 6-phosphofructokinase 3-like            207   4e-62   Malus domestica [apple tree]
gb|KJB54321.1|  hypothetical protein B456_009G029100                    214   4e-62   Gossypium raimondii
ref|XP_003630682.1|  6-phosphofructokinase                              208   5e-62   
gb|KDP33769.1|  hypothetical protein JCGZ_07340                         213   5e-62   Jatropha curcas
ref|XP_009350260.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   5e-62   Pyrus x bretschneideri [bai li]
ref|XP_007152950.1|  hypothetical protein PHAVU_004G173900g             212   8e-62   Phaseolus vulgaris [French bean]
gb|KJB65623.1|  hypothetical protein B456_010G103900                    211   8e-62   Gossypium raimondii
gb|KJB65060.1|  hypothetical protein B456_010G079100                    212   1e-61   Gossypium raimondii
ref|XP_002514189.1|  phosphofructokinase, putative                      214   1e-61   
gb|KJB65059.1|  hypothetical protein B456_010G079100                    212   1e-61   Gossypium raimondii
ref|XP_004245136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    211   1e-61   Solanum lycopersicum
emb|CBI27972.3|  unnamed protein product                                211   1e-61   Vitis vinifera
gb|KEH36099.1|  6-phosphofructokinase                                   211   1e-61   Medicago truncatula
ref|XP_010050463.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    205   1e-61   Eucalyptus grandis [rose gum]
ref|XP_003526507.1|  PREDICTED: 6-phosphofructokinase 3-like            211   1e-61   Glycine max [soybeans]
gb|EPS62819.1|  hypothetical protein M569_11969                         209   1e-61   Genlisea aurea
ref|XP_006355296.1|  PREDICTED: 6-phosphofructokinase 3-like            210   2e-61   Solanum tuberosum [potatoes]
ref|XP_006285534.1|  hypothetical protein CARUB_v10006975mg             210   2e-61   Capsella rubella
ref|XP_006583562.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    209   2e-61   
ref|XP_011458966.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    209   2e-61   Fragaria vesca subsp. vesca
ref|XP_011091507.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    209   3e-61   Sesamum indicum [beniseed]
ref|XP_002283274.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    211   3e-61   Vitis vinifera
gb|ACO35360.1|  phosphofructokinase                                     201   4e-61   Elaeis oleifera
ref|XP_010690141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    209   4e-61   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010545328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    209   4e-61   Tarenaya hassleriana [spider flower]
ref|XP_010244403.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    210   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010049142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    209   6e-61   Eucalyptus grandis [rose gum]
ref|XP_009367416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    209   7e-61   Pyrus x bretschneideri [bai li]
gb|AIU64848.1|  6-phosphofructokinase                                   209   7e-61   Prunus sibirica [Siberian apricot]
ref|XP_007223382.1|  hypothetical protein PRUPE_ppa004610mg             209   7e-61   Prunus persica
ref|XP_010049141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    209   8e-61   Eucalyptus grandis [rose gum]
ref|XP_009125389.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    207   1e-60   Brassica rapa
emb|CDX68896.1|  BnaC01g05570D                                          207   1e-60   Brassica napus [oilseed rape]
emb|CDX75291.1|  BnaA01g04110D                                          207   1e-60   Brassica napus [oilseed rape]
gb|KHN16662.1|  6-phosphofructokinase 3                                 207   1e-60   Glycine soja [wild soybean]
ref|XP_003532467.1|  PREDICTED: 6-phosphofructokinase 3-like            207   1e-60   Glycine max [soybeans]
ref|XP_003516323.2|  PREDICTED: 6-phosphofructokinase 3-like            209   1e-60   
gb|KHN03217.1|  6-phosphofructokinase 3                                 208   2e-60   Glycine soja [wild soybean]
ref|XP_007203634.1|  hypothetical protein PRUPE_ppa003994mg             209   2e-60   Prunus persica
ref|XP_003529065.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    208   2e-60   Glycine max [soybeans]
ref|XP_003630681.1|  6-phosphofructokinase                              207   2e-60   Medicago truncatula
ref|XP_008242459.1|  PREDICTED: 6-phosphofructokinase 6-like            207   3e-60   
emb|CDY32769.1|  BnaA10g10800D                                          203   4e-60   Brassica napus [oilseed rape]
ref|XP_003620763.1|  6-phosphofructokinase                              207   4e-60   Medicago truncatula
ref|XP_004503509.1|  PREDICTED: 6-phosphofructokinase 3-like            206   4e-60   Cicer arietinum [garbanzo]
ref|XP_010536840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   5e-60   Tarenaya hassleriana [spider flower]
ref|XP_009613574.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   5e-60   Nicotiana tomentosiformis
ref|XP_006412426.1|  hypothetical protein EUTSA_v10025143mg             206   5e-60   Eutrema salsugineum
ref|XP_006451355.1|  hypothetical protein CICLE_v10007886mg             206   6e-60   Citrus clementina
gb|AHB32113.1|  6-phosphofructokinase 3-like protein                    206   6e-60   Camellia sinensis [black tea]
gb|AIE47276.1|  phosphofructokinase                                     207   6e-60   Hevea brasiliensis [Para rubber tree]
ref|NP_194651.1|  6-phosphofructokinase 1                               206   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539385.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   6e-60   Tarenaya hassleriana [spider flower]
gb|AIE47274.1|  phosphofructokinase                                     207   7e-60   Hevea brasiliensis [Para rubber tree]
ref|XP_009613573.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   7e-60   Nicotiana tomentosiformis
gb|KFK29896.1|  hypothetical protein AALP_AA7G192500                    205   7e-60   Arabis alpina [alpine rockcress]
ref|XP_002516495.1|  phosphofructokinase, putative                      206   7e-60   Ricinus communis
gb|AIE47270.1|  phosphofructokinase                                     206   8e-60   Hevea brasiliensis [Para rubber tree]
ref|XP_011078226.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   8e-60   Sesamum indicum [beniseed]
gb|KDP34145.1|  hypothetical protein JCGZ_07716                         206   8e-60   Jatropha curcas
ref|XP_006413209.1|  hypothetical protein EUTSA_v10025029mg             206   8e-60   Eutrema salsugineum
gb|KDO51846.1|  hypothetical protein CISIN_1g009394mg                   207   9e-60   Citrus sinensis [Valencia orange]
ref|XP_006465714.1|  PREDICTED: 6-phosphofructokinase 3-like            206   1e-59   Citrus sinensis [Valencia orange]
ref|XP_010526423.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   1e-59   Tarenaya hassleriana [spider flower]
gb|KHM99825.1|  6-phosphofructokinase 3                                 205   1e-59   Glycine soja [wild soybean]
ref|XP_002867225.1|  phosphofructokinase family protein                 204   1e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_011093663.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   1e-59   Sesamum indicum [beniseed]
ref|XP_003524412.1|  PREDICTED: 6-phosphofructokinase 7-like            205   1e-59   Glycine max [soybeans]
ref|XP_004302844.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    206   1e-59   Fragaria vesca subsp. vesca
ref|XP_007215486.1|  hypothetical protein PRUPE_ppa003635mg             207   1e-59   Prunus persica
gb|EYU30678.1|  hypothetical protein MIMGU_mgv1a005513mg                205   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_006401301.1|  hypothetical protein EUTSA_v10013372mg             205   2e-59   Eutrema salsugineum
gb|KDP40841.1|  hypothetical protein JCGZ_24840                         206   2e-59   Jatropha curcas
gb|AAM65566.1|  putative pyrophosphate--fructose-6-phosphate 1-ph...    204   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451353.1|  hypothetical protein CICLE_v10007886mg             205   3e-59   Citrus clementina
ref|XP_006426847.1|  hypothetical protein CICLE_v10025255mg             206   3e-59   Citrus clementina
ref|NP_195010.1|  6-phosphofructokinase 6                               204   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135681.1|  PREDICTED: 6-phosphofructokinase 7-like            204   3e-59   Cucumis sativus [cucumbers]
ref|XP_006451354.1|  hypothetical protein CICLE_v10007886mg             206   3e-59   Citrus clementina
gb|AAM91591.1|  pyrophosphate-dependent phosphofructo-1-kinase-li...    204   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475360.1|  PREDICTED: 6-phosphofructokinase 3-like            206   3e-59   Citrus sinensis [Valencia orange]
gb|KCW79599.1|  hypothetical protein EUGRSUZ_C00956                     204   3e-59   Eucalyptus grandis [rose gum]
ref|XP_004513074.1|  PREDICTED: 6-phosphofructokinase 3-like            204   3e-59   Cicer arietinum [garbanzo]
gb|AAB88875.1|  pyrophosphate-dependent phosphofructo-1-kinase          198   3e-59   Prunus armeniaca
ref|XP_008354543.1|  PREDICTED: 6-phosphofructokinase 3-like            203   3e-59   Malus domestica [apple tree]
ref|XP_008450803.1|  PREDICTED: 6-phosphofructokinase 7-like            204   4e-59   Cucumis melo [Oriental melon]
ref|XP_007012201.1|  Phosphofructokinase 3 isoform 3                    204   4e-59   Theobroma cacao [chocolate]
gb|KHN40360.1|  6-phosphofructokinase 3                                 206   4e-59   Glycine soja [wild soybean]
ref|XP_008375840.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    203   4e-59   
ref|XP_009763926.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    204   4e-59   Nicotiana sylvestris
ref|XP_010447334.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_011007273.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    205   5e-59   Populus euphratica
ref|XP_010437846.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010267094.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    204   6e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010047648.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    205   6e-59   Eucalyptus grandis [rose gum]
ref|XP_007012199.1|  Phosphofructokinase 3 isoform 1                    204   6e-59   Theobroma cacao [chocolate]
ref|XP_010447333.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009763925.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    204   6e-59   Nicotiana sylvestris
ref|XP_010432655.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   6e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001056831.1|  Os06g0151900                                       194   6e-59   
ref|XP_006371963.1|  phosphofructokinase family protein                 203   6e-59   Populus trichocarpa [western balsam poplar]
emb|CDX94352.1|  BnaC01g18320D                                          203   6e-59   Brassica napus [oilseed rape]
ref|XP_002867573.1|  phosphofructokinase family protein                 203   6e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_008228400.1|  PREDICTED: 6-phosphofructokinase 6-like            204   7e-59   
ref|XP_006357682.1|  PREDICTED: 6-phosphofructokinase 3-like            204   7e-59   Solanum tuberosum [potatoes]
ref|XP_002867420.1|  phosphofructokinase family protein                 203   7e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_010925504.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   7e-59   Elaeis guineensis
ref|XP_008348488.1|  PREDICTED: 6-phosphofructokinase 6-like            204   7e-59   Malus domestica [apple tree]
ref|XP_010483140.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010443317.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_011006431.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   8e-59   Populus euphratica
ref|XP_004517277.1|  PREDICTED: 6-phosphofructokinase 3-like            204   8e-59   Cicer arietinum [garbanzo]
ref|XP_009142127.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    203   9e-59   Brassica rapa
emb|CDY69051.1|  BnaAnng29210D                                          203   9e-59   Brassica napus [oilseed rape]
ref|NP_567742.1|  6-phosphofructokinase 3                               203   9e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016327.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   1e-58   Populus euphratica
ref|XP_010924465.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   1e-58   Elaeis guineensis
ref|XP_006856644.1|  hypothetical protein AMTR_s01089p00001250          197   1e-58   
ref|XP_008375839.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    202   1e-58   Malus domestica [apple tree]
ref|XP_008375838.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    202   1e-58   
ref|XP_010526087.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   1e-58   Tarenaya hassleriana [spider flower]
emb|CDP03227.1|  unnamed protein product                                202   1e-58   Coffea canephora [robusta coffee]
ref|XP_009126929.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   1e-58   Brassica rapa
ref|XP_006283577.1|  hypothetical protein CARUB_v10004629mg             202   1e-58   Capsella rubella
ref|XP_009337906.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   1e-58   Pyrus x bretschneideri [bai li]
gb|AIE47275.1|  phosphofructokinase                                     204   2e-58   Hevea brasiliensis [Para rubber tree]
ref|XP_010925503.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    204   2e-58   Elaeis guineensis
ref|XP_002275308.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   2e-58   Vitis vinifera
emb|CDY20715.1|  BnaA02g08550D                                          202   2e-58   Brassica napus [oilseed rape]
emb|CAN74837.1|  hypothetical protein VITISV_023326                     202   2e-58   Vitis vinifera
ref|XP_008387449.1|  PREDICTED: 6-phosphofructokinase 3-like            203   2e-58   Malus domestica [apple tree]
emb|CDY32873.1|  BnaC09g33200D                                          202   2e-58   Brassica napus [oilseed rape]
ref|XP_007160266.1|  hypothetical protein PHAVU_002G306800g             201   2e-58   Phaseolus vulgaris [French bean]
ref|XP_006412866.1|  hypothetical protein EUTSA_v10024824mg             201   3e-58   Eutrema salsugineum
ref|XP_009120176.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   3e-58   Brassica rapa
ref|XP_004158491.1|  PREDICTED: 6-phosphofructokinase 3-like            202   3e-58   
emb|CAB38956.1|  pyrophosphate-dependent phosphofructo-1-kinase         202   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010051556.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   3e-58   Eucalyptus grandis [rose gum]
dbj|BAB09881.1|  pyrophosphate-dependent phosphofructo-1-kinase-l...    201   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438324.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   3e-58   Camelina sativa [gold-of-pleasure]
ref|NP_568842.1|  6-phosphofructokinase 7                               201   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KGN58020.1|  hypothetical protein Csa_3G435010                       202   3e-58   Cucumis sativus [cucumbers]
gb|KDO79936.1|  hypothetical protein CISIN_1g012056mg                   201   3e-58   Citrus sinensis [Valencia orange]
ref|XP_006285234.1|  hypothetical protein CARUB_v10006594mg             201   3e-58   Capsella rubella
ref|XP_010447879.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009128951.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   4e-58   Brassica rapa
ref|XP_006450746.1|  hypothetical protein CICLE_v10008181mg             201   4e-58   Citrus clementina
gb|KDO79934.1|  hypothetical protein CISIN_1g012056mg                   201   4e-58   Citrus sinensis [Valencia orange]
ref|XP_004243602.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   4e-58   Solanum lycopersicum
ref|XP_006280374.1|  hypothetical protein CARUB_v10026301mg             201   4e-58   Capsella rubella
emb|CDY06829.1|  BnaC01g09280D                                          201   5e-58   Brassica napus [oilseed rape]
emb|CDY41800.1|  BnaC02g12110D                                          201   5e-58   Brassica napus [oilseed rape]
ref|XP_009395051.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412865.1|  hypothetical protein EUTSA_v10024824mg             200   6e-58   Eutrema salsugineum
ref|XP_009395050.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    202   7e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB06662.1|  hypothetical protein B456_001G025000                    202   7e-58   Gossypium raimondii
ref|XP_004243600.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   7e-58   Solanum lycopersicum
ref|XP_002309230.2|  hypothetical protein POPTR_0006s15730g             202   8e-58   Populus trichocarpa [western balsam poplar]
gb|AFW75541.1|  hypothetical protein ZEAMMB73_660971                    201   8e-58   Zea mays [maize]
ref|XP_010668815.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    200   1e-57   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008794086.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   1e-57   Phoenix dactylifera
ref|XP_008648820.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   1e-57   Zea mays [maize]
ref|XP_010433524.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    200   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004149188.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    201   1e-57   
ref|XP_008795495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    196   1e-57   Phoenix dactylifera
ref|XP_010438323.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010438777.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    200   1e-57   Camelina sativa [gold-of-pleasure]
gb|KFK27231.1|  hypothetical protein AALP_AA8G354500                    200   1e-57   Arabis alpina [alpine rockcress]
ref|XP_009132191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    200   1e-57   Brassica rapa
ref|XP_008375836.1|  PREDICTED: 6-phosphofructokinase 3-like            200   1e-57   Malus domestica [apple tree]
ref|XP_008375837.1|  PREDICTED: 6-phosphofructokinase 6-like            200   1e-57   Malus domestica [apple tree]
ref|XP_002437847.1|  hypothetical protein SORBIDRAFT_10g003650          201   1e-57   Sorghum bicolor [broomcorn]
emb|CDY11911.1|  BnaC03g13370D                                          199   1e-57   Brassica napus [oilseed rape]
ref|XP_002515946.1|  phosphofructokinase, putative                      201   1e-57   Ricinus communis
ref|XP_010668810.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    200   2e-57   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KDO79935.1|  hypothetical protein CISIN_1g012056mg                   198   2e-57   Citrus sinensis [Valencia orange]
ref|XP_008795494.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    196   2e-57   
ref|XP_006412864.1|  hypothetical protein EUTSA_v10024824mg             201   2e-57   Eutrema salsugineum
ref|XP_009337915.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    198   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_010433122.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008795493.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    196   3e-57   Phoenix dactylifera
ref|XP_008794084.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    201   3e-57   Phoenix dactylifera
ref|XP_010541000.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_009337910.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    198   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_009395732.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB65625.1|  hypothetical protein B456_010G103900                    199   4e-57   Gossypium raimondii
ref|NP_001054859.1|  Os05g0194900                                       193   4e-57   
ref|XP_008447566.1|  PREDICTED: 6-phosphofructokinase 6-like            199   4e-57   Cucumis melo [Oriental melon]
ref|XP_009337911.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    198   5e-57   Pyrus x bretschneideri [bai li]
ref|XP_010924464.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    198   5e-57   Elaeis guineensis
ref|XP_009337913.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    198   5e-57   Pyrus x bretschneideri [bai li]
ref|XP_009337914.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    198   5e-57   Pyrus x bretschneideri [bai li]
ref|XP_002309528.2|  hypothetical protein POPTR_0006s25170g             198   5e-57   Populus trichocarpa [western balsam poplar]
ref|XP_008799762.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   6e-57   Phoenix dactylifera
ref|XP_009337916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    198   6e-57   Pyrus x bretschneideri [bai li]
ref|XP_010915352.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   7e-57   Elaeis guineensis
ref|XP_010433121.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006643863.1|  PREDICTED: 6-phosphofructokinase 3-like            199   9e-57   Oryza brachyantha
ref|XP_010540999.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   9e-57   Tarenaya hassleriana [spider flower]
ref|NP_001151911.1|  6-phosphofructokinase                              199   1e-56   Zea mays [maize]
ref|XP_009387228.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004964832.1|  PREDICTED: 6-phosphofructokinase 7-like            199   1e-56   Setaria italica
gb|ACL53548.1|  unknown                                                 199   1e-56   Zea mays [maize]
ref|XP_003564328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    199   1e-56   Brachypodium distachyon [annual false brome]
ref|XP_006583042.1|  PREDICTED: 6-phosphofructokinase 3-like            196   2e-56   Glycine max [soybeans]
gb|AFW80261.1|  hypothetical protein ZEAMMB73_064922                    194   2e-56   Zea mays [maize]
gb|KCW69691.1|  hypothetical protein EUGRSUZ_F03086                     196   2e-56   Eucalyptus grandis [rose gum]
gb|KHN05322.1|  6-phosphofructokinase 3                                 196   2e-56   Glycine soja [wild soybean]
ref|XP_010086908.1|  6-phosphofructokinase 3                            197   2e-56   Morus notabilis
gb|KHN39263.1|  6-phosphofructokinase 3                                 196   2e-56   Glycine soja [wild soybean]
ref|XP_011072633.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    196   2e-56   Sesamum indicum [beniseed]
ref|XP_003533035.1|  PREDICTED: 6-phosphofructokinase 3-like            196   2e-56   Glycine max [soybeans]
tpg|DAA57730.1|  TPA: hypothetical protein ZEAMMB73_790705              189   2e-56   Zea mays [maize]
ref|XP_009388585.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    197   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010451175.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    196   3e-56   Camelina sativa [gold-of-pleasure]
emb|CDX88580.1|  BnaA03g10690D                                          196   4e-56   Brassica napus [oilseed rape]
ref|NP_001042273.1|  Os01g0191700                                       197   4e-56   
gb|KJB18571.1|  hypothetical protein B456_003G061100                    194   5e-56   Gossypium raimondii
gb|EAZ10866.1|  hypothetical protein OsJ_00706                          196   5e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388583.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    197   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006853746.1|  hypothetical protein AMTR_s00056p00183670          195   7e-56   Amborella trichopoda
ref|XP_009344489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    196   9e-56   Pyrus x bretschneideri [bai li]
dbj|BAK01448.1|  predicted protein                                      195   1e-55   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004494953.1|  PREDICTED: 6-phosphofructokinase 3-like            196   1e-55   
ref|XP_002864472.1|  phosphofructokinase family protein                 194   1e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_008798601.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    196   2e-55   Phoenix dactylifera
ref|NP_001147976.1|  6-phosphofructokinase 2                            195   2e-55   Zea mays [maize]
ref|XP_011019558.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    194   2e-55   Populus euphratica
ref|XP_010914787.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    195   2e-55   Elaeis guineensis
dbj|BAD69330.1|  putative pyrophosphate-dependent phosphofructo-1...    195   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99719.1|  hypothetical protein OsI_21704                          195   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_007135617.1|  hypothetical protein PHAVU_010G143900g             195   3e-55   Phaseolus vulgaris [French bean]
ref|XP_006656646.1|  PREDICTED: 6-phosphofructokinase 3-like            195   3e-55   
ref|XP_004969889.1|  PREDICTED: 6-phosphofructokinase 3-like            191   3e-55   Setaria italica
ref|XP_008654297.1|  PREDICTED: uncharacterized protein LOC100192...    194   6e-55   Zea mays [maize]
gb|KCW79598.1|  hypothetical protein EUGRSUZ_C00956                     192   6e-55   Eucalyptus grandis [rose gum]
ref|XP_004968501.1|  PREDICTED: 6-phosphofructokinase 3-like            194   6e-55   Setaria italica
ref|XP_007024343.1|  6-phosphofructokinase 3                            194   7e-55   Theobroma cacao [chocolate]
ref|NP_001266546.1|  6-phosphofructokinase 2                            194   7e-55   Zea mays [maize]
ref|XP_002457198.1|  hypothetical protein SORBIDRAFT_03g003140          193   8e-55   Sorghum bicolor [broomcorn]
ref|XP_004287498.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    193   9e-55   Fragaria vesca subsp. vesca
ref|XP_003564709.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    193   9e-55   Brachypodium distachyon [annual false brome]
ref|NP_001241814.1|  6-phosphofructokinase 2                            193   1e-54   Zea mays [maize]
ref|XP_002439415.1|  hypothetical protein SORBIDRAFT_09g006030          193   1e-54   Sorghum bicolor [broomcorn]
ref|XP_002463719.1|  hypothetical protein SORBIDRAFT_01g004810          193   1e-54   Sorghum bicolor [broomcorn]
ref|XP_009409366.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    193   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148080.1|  6-phosphofructokinase 2                            193   2e-54   Zea mays [maize]
gb|ACN34221.1|  unknown                                                 192   2e-54   Zea mays [maize]
gb|EAY96852.1|  hypothetical protein OsI_18773                          192   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_007150587.1|  hypothetical protein PHAVU_005G165100g             191   2e-54   Phaseolus vulgaris [French bean]
gb|AAT38069.1|  putative pyrophosphate-fructose-6-phosphate-1-pho...    192   3e-54   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85856.1|  predicted protein                                      192   3e-54   Hordeum vulgare subsp. vulgare [barley]
gb|EMT19126.1|  6-phosphofructokinase 3                                 192   3e-54   Aegilops tauschii
dbj|BAJ85701.1|  predicted protein                                      192   3e-54   Hordeum vulgare subsp. vulgare [barley]
emb|CDM81680.1|  unnamed protein product                                192   3e-54   Triticum aestivum [Canadian hard winter wheat]
gb|EMS52572.1|  6-phosphofructokinase 3                                 192   3e-54   Triticum urartu
ref|XP_004960908.1|  PREDICTED: 6-phosphofructokinase 3-like            192   4e-54   Setaria italica
gb|EAZ13474.1|  hypothetical protein OsJ_03390                          194   4e-54   
ref|XP_008672828.1|  PREDICTED: 6-phosphofructokinase isoform X1        194   4e-54   
ref|XP_008672829.1|  PREDICTED: 6-phosphofructokinase isoform X2        194   5e-54   
gb|KGN58018.1|  hypothetical protein Csa_3G434990                       189   8e-54   
ref|XP_003566456.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    190   2e-53   
gb|KDO40004.1|  hypothetical protein CISIN_1g0094441mg                  181   2e-53   
gb|EMS48156.1|  6-phosphofructokinase 3                                 192   2e-53   
ref|XP_006644676.1|  PREDICTED: 6-phosphofructokinase 7-like            190   3e-53   
ref|XP_004149187.1|  PREDICTED: 6-phosphofructokinase 3-like            189   3e-53   
gb|ACU20351.1|  unknown                                                 183   3e-53   
dbj|BAD86939.1|  putative pyrophosphate-dependent phosphofructo-1...    189   4e-53   
ref|XP_008649450.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    189   5e-53   
ref|XP_006654136.1|  PREDICTED: 6-phosphofructokinase 3-like            189   5e-53   
ref|XP_002458460.1|  hypothetical protein SORBIDRAFT_03g034060          189   5e-53   
ref|NP_001147854.1|  6-phosphofructokinase                              189   5e-53   
gb|ACR36601.1|  unknown                                                 189   5e-53   
gb|EYU20177.1|  hypothetical protein MIMGU_mgv1a004503mg                188   6e-53   
ref|XP_003597663.1|  6-phosphofructokinase                              187   8e-53   
ref|XP_010098164.1|  6-phosphofructokinase 4                            185   9e-53   
ref|XP_011076434.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    188   1e-52   
ref|XP_010275416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    188   1e-52   
gb|KCW90883.1|  hypothetical protein EUGRSUZ_A02923                     186   1e-52   
ref|XP_010688378.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    187   1e-52   
ref|XP_003569758.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    189   2e-52   
dbj|BAK02245.1|  predicted protein                                      187   2e-52   
ref|XP_010275417.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    187   2e-52   
ref|XP_003543617.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    186   3e-52   
ref|XP_002440110.1|  hypothetical protein SORBIDRAFT_09g026150          187   3e-52   
ref|XP_010546132.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    187   3e-52   
gb|KCW90878.1|  hypothetical protein EUGRSUZ_A02923                     186   3e-52   
ref|XP_008649908.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    187   4e-52   
ref|XP_003568068.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    186   4e-52   
gb|ABR17197.1|  unknown                                                 187   4e-52   
ref|XP_008447679.1|  PREDICTED: 6-phosphofructokinase 6-like            186   5e-52   
gb|KHG00436.1|  6-phosphofructokinase 3 -like protein                   186   7e-52   
ref|XP_004961440.1|  PREDICTED: 6-phosphofructokinase 7-like            186   7e-52   
ref|XP_009362710.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    186   7e-52   
ref|XP_010062614.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    185   1e-51   
ref|XP_008234443.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    185   1e-51   
ref|XP_008375682.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    185   1e-51   
ref|XP_007038279.1|  Phosphofructokinase 4                              185   1e-51   
ref|XP_011022362.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    184   1e-51   
gb|KJB07889.1|  hypothetical protein B456_001G051000                    185   1e-51   
gb|EMS54289.1|  6-phosphofructokinase 3                                 184   1e-51   
ref|XP_003546601.1|  PREDICTED: 6-phosphofructokinase 3 isoform X1      183   2e-51   
ref|XP_008453875.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    182   2e-51   
ref|XP_006385829.1|  hypothetical protein POPTR_0003s15090g             183   3e-51   
gb|EMT10635.1|  6-phosphofructokinase 3                                 184   4e-51   
ref|XP_007219544.1|  hypothetical protein PRUPE_ppa003986mg             183   8e-51   
gb|KDP22466.1|  hypothetical protein JCGZ_26297                         182   1e-50   
ref|XP_008453872.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    182   1e-50   
gb|ABD96051.1|  putative phosphofructokinase                            181   2e-50   
gb|EEE64418.1|  hypothetical protein OsJ_19262                          182   2e-50   
ref|NP_001056090.1|  Os05g0524400                                       182   2e-50   
ref|XP_004235183.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    182   2e-50   
ref|XP_010546134.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    182   2e-50   
gb|EEC79555.1|  hypothetical protein OsI_20679                          182   2e-50   
ref|XP_003536274.2|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    182   2e-50   
gb|KHG19950.1|  6-phosphofructokinase 4, chloroplastic -like protein    182   2e-50   
ref|XP_009136495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    181   2e-50   
ref|XP_006421534.1|  hypothetical protein CICLE_v10004702mg             181   2e-50   
ref|XP_004309023.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    181   3e-50   
emb|CDP05378.1|  unnamed protein product                                181   3e-50   
emb|CDY02131.1|  BnaA03g40360D                                          181   3e-50   
ref|XP_006394490.1|  hypothetical protein EUTSA_v10003971mg             181   3e-50   
ref|XP_004146902.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    181   3e-50   
ref|XP_006490011.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    181   4e-50   
gb|KHN37911.1|  6-phosphofructokinase 4, chloroplastic                  181   5e-50   
ref|XP_010457508.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    181   5e-50   
ref|XP_002864742.1|  phosphofructokinase family protein                 181   5e-50   
ref|XP_010443983.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    181   5e-50   
gb|AAP80666.1|AF479047_1  pyrophosphate-dependent phosphofructo-1...    170   5e-50   
emb|CDY23054.1|  BnaC07g31330D                                          180   8e-50   
ref|XP_010483840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    179   1e-49   
gb|KFK27910.1|  hypothetical protein AALP_AA8G446100                    179   1e-49   
ref|XP_006654672.1|  PREDICTED: 6-phosphofructokinase 3-like            180   2e-49   
ref|XP_006358222.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    179   2e-49   
ref|NP_200966.2|  6-phosphofructokinase 4                               179   2e-49   
ref|XP_002511010.1|  phosphofructokinase, putative                      178   3e-49   
ref|XP_004496088.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    177   3e-49   
gb|AIE47272.1|  phosphofructokinase                                     178   4e-49   
ref|XP_002282309.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    178   4e-49   
ref|XP_002975191.1|  hypothetical protein SELMODRAFT_150344             178   4e-49   
ref|XP_002977595.1|  hypothetical protein SELMODRAFT_176350             177   5e-49   
ref|XP_009588737.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    178   7e-49   
ref|XP_009804348.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    177   8e-49   
ref|XP_004496087.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    177   1e-48   
ref|XP_006354082.1|  PREDICTED: 6-phosphofructokinase 3-like            174   8e-48   
ref|NP_001032120.1|  6-phosphofructokinase 4                            174   2e-47   
ref|XP_010448295.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    162   4e-47   
ref|XP_004238509.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   8e-47   
ref|XP_006837361.1|  hypothetical protein AMTR_s00111p00106690          171   2e-46   
ref|XP_007144193.1|  hypothetical protein PHAVU_007G136000g             170   3e-46   
ref|XP_001766110.1|  predicted protein                                  170   3e-46   
ref|XP_001764541.1|  predicted protein                                  170   4e-46   
ref|XP_001782327.1|  predicted protein                                  170   4e-46   
ref|XP_010047298.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    169   6e-46   
gb|EEC71448.1|  hypothetical protein OsI_03669                          169   2e-45   
ref|XP_003637099.1|  6-phosphofructokinase                              167   4e-45   
ref|XP_003591658.1|  6-phosphofructokinase                              167   4e-45   
ref|XP_001780597.1|  predicted protein                                  164   2e-44   
gb|KCW45308.1|  hypothetical protein EUGRSUZ_L01027                     152   7e-43   
ref|XP_001770890.1|  predicted protein                                  161   7e-43   
ref|XP_010451322.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    149   3e-42   
gb|EPS73018.1|  hypothetical protein M569_01738                         156   6e-42   
gb|KJB65621.1|  hypothetical protein B456_010G1038001                   145   8e-41   
ref|XP_006280423.1|  hypothetical protein CARUB_v10026356mg             152   9e-40   
ref|XP_005709060.1|  6-phosphofructokinase                              145   3e-38   
ref|NP_001131170.1|  uncharacterized protein LOC100192478               144   7e-38   
gb|AFW80260.1|  hypothetical protein ZEAMMB73_064922                    144   7e-38   
ref|XP_005702907.1|  6-phosphofructokinase                              145   4e-37   
gb|AFW80264.1|  hypothetical protein ZEAMMB73_064922                    144   1e-36   
ref|XP_008343688.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    138   1e-36   
gb|AFW85828.1|  hypothetical protein ZEAMMB73_244047                    142   8e-36   
gb|KDO40006.1|  hypothetical protein CISIN_1g0094441mg                  134   8e-36   
emb|CAN61777.1|  hypothetical protein VITISV_010426                     137   8e-36   
gb|EAZ35851.1|  hypothetical protein OsJ_20149                          140   2e-35   
gb|ACN31923.1|  unknown                                                 140   2e-35   
ref|XP_004172311.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    136   4e-35   
gb|ACN41013.1|  unknown                                                 139   4e-35   
ref|XP_005537083.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    139   7e-35   
gb|KCW90880.1|  hypothetical protein EUGRSUZ_A02923                     137   3e-34   
ref|XP_010094794.1|  6-phosphofructokinase 4                            136   3e-34   
gb|KCW90879.1|  hypothetical protein EUGRSUZ_A02923                     137   3e-34   
ref|XP_007132903.1|  hypothetical protein PHAVU_011G134700g             126   2e-33   
ref|XP_001008692.1|  Phosphofructokinase family protein                 134   4e-33   
ref|XP_006661356.1|  PREDICTED: 6-phosphofructokinase 2-like            131   4e-33   
gb|AIE47271.1|  phosphofructokinase                                     133   5e-33   
ref|XP_004037415.1|  phosphofructokinase family protein, putative       133   5e-33   
ref|XP_005536329.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    133   7e-33   
gb|EMT24858.1|  6-phosphofructokinase 2                                 130   1e-32   
ref|XP_004039656.1|  phosphofructokinase, putative                      132   1e-32   
gb|KHN00985.1|  6-phosphofructokinase 4, chloroplastic                  124   1e-32   
ref|XP_011096141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    131   1e-32   
ref|XP_006857658.1|  hypothetical protein AMTR_s00061p00151020          132   2e-32   
ref|XP_002525025.1|  phosphofructokinase, putative                      132   2e-32   
emb|CDX77799.1|  BnaC07g20530D                                          131   2e-32   
gb|KDP35553.1|  hypothetical protein JCGZ_08991                         131   3e-32   
ref|XP_003579939.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    131   3e-32   
ref|XP_009101383.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    131   3e-32   
dbj|BAG92288.1|  unnamed protein product                                128   3e-32   
ref|XP_010052498.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    131   3e-32   
gb|EMS53637.1|  6-phosphofructokinase 2                                 130   5e-32   
emb|CDY17703.1|  BnaA06g35220D                                          130   5e-32   
ref|XP_009617768.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    130   5e-32   
ref|NP_001063482.1|  Os09g0479800                                       130   5e-32   
gb|EEE69916.1|  hypothetical protein OsJ_29767                          130   5e-32   
ref|XP_008440953.1|  PREDICTED: 6-phosphofructokinase 2                 130   6e-32   
ref|XP_007213751.1|  hypothetical protein PRUPE_ppa004167m1g            127   9e-32   
gb|KHG28031.1|  6-phosphofructokinase 2 -like protein                   130   9e-32   
ref|XP_006653509.1|  PREDICTED: 6-phosphofructokinase 2-like            129   9e-32   
dbj|BAK02022.1|  predicted protein                                      130   9e-32   
ref|XP_004236642.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    129   1e-31   
ref|NP_001130878.1|  uncharacterized protein LOC100191982               129   1e-31   
ref|XP_006368809.1|  hypothetical protein POPTR_0001s11810g             124   1e-31   
ref|XP_006350241.1|  PREDICTED: 6-phosphofructokinase 2-like            129   1e-31   
ref|XP_009779364.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    129   1e-31   
gb|EYU27630.1|  hypothetical protein MIMGU_mgv1a005772mg                129   2e-31   
ref|XP_001439166.1|  hypothetical protein                               129   2e-31   
ref|XP_002963124.1|  hypothetical protein SELMODRAFT_438337             129   2e-31   
ref|XP_002448010.1|  hypothetical protein SORBIDRAFT_06g019610          128   3e-31   
gb|EEE61159.1|  hypothetical protein OsJ_15126                          128   3e-31   
ref|XP_002980196.1|  hypothetical protein SELMODRAFT_178124             128   3e-31   
gb|EEC77447.1|  hypothetical protein OsI_16253                          128   3e-31   
ref|XP_001444382.1|  hypothetical protein                               128   4e-31   
ref|XP_006368810.1|  hypothetical protein POPTR_0001s11810g             124   4e-31   
ref|XP_010942916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    128   4e-31   
ref|XP_004134815.1|  PREDICTED: 6-phosphofructokinase 2-like            127   5e-31   
emb|CAH67040.1|  OSIGBa0124N08.2                                        127   5e-31   
ref|XP_007026417.1|  Phosphofructokinase 2                              127   6e-31   
ref|NP_001053045.1|  Os04g0469500                                       127   6e-31   
ref|XP_011040110.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    127   6e-31   
ref|NP_199592.1|  6-phosphofructokinase 2                               127   7e-31   
ref|XP_006373566.1|  hypothetical protein POPTR_0016s00450g             127   7e-31   
emb|CAE75963.1|  OSJNBa0016O02.24                                       127   7e-31   
gb|KFK31346.1|  hypothetical protein AALP_AA6G100300                    127   7e-31   
ref|XP_004293419.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    127   8e-31   
ref|XP_004975916.1|  PREDICTED: 6-phosphofructokinase 2-like            127   1e-30   
ref|XP_010503512.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    126   1e-30   
ref|XP_006291021.1|  hypothetical protein CARUB_v10017134mg             126   1e-30   
emb|CDP14249.1|  unnamed protein product                                120   2e-30   
ref|XP_010426370.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    126   2e-30   
ref|XP_010515191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    126   2e-30   
ref|XP_010096496.1|  6-phosphofructokinase 2                            126   2e-30   
ref|XP_010246561.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    126   2e-30   
ref|XP_006398483.1|  hypothetical protein EUTSA_v10000886mg             125   2e-30   
ref|XP_008779196.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    125   3e-30   
ref|XP_010530089.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    125   4e-30   
ref|XP_008779034.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    124   5e-30   
gb|KJB57887.1|  hypothetical protein B456_009G185000                    124   7e-30   
ref|XP_008224680.1|  PREDICTED: 6-phosphofructokinase 2                 125   8e-30   
ref|XP_009401489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    124   8e-30   
gb|KDO78652.1|  hypothetical protein CISIN_1g042534mg                   124   9e-30   
ref|XP_006293956.1|  hypothetical protein CARUB_v10022950mg             124   9e-30   
ref|XP_006467226.1|  PREDICTED: 6-phosphofructokinase 2-like            124   1e-29   
ref|XP_006449986.1|  hypothetical protein CICLE_v10015031mg             124   1e-29   
ref|XP_005710269.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    124   1e-29   
gb|KHN40226.1|  6-phosphofructokinase 2                                 122   2e-29   
ref|XP_006404705.1|  hypothetical protein EUTSA_v10000117mg             123   2e-29   
ref|XP_004499341.1|  PREDICTED: 6-phosphofructokinase 2-like            122   3e-29   
ref|XP_006584114.1|  PREDICTED: 6-phosphofructokinase 2-like            122   4e-29   
ref|XP_003635479.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    122   4e-29   
ref|XP_010472236.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    122   4e-29   
ref|XP_007154072.1|  hypothetical protein PHAVU_003G088700g             122   5e-29   
emb|CBI41063.3|  unnamed protein product                                122   5e-29   
ref|XP_010683074.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    122   6e-29   
ref|XP_010417006.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    122   6e-29   
ref|XP_010429169.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    122   6e-29   
gb|AAD22353.1|  putative pyrophosphate--fructose-6-phosphate 1-ph...    121   8e-29   
ref|NP_850025.1|  6-phosphofructokinase 5                               121   1e-28   
ref|XP_009349890.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    121   1e-28   
gb|KHG10318.1|  6-phosphofructokinase 5, chloroplastic -like protein    115   2e-28   
ref|XP_002878619.1|  phosphofructokinase family protein                 120   3e-28   
ref|XP_001448837.1|  hypothetical protein                               122   4e-28   
gb|KFK32811.1|  hypothetical protein AALP_AA6G290900                    120   4e-28   
ref|XP_004040132.1|  hypothetical protein IMG5_000550                   120   4e-28   
emb|CDX90382.1|  BnaA08g16020D                                          119   5e-28   
emb|CDX76918.1|  BnaC08g35040D                                          119   5e-28   
emb|CDY52512.1|  BnaC03g61050D                                          119   5e-28   
emb|CDY13756.1|  BnaA09g42580D                                          119   5e-28   
ref|XP_009109420.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    119   5e-28   



>ref|XP_009757482.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3, partial [Nicotiana 
sylvestris]
Length=295

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA E+S +++E DASGNKLLQDVG+W+SQKI+D + K+ K PITL
Sbjct  106  GHMVIVIAEGAGQELLAEENSHARSEQDASGNKLLQDVGLWVSQKIRDHFEKKLKMPITL  165

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAMAG+TGFT G+VNGR TYIPFNRITE+
Sbjct  166  KYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAMAGYTGFTSGVVNGRQTYIPFNRITEK  225

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            QNKVVITDRMWARLLSSTNQPSFL  K++ +V++ +    QLL   N  +  S T
Sbjct  226  QNKVVITDRMWARLLSSTNQPSFLSTKDIVEVQKGQHPPTQLLDGDNNDSETSGT  280



>emb|CDP08198.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 145/182 (80%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELLA    ++  +  + GNKLLQDVG+W+SQKIKDY +KQRK  ITL
Sbjct  303  GHMVIVIAEGAGQELLAESGHANDEQDAS-GNKLLQDVGLWISQKIKDYFAKQRKMAITL  361

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLV+GRHTYIPFNRI E 
Sbjct  362  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVHGRHTYIPFNRIIET  421

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL-----GAANGKTPASKT  522
            QNKVVITDRMWARLLSSTNQPSFL P  + + K+EE  + QLL      + NG T   K 
Sbjct  422  QNKVVITDRMWARLLSSTNQPSFLGPNAIVEAKKEEAPETQLLDDDGANSGNGDTGNHKI  481

Query  523  PA  528
             A
Sbjct  482  EA  483



>ref|XP_009758764.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Nicotiana 
sylvestris]
Length=485

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLAAE+S +K E DASGNKLLQDVG+W+SQKI+D ++K+ K  ITL
Sbjct  311  GHMVIVIAEGAGQELLAAENSLAKNEQDASGNKLLQDVGLWISQKIRDHFAKKPKMAITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPFNRITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            QN VVITDRMWARLLSSTNQPSFLCPK+VE+VK EE+ + QLL   N
Sbjct  431  QNMVVITDRMWARLLSSTNQPSFLCPKDVEEVKNEEQPQTQLLDGDN  477



>ref|XP_009603443.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Nicotiana tomentosiformis]
Length=485

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLAAE+S +K E DASGNKLLQDVG+W+SQKI+D ++K+ K  ITL
Sbjct  311  GHMVIVIAEGAGQELLAAENSLAKNEQDASGNKLLQDVGLWISQKIRDHFAKKPKMAITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPFNRITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            QN VVITDRMWARLLSSTNQPSFLCPK+VE+VK EE+ + QLL   N
Sbjct  431  QNMVVITDRMWARLLSSTNQPSFLCPKDVEEVKNEEQPQTQLLDGDN  477



>ref|XP_009602786.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Nicotiana tomentosiformis]
Length=500

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA E+S +++E DASGNKLLQDVG+W+SQKI+D + K+ + PITL
Sbjct  311  GHMVIVIAEGAGQELLAEENSHARSEQDASGNKLLQDVGLWVSQKIRDHFEKKLRIPITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAMAG+TGFT G+VNGR TYIPFNRITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAMAGYTGFTSGVVNGRQTYIPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            QNKVVITDRMWARLLSSTNQPSFL  K++ +V++ +    QLL   N  +  S T
Sbjct  431  QNKVVITDRMWARLLSSTNQPSFLSTKDIVEVQKGQHPPTQLLDGDNNDSETSGT  485



>ref|XP_010095449.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB60275.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=495

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 142/174 (82%), Gaps = 3/174 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S K ++   GNKLL DVG+WLSQ+IKD +SKQR F I L
Sbjct  319  GHMVIVIAEGAGQELLSESLESMKQDAS--GNKLLPDVGLWLSQRIKDHFSKQRNFAINL  376

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF+RITER
Sbjct  377  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFHRITER  436

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASK  519
            QNKVVITDRMWARLLSSTNQPSF  PKE+ + K+E +   QLL   N +  + K
Sbjct  437  QNKVVITDRMWARLLSSTNQPSFPNPKELAEAKKESEAPTQLLDGENKEDQSVK  490



>ref|XP_004253102.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Solanum 
lycopersicum]
Length=485

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA E++ +K E DASGNKLLQDVG+W+SQKI+D ++K+ K PITL
Sbjct  311  GHMVIVIAEGAGQELLAEENAHAKNEQDASGNKLLQDVGLWISQKIRDHFAKKTKMPITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPFNRITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGFTSGLVNGRQTYIPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            QN VVITDRMWARLLSSTNQPSFL  K++E++K+EE+ + QLL   N
Sbjct  431  QNMVVITDRMWARLLSSTNQPSFLRVKDIEEIKKEEQPQTQLLDGDN  477



>ref|XP_007137260.1| hypothetical protein PHAVU_009G112500g [Phaseolus vulgaris]
 gb|ESW09254.1| hypothetical protein PHAVU_009G112500g [Phaseolus vulgaris]
Length=339

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL     +   +  + GNKLLQDVG+W+S KIKD ++++ K  I L
Sbjct  133  GHMVIVIAEGAGQDLLTESMQAMDQKDAS-GNKLLQDVGLWISHKIKDHFARKDKIAINL  191

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNV CTLLAQS VHG MAG++GFT GLVNGRHTYIPFNRITER
Sbjct  192  KYIDPTYMIRAIPSNASDNVNCTLLAQSAVHGVMAGYSGFTVGLVNGRHTYIPFNRITER  251

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            QNKVVITDRMWARLLSSTNQPSFL PK++++ K+ E+   +LL  +N
Sbjct  252  QNKVVITDRMWARLLSSTNQPSFLSPKDLDEAKKAEQPPSELLEGSN  298



>gb|EYU29302.1| hypothetical protein MIMGU_mgv1a005820mg [Erythranthe guttata]
Length=469

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 6/144 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGA QELL A++    +     GNKLLQDVG+W+SQKIK+ ++KQ K PITL
Sbjct  311  GHMVIVIAEGAAQELLTAKNEEDAS-----GNKLLQDVGLWISQKIKEHFAKQNKIPITL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHT IPFNRITE+
Sbjct  366  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHTCIPFNRITEK  425

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  426  QNKVVITDRMWARLLSSTNQPSFL  449



>ref|XP_011094240.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=489

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 128/144 (89%), Gaps = 6/144 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLAA++    +     GNKLLQDVG+W+SQKIK+ ++K+ K PITL
Sbjct  311  GHMVIVIAEGAGQELLAAKNEEDAS-----GNKLLQDVGLWISQKIKEHFAKKNKMPITL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSN SDNVYCTLLAQS VHGAMAGFTGFT GLVNGR TYIPFNRITE+
Sbjct  366  KYIDPTYMIRAIPSNGSDNVYCTLLAQSAVHGAMAGFTGFTSGLVNGRQTYIPFNRITEK  425

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLL+STNQPSFL
Sbjct  426  QNKVVITDRMWARLLASTNQPSFL  449



>gb|EYU20401.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 6/144 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLAA+     +     GNKLLQDVG+W+SQKIKD +SKQ K PITL
Sbjct  303  GHMVIVIAEGAGQELLAAKDEQDAS-----GNKLLQDVGLWISQKIKDHFSKQGKLPITL  357

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRITE 
Sbjct  358  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITEG  417

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSF+
Sbjct  418  QNKVVITDRMWARLLSSTNQPSFV  441



>ref|XP_011081730.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=496

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 8/177 (5%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA ++    +     GNKLLQDVG+W+SQ+IK+ ++K+ K PITL
Sbjct  311  GHMVIVIAEGAGQELLAEKNEQDAS-----GNKLLQDVGLWISQQIKEHFAKRTKSPITL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPFNRITE 
Sbjct  366  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFNRITES  425

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA--NGKTPASKT  522
            QNKVVITDRMWARLLSSTNQPSFL PKE+++ K+E+  + QLL  A  +GK    KT
Sbjct  426  QNKVVITDRMWARLLSSTNQPSFLGPKEIDEFKKEQGPQTQLLDDARDSGKGTPGKT  482



>gb|EYU20400.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 6/144 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLAA+     +     GNKLLQDVG+W+SQKIKD +SKQ K PITL
Sbjct  303  GHMVIVIAEGAGQELLAAKDEQDAS-----GNKLLQDVGLWISQKIKDHFSKQGKLPITL  357

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRITE 
Sbjct  358  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITEG  417

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSF+
Sbjct  418  QNKVVITDRMWARLLSSTNQPSFV  441



>ref|XP_006342512.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=485

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA E++ +K E DASGNKLLQDVG+W+SQKI+D ++ + K PITL
Sbjct  311  GHMVIVIAEGAGQELLAEENAHAKNEQDASGNKLLQDVGLWISQKIRDHFATKTKMPITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPFNRITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGFTSGLVNGRQTYIPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  431  QNMVVITDRMWARLLSSTNQPSFL  454



>gb|KJB83095.1| hypothetical protein B456_013G229200 [Gossypium raimondii]
Length=476

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +1

Query  4    HMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLKY  183
            HMVIVIAEGAGQELL+    S+   S   GNKLLQDVG+W+SQ IKD+  ++K PI LKY
Sbjct  315  HMVIVIAEGAGQELLSQSIQSTTDAS---GNKLLQDVGLWISQSIKDHFSKQKMPINLKY  371

Query  184  IDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQN  363
            IDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIPFNRI E+QN
Sbjct  372  IDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHTYIPFNRIIEKQN  431

Query  364  KVVITDRMWARLLSSTNQPSFLCP  435
            KVVITDRMWARLLSSTNQPSFL P
Sbjct  432  KVVITDRMWARLLSSTNQPSFLRP  455



>ref|XP_003522720.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN10174.1| 6-phosphofructokinase 3 [Glycine soja]
Length=509

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL     +   +  + GNKLLQDVG+W+S KIKD ++++ K PI L
Sbjct  312  GHMVIVIAEGAGQDLLTESMQAMDQKDAS-GNKLLQDVGLWISHKIKDHFARKDKIPINL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAI SNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIPFNRI ER
Sbjct  371  KYIDPTYMIRAIQSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFNRINER  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            QNKVVITDRMWARLLSSTNQPSFL PK++E+ K+ E+   +LL   N
Sbjct  431  QNKVVITDRMWARLLSSTNQPSFLSPKDLEEAKKAEQPPTELLEGNN  477



>gb|KDO55889.1| hypothetical protein CISIN_1g0098041mg, partial [Citrus sinensis]
Length=233

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S+  +  + GNKLLQDVG+WLSQKIKD ++K++K PI L
Sbjct  43   GHMVIVIAEGAGQDLLAESIRSATQQDAS-GNKLLQDVGLWLSQKIKDHFAKEKKMPINL  101

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI E+
Sbjct  102  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEK  161

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+ VVITDRMWARLLSSTNQPSF+
Sbjct  162  QHHVVITDRMWARLLSSTNQPSFM  185



>gb|AFK48605.1| unknown [Lotus japonicus]
Length=207

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+L++    S   +  + GNKLLQDVG+W+SQK+K+ ++K++   ITL
Sbjct  48   GHMVIVIAEGAGQDLVSQSIQSMDKQDAS-GNKLLQDVGLWISQKLKENFAKKKTLAITL  106

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E 
Sbjct  107  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRINEG  166

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  167  QNKVVITDRMWARLLSSTNQPSFL  190



>ref|XP_007012967.1| 6-phosphofructokinase 3 [Theobroma cacao]
 gb|EOY30586.1| 6-phosphofructokinase 3 [Theobroma cacao]
Length=583

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S   E  + GNKLLQDVG+W+SQ+IKDY SKQRK PI L
Sbjct  405  GHMVIVIAEGAGQELLSESMQSMTKEDAS-GNKLLQDVGLWISQRIKDYFSKQRKMPINL  463

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E+
Sbjct  464  KYIDPTYMIRAIPSNASDNVYCTLLAQSVVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEK  523

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            QNKVV TDRMWARLLSSTNQPSFL  K+V + K + +   QLL   N
Sbjct  524  QNKVVTTDRMWARLLSSTNQPSFLSAKDVIEDKVDGEESNQLLDNGN  570



>gb|KHG01593.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
 gb|KHG02572.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=490

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 138/174 (79%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+L++    S   +  + GNKLLQDVG+W+S +IKD+  ++K PI LK
Sbjct  311  GHMVIVIAEGAGQDLVSESLQSMDQQDAS-GNKLLQDVGLWISHRIKDHFAKKKMPINLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPFNRITE+Q
Sbjct  370  YIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            NKVVITDRMWARLLSSTNQPSFL PK++ + KEE++    LL   N K   S T
Sbjct  430  NKVVITDRMWARLLSSTNQPSFLNPKDIAEAKEEKQPATGLLDGENCKEKKSNT  483



>gb|KHG29071.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=528

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMV+VIAEGAGQELL+    S   +  + GNKLLQDV +W+SQ+IKD +SK+RK  I L
Sbjct  359  GHMVLVIAEGAGQELLSESLQSMTQKDAS-GNKLLQDVALWISQRIKDHFSKERKMTINL  417

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  418  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITET  477

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFLCPKE+ + +  E+   +LL   NGK
Sbjct  478  QNKVVITDRMWARLLSSTNQPSFLCPKEILEDQGHEESSNELL--DNGK  524



>gb|KCW79592.1| hypothetical protein EUGRSUZ_C00952 [Eucalyptus grandis]
Length=230

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFPITL  177
            GHMVIVIAEGAGQEL++  + S     DASGNKL QDVG+W+SQKIKD+  QR K  ITL
Sbjct  49   GHMVIVIAEGAGQELMSQSNQSLDNGKDASGNKLFQDVGLWISQKIKDHFSQRGKMGITL  108

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPS ASDNVYCTLLAQS VHG MAG+TGFT GLVNGR TYIPF RITE+
Sbjct  109  KYIDPTYMIRAIPSIASDNVYCTLLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYRITEK  168

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN VVITDRMWARLLSSTNQPSF  P
Sbjct  169  QNNVVITDRMWARLLSSTNQPSFWSP  194



>ref|XP_008337072.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=300

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL+    S   +  + GNK L+DVG+W+S++IK  + +Q+K  I L
Sbjct  120  GHMVIVIAEGAGQDLLSESLQSMNQQDAS-GNKXLKDVGLWISERIKSHFGRQQKLAINL  178

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGF CG VNGRH+YIPFN ITE+
Sbjct  179  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFICGPVNGRHSYIPFNHITEK  238

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFL PK+V +++E+E    Q+L   N K
Sbjct  239  QNKVVITDRMWARLLSSTNQPSFLNPKDVTEIQEDEDPPTQMLDGENCK  287



>gb|KJB54321.1| hypothetical protein B456_009G029100 [Gossypium raimondii]
Length=574

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S   +  + GNKLLQDVG+W+SQ+IKDY SKQRK PI L
Sbjct  398  GHMVIVIAEGAGQELLSESIQSMTLKDAS-GNKLLQDVGLWISQRIKDYFSKQRKMPINL  456

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E+
Sbjct  457  KYIDPTYMIRAIPSNASDNVYCTLLAQSVVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEK  516

Query  358  QNKVVITDRMWARLLSSTNQPSFLC  432
            +N VVITDRMWARLLSSTNQPSFLC
Sbjct  517  RNGVVITDRMWARLLSSTNQPSFLC  541



>ref|XP_003630682.1| 6-phosphofructokinase [Medicago truncatula]
Length=356

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQEL+     S   + DASGNKLLQDVG+W+S K+KDY +KQ+   ITL
Sbjct  192  GHMVIVIAEGAGQELVTESIQSMHKQQDASGNKLLQDVGLWISHKLKDYFAKQKTMGITL  251

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLV+GR  YIPFNRI E 
Sbjct  252  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVHGRQAYIPFNRINEG  311

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  312  QNTVVITDRMWARLLSSTNQPSFL  335



>gb|KDP33769.1| hypothetical protein JCGZ_07340 [Jatropha curcas]
Length=558

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL     S++ ++   GNKLLQDVG+W+SQKIKD+ +K+RK  I L
Sbjct  372  GHMVIVIAEGAGQELLTETMQSTQQDAS--GNKLLQDVGLWISQKIKDFFAKKRKMTINL  429

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF+RITE+
Sbjct  430  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFHRITEK  489

Query  358  QNKVVITDRMWARLLSSTNQPSFLC  432
            QNKVVITDRMWARLLSSTNQPSF C
Sbjct  490  QNKVVITDRMWARLLSSTNQPSFWC  514



>ref|XP_009350260.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=126

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  267
            GNKLL+DVG+W+SQ+IK  + +Q+K  I LKYIDPTYMIRAI SNA+DNVYCTLLAQS V
Sbjct  8    GNKLLKDVGLWISQRIKSHFGRQQKLAIHLKYIDPTYMIRAITSNAADNVYCTLLAQSAV  67

Query  268  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  435
            HGAMAG+TGFTCG VNGRH+YIPFNRITE+QNKVVITDRMWA LLSSTNQPSFL P
Sbjct  68   HGAMAGYTGFTCGPVNGRHSYIPFNRITEKQNKVVITDRMWAGLLSSTNQPSFLNP  123



>ref|XP_007152950.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
 gb|ESW24944.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
Length=531

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKLLQDVG+W+SQKIKD +++Q+  PITL
Sbjct  351  GHMVIVIAEGAGQELVSESVQSMSTQDAS-GNKLLQDVGLWISQKIKDHFAEQKTLPITL  409

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITER
Sbjct  410  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITER  469

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  470  QNHVVITDRMWARLLSSTNQPSFL  493



>gb|KJB65623.1| hypothetical protein B456_010G103900 [Gossypium raimondii]
Length=490

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+L++    S   +  + GNKLLQDVG+W+S  IKD+  ++K PI LK
Sbjct  311  GHMVIVIAEGAGQDLVSESLQSMDQQDAS-GNKLLQDVGLWISHGIKDHFAKKKMPINLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPFNRITE+Q
Sbjct  370  YIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            NKVVITDRMWARLLSSTNQPSFL PK++ + KEE++    LL   N K   S T
Sbjct  430  NKVVITDRMWARLLSSTNQPSFLNPKDIAEAKEEKQPATGLLDGENCKDKKSNT  483



>gb|KJB65060.1| hypothetical protein B456_010G079100 [Gossypium raimondii]
Length=555

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMV+VIAEGAGQELL+    S   +  + GN+LLQDV +W+SQ+IKD +SK+RK  I L
Sbjct  386  GHMVLVIAEGAGQELLSESLQSMTQKDAS-GNRLLQDVALWISQRIKDHFSKERKMTINL  444

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  445  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITET  504

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFLCPKE+ + +  E+   +LL   NGK
Sbjct  505  QNKVVITDRMWARLLSSTNQPSFLCPKEILEDQGHEESSNELL--DNGK  551



>ref|XP_002514189.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF48143.1| phosphofructokinase, putative [Ricinus communis]
Length=632

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 128/145 (88%), Gaps = 5/145 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+ +S+   A     GNKLLQDVG+++SQ+IKD+ SKQ+K PI L
Sbjct  370  GHMVIVIAEGAGQELLSQQSTLQDAS----GNKLLQDVGLYISQRIKDFFSKQKKMPINL  425

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  426  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITES  485

Query  358  QNKVVITDRMWARLLSSTNQPSFLC  432
            QNKVVITDRMWARLLSSTNQPSFLC
Sbjct  486  QNKVVITDRMWARLLSSTNQPSFLC  510



>gb|KJB65059.1| hypothetical protein B456_010G079100 [Gossypium raimondii]
Length=555

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMV+VIAEGAGQELL+    S   +  + GN+LLQDV +W+SQ+IKD +SK+RK  I L
Sbjct  386  GHMVLVIAEGAGQELLSESLQSMTQKDAS-GNRLLQDVALWISQRIKDHFSKERKMTINL  444

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  445  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITET  504

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFLCPKE+ + +  E+   +LL   NGK
Sbjct  505  QNKVVITDRMWARLLSSTNQPSFLCPKEILEDQGHEESSNELL--DNGK  551



>ref|XP_004245136.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Solanum lycopersicum]
Length=500

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLAAE+S++ ++ DASGNKLLQDVG+W+S KI+D + K+ K PITL
Sbjct  311  GHMVIVIAEGAGQELLAAENSNAGSQQDASGNKLLQDVGLWVSHKIRDHFGKKLKMPITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAMAG+TGFT G+VNGR TY+PFNRITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAMAGYTGFTSGIVNGRQTYLPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            QN VVITDRMWARLL+STNQPSFL   ++ +V + +  + QLL     ++  + T
Sbjct  431  QNNVVITDRMWARLLASTNQPSFLSTNDIVQVHKRQHSQSQLLNGDENESEITGT  485



>emb|CBI27972.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQELL+     +  +  + GNKLLQDVG+W+SQKI+D +S  ++  ITL
Sbjct  311  GHMVIVMAEGAGQELLSESMRYADKQDAS-GNKLLQDVGLWISQKIRDHFSTSKRMGITL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF RI ER
Sbjct  370  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFYRIIER  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFL P+++ + K+EE  + QLL   +G+
Sbjct  430  QNKVVITDRMWARLLSSTNQPSFLSPEDIIEDKKEEAPQSQLLNGESGR  478



>gb|KEH36099.1| 6-phosphofructokinase [Medicago truncatula]
Length=519

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL         +  + GNKLLQDVG+W+S KIKD ++K+ K  I L
Sbjct  312  GHMVIVIAEGAGQDLLTESMQDMDQKDAS-GNKLLQDVGLWISHKIKDHFAKENKMAIVL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASD+VYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIPFNRITE+
Sbjct  371  KYIDPTYMIRAIPSNASDSVYCTLLAQSAVHGAMAGYTGFTAGLVNGRHTYIPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
             N VVITDRMWAR+LSSTNQPSFL PK+V ++ +  +   QLL  +N
Sbjct  431  MNNVVITDRMWARMLSSTNQPSFLKPKDVHQIMKAGQSPTQLLEGSN  477



>ref|XP_010050463.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
Length=302

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFPITL  177
            GHMVIVIAEGAGQEL++  + S     DASGNKL QDVG+W+SQKIKD+  QR K  ITL
Sbjct  121  GHMVIVIAEGAGQELMSQSNQSLDNGKDASGNKLFQDVGLWISQKIKDHFSQRGKMGITL  180

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPS ASDNVYCTLLAQS VHG MAG+TGFT GLVNGR TYIPF RITE+
Sbjct  181  KYIDPTYMIRAIPSIASDNVYCTLLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYRITEK  240

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN VVITDRMWARLLSSTNQPSF  P
Sbjct  241  QNNVVITDRMWARLLSSTNQPSFWSP  266



>ref|XP_003526507.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN18140.1| 6-phosphofructokinase 3 [Glycine soja]
Length=507

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL     +   +  + GNKLLQDVG+W+S KIKD ++++ K PI L
Sbjct  312  GHMVIVIAEGAGQDLLTESMQAMDQKDAS-GNKLLQDVGLWISHKIKDHFARKDKMPINL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI ER
Sbjct  371  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFIRINER  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  431  QNKVVITDRMWARLLSSTNQPSFLSP  456



>gb|EPS62819.1| hypothetical protein M569_11969, partial [Genlisea aurea]
Length=419

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 103/116 (89%), Gaps = 1/116 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  267
            GNKLLQDVGMWLS KIK+ ++K  KFPITLKYIDPTYMIRAIPSNA+DNVYCTLLAQS V
Sbjct  273  GNKLLQDVGMWLSHKIKEHFTKLNKFPITLKYIDPTYMIRAIPSNAADNVYCTLLAQSAV  332

Query  268  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  435
            HG MAGFTGF  GLVNGRH YIPFNRI E+Q  VVITDRMWARLLSSTNQPSFL P
Sbjct  333  HGTMAGFTGFVSGLVNGRHAYIPFNRIIEKQKNVVITDRMWARLLSSTNQPSFLEP  388



>ref|XP_006355296.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=493

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLAAE+S++ +E DASGNKLLQDVG+W+S KI+D + K+ K PITL
Sbjct  311  GHMVIVIAEGAGQELLAAENSNAGSEQDASGNKLLQDVGLWISHKIRDHFEKKLKMPITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAMAG+TGFT G+VNGR TY+PFNRITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAMAGYTGFTSGIVNGRQTYLPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLL+STNQPSFL
Sbjct  431  QNNVVITDRMWARLLASTNQPSFL  454



>ref|XP_006285534.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
 gb|EOA18432.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
Length=489

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+ ++    S   +  + GNKLL+DVG+WLSQ IKD+ KQ+K  + LK
Sbjct  311  GHMVIVIAEGAGQDQMSKSMESMTLKDAS-GNKLLKDVGLWLSQSIKDHFKQKKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFLCP
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLCP  454



>ref|XP_006583562.1| PREDICTED: 6-phosphofructokinase 3-like isoform X2 [Glycine max]
Length=434

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKL QDVG+W+SQKI+D ++ Q+  PITL
Sbjct  249  GHMVIVIAEGAGQELVSESVQSMSKQDAS-GNKLFQDVGLWISQKIRDHFAAQKTLPITL  307

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITER
Sbjct  308  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITER  367

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  368  QNHVVITDRMWARLLSSTNQPSFL  391



>ref|XP_011458966.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL     S   +  + GNKLL+DVG+W+SQ+IKD ++ Q K  + L
Sbjct  311  GHMVIVIAEGAGQDLLEESLQSMNQQDAS-GNKLLKDVGLWISQRIKDHFAHQHKLSVNL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAGFTGF  G VNGRH+YIPFN ITER
Sbjct  370  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGFTGFVVGPVNGRHSYIPFNHITER  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFL PK+V++V +EE+   QLL   N K
Sbjct  430  QNKVVITDRMWARLLSSTNQPSFLNPKDVDEVLKEEEPVTQLLEGDNCK  478



>ref|XP_011091507.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Sesamum 
indicum]
Length=464

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 126/146 (86%), Gaps = 6/146 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA ++    +     GNKLLQDVG+W+SQKIK+ ++K+ K PITL
Sbjct  311  GHMVIVIAEGAGQELLAEKNEQDAS-----GNKLLQDVGLWISQKIKEHFAKRAKPPITL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGFT GLVNG  TYIPFNRITE 
Sbjct  366  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFTSGLVNGSQTYIPFNRITES  425

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVV TDRMWARLLSSTNQPSFL P
Sbjct  426  QNKVVTTDRMWARLLSSTNQPSFLGP  451



>ref|XP_002283274.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Vitis 
vinifera]
Length=539

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQELL+     +  +  + GNKLLQDVG+W+SQKI+D +S  ++  ITL
Sbjct  359  GHMVIVMAEGAGQELLSESMRYADKQDAS-GNKLLQDVGLWISQKIRDHFSTSKRMGITL  417

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF RI ER
Sbjct  418  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFYRIIER  477

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFL P+++ + K+EE  + QLL   +G+
Sbjct  478  QNKVVITDRMWARLLSSTNQPSFLSPEDIIEDKKEEAPQSQLLNGESGR  526



>gb|ACO35360.1| phosphofructokinase [Elaeis oleifera]
Length=196

 Score =   201 bits (510),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKDY--SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQST  264
            GNKLL DVG+WL QKIKD+  S+++K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S 
Sbjct  38   GNKLLLDVGLWLFQKIKDHFASRKKKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAHSV  97

Query  265  VHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkev  444
            +HGAMAG+TGFT G VNGRH YIPF+RITE QNKVVITDRMWARLLSSTNQPSFL  K+V
Sbjct  98   IHGAMAGYTGFTVGPVNGRHAYIPFHRITETQNKVVITDRMWARLLSSTNQPSFLSHKDV  157

Query  445  ekvkeeeklkeQLLGAANGK  504
            E  ++EE    QLL   N K
Sbjct  158  EDARKEEAPPTQLLDGENCK  177



>ref|XP_010690141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Beta vulgaris 
subsp. vulgaris]
Length=468

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ LL+        +  + GNKLLQDVG+W+SQKIKDY KQ+++ I LK
Sbjct  316  GHMVIVIAEGAGQNLLSECMRKVHEKDAS-GNKLLQDVGLWISQKIKDYFKQQEWVINLK  374

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIP+NASDNVYCTLLA S +HGAMAG+TGFT G VN RH YIPF RITERQ
Sbjct  375  YIDPTYMIRAIPANASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNSRHAYIPFQRITERQ  434

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            NKVVITDRMWARLLSSTNQPSFL P
Sbjct  435  NKVVITDRMWARLLSSTNQPSFLDP  459



>ref|XP_010545328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=490

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 135/178 (76%), Gaps = 4/178 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQEL+   S+   A     GNKLL+DVG+W+SQ IKD+  ++K  I LK
Sbjct  311  GHMVIVIAEGAGQELMMESSNLEDAS----GNKLLKDVGLWISQSIKDHFSRKKTTINLK  366

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+P NASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE+Q
Sbjct  367  YIDPTYMIRAVPGNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQ  426

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKTPALK  534
            NKVVITDRMWARLLSSTNQPSFL PK+V    +      QLL  ++    A   P ++
Sbjct  427  NKVVITDRMWARLLSSTNQPSFLSPKDVSDDVKSSLPATQLLDDSHCNGVADDVPPVE  484



>ref|XP_010244403.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=547

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAG ELL+    +   +  + GNKLL DVG+W+SQ+IKD +S + K  I L
Sbjct  372  GHMVIVIAEGAGLELLSQSMRNMDQKDAS-GNKLLPDVGLWISQRIKDHFSSRNKMSINL  430

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIPFNR+TER
Sbjct  431  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFNRVTER  490

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            QNKVVITDRMWARLLSST QPSF+ PKE+   K+E +   QLL   N
Sbjct  491  QNKVVITDRMWARLLSSTTQPSFVRPKELISKKQEPEPPTQLLDGEN  537



>ref|XP_010049142.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW81626.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=492

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 3/144 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+L+A    S++ ++   GN+LLQDVG+W+S KI+D +++Q+K  ITL
Sbjct  313  GHMVIVIAEGAGQDLVAESLQSNQQDAS--GNRLLQDVGLWISHKIRDHFARQQKMGITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNV CTLLAQS VHGAMAGFTGFT GLVN RHTYIPFNR+TER
Sbjct  371  KYIDPTYMIRAVPSNASDNVNCTLLAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRVTER  430

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  431  QNKVVITDRMWARLLSSTNQPSFL  454



>ref|XP_009367416.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=494

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL+    S   +  + GNKLLQDVG+W+S++IK  + +Q+K  I L
Sbjct  314  GHMVIVIAEGAGQDLLSESLQSMNQQDAS-GNKLLQDVGLWISERIKSHFGRQQKLAINL  372

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGF CG VNGRH+YIPFN ITE+
Sbjct  373  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFVCGPVNGRHSYIPFNHITEK  432

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFL PK+V +++E+E    Q+L   N K
Sbjct  433  QNKVVITDRMWARLLSSTNQPSFLNPKDVTEIQEDEDPPTQMLDGENCK  481



>gb|AIU64848.1| 6-phosphofructokinase [Prunus sibirica]
Length=532

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GH+VIV+AEGAG+ LL+      + ++   GNKLLQDVG+WLSQ IKDY SKQRK  ITL
Sbjct  367  GHIVIVVAEGAGEVLLSESLLKDEQDAS--GNKLLQDVGLWLSQNIKDYFSKQRKMNITL  424

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF R+TER
Sbjct  425  KYIDPTYMIRAIPGNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFCRVTER  484

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  485  QNKVVITDRMWARLLSSTNQPSFLDP  510



>ref|XP_007223382.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
 ref|XP_008220132.1| PREDICTED: 6-phosphofructokinase 6 [Prunus mume]
 gb|EMJ24581.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
Length=500

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL+    S   +  + GNKLL+DVG+W+SQ+IK+ + +Q+K  I L
Sbjct  320  GHMVIVIAEGAGQDLLSESLQSMNQQDAS-GNKLLKDVGLWISQRIKNHFGRQQKISINL  378

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGF CG VNGRH+YIPFN ITE+
Sbjct  379  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFICGPVNGRHSYIPFNHITEK  438

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQPSFL PK+V +V+E E+   QLL   N K
Sbjct  439  QNKVVITDRMWARLLSSTNQPSFLNPKDVIEVQEGEEPPTQLLEGENCK  487



>ref|XP_010049141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW81625.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=510

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 3/144 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+L+A    S++ ++   GN+LLQDVG+W+S KI+D +++Q+K  ITL
Sbjct  313  GHMVIVIAEGAGQDLVAESLQSNQQDAS--GNRLLQDVGLWISHKIRDHFARQQKMGITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNV CTLLAQS VHGAMAGFTGFT GLVN RHTYIPFNR+TER
Sbjct  371  KYIDPTYMIRAVPSNASDNVNCTLLAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRVTER  430

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  431  QNKVVITDRMWARLLSSTNQPSFL  454



>ref|XP_009125389.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Brassica rapa]
Length=463

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQRK  ITL
Sbjct  313  GHMVIVVAEGAGQDLVAESIEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQRKMDITL  368

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITE+
Sbjct  369  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRITEK  428

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  429  QNKVVITDRMWARMLSSTNQPSFMNP  454



>emb|CDX68896.1| BnaC01g05570D [Brassica napus]
Length=463

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQRK  ITL
Sbjct  313  GHMVIVVAEGAGQDLVAESIEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQRKMDITL  368

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITE+
Sbjct  369  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRITEK  428

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  429  QNKVVITDRMWARMLSSTNQPSFMNP  454



>emb|CDX75291.1| BnaA01g04110D [Brassica napus]
Length=463

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQRK  ITL
Sbjct  313  GHMVIVVAEGAGQDLVAESIEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQRKMDITL  368

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITE+
Sbjct  369  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRITEK  428

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  429  QNKVVITDRMWARMLSSTNQPSFMNP  454



>gb|KHN16662.1| 6-phosphofructokinase 3 [Glycine soja]
Length=473

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKLLQDVG+W+SQKIKDY +KQ++  I L
Sbjct  311  GHMVIVIAEGAGQELVSESIQSLNKQDAS-GNKLLQDVGLWISQKIKDYFNKQKRMTINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  370  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEG  429

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
            QNKV+ITDRMWARLLSSTNQPSF
Sbjct  430  QNKVIITDRMWARLLSSTNQPSF  452



>ref|XP_003532467.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=473

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKLLQDVG+W+SQKIKDY +KQ++  I L
Sbjct  311  GHMVIVIAEGAGQELVSESIQSLNKQDAS-GNKLLQDVGLWISQKIKDYFNKQKRMTINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  370  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEG  429

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
            QNKV+ITDRMWARLLSSTNQPSF
Sbjct  430  QNKVIITDRMWARLLSSTNQPSF  452



>ref|XP_003516323.2| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=526

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKL QDVG+W+SQKI+D ++ Q+  PITL
Sbjct  341  GHMVIVIAEGAGQELVSESVQSMSKQDAS-GNKLFQDVGLWISQKIRDHFAAQKTLPITL  399

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITER
Sbjct  400  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITER  459

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  460  QNHVVITDRMWARLLSSTNQPSFL  483



>gb|KHN03217.1| 6-phosphofructokinase 3 [Glycine soja]
Length=525

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKL QDVG+W+SQKI+D ++ Q+  PITL
Sbjct  340  GHMVIVIAEGAGQELVSESVQSMSKQDAS-GNKLFQDVGLWISQKIRDHFAAQKTLPITL  398

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITER
Sbjct  399  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITER  458

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  459  QNHVVITDRMWARLLSSTNQPSFL  482



>ref|XP_007203634.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
 gb|EMJ04833.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
Length=536

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 125/145 (86%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S   +  + GNKLLQDVG+W+SQKIKD +SK+ K  I L
Sbjct  357  GHMVIVIAEGAGQELLSESMRSMAKQDAS-GNKLLQDVGLWISQKIKDHFSKRNKMTINL  415

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF+ I E+
Sbjct  416  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHSIIEQ  475

Query  358  QNKVVITDRMWARLLSSTNQPSFLC  432
            QNKVVITDRMWARLLSSTNQPSFLC
Sbjct  476  QNKVVITDRMWARLLSSTNQPSFLC  500



>ref|XP_003529065.1| PREDICTED: 6-phosphofructokinase 3-like isoform X1 [Glycine max]
Length=536

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKL QDVG+W+SQKI+D ++ Q+  PITL
Sbjct  351  GHMVIVIAEGAGQELVSESVQSMSKQDAS-GNKLFQDVGLWISQKIRDHFAAQKTLPITL  409

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITER
Sbjct  410  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITER  469

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  470  QNHVVITDRMWARLLSSTNQPSFL  493



>ref|XP_003630681.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AET05157.1| 6-phosphofructokinase [Medicago truncatula]
Length=475

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQEL+     S   + DASGNKLLQDVG+W+S K+KDY +KQ+   ITL
Sbjct  311  GHMVIVIAEGAGQELVTESIQSMHKQQDASGNKLLQDVGLWISHKLKDYFAKQKTMGITL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLV+GR  YIPFNRI E 
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVHGRQAYIPFNRINEG  430

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  431  QNTVVITDRMWARLLSSTNQPSFL  454



>ref|XP_008242459.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=487

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S   +  + GNKLLQDVG+W+SQKIKD +SK+ K  I L
Sbjct  308  GHMVIVIAEGAGQELLSEIMHSMAKQDAS-GNKLLQDVGLWISQKIKDHFSKRHKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF+RI E+
Sbjct  367  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQ  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  427  QNKVVITDRMWARLLSSTNQPSFL  450



>emb|CDY32769.1| BnaA10g10800D [Brassica napus]
Length=369

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQEL++    S+   S   GNKLL+DVG+WLSQ IKDY K+    + LK
Sbjct  192  GHMVIVLAEGAGQELMSKSMESNTDAS---GNKLLKDVGLWLSQSIKDYFKKINMVMNLK  248

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  249  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  308

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  309  NNVVITDRMWARLLSSTNQPSFLGP  333



>ref|XP_003620763.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AES76981.1| 6-phosphofructokinase [Medicago truncatula]
Length=505

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL     S K +  + GNKLLQDVG+W+SQ IKD +++++  PITL
Sbjct  308  GHMVIVIAEGAGQELLTESLQSGKKQDAS-GNKLLQDVGLWISQSIKDHFAREKTLPITL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITER
Sbjct  367  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITER  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSF+
Sbjct  427  QNNVVITDRMWARLLSSTNQPSFM  450



>ref|XP_004503509.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=479

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQEL++    + + +  + GNKLLQDVG+W+SQK+KDY + Q+   ITL
Sbjct  311  GHMVIVIAEGAGQELVSESIQAMQKQDAS-GNKLLQDVGLWISQKLKDYFANQKTMGITL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLV+GR TYIPFNRITE 
Sbjct  370  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVHGRQTYIPFNRITEG  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  430  QNTVVITDRMWARLLSSTNQPSFL  453



>ref|XP_010536840.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Tarenaya hassleriana]
Length=474

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 121/145 (83%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQEL+   ++   A     GNKLL+DVG+WL Q IKD+   +K  I LK
Sbjct  311  GHMVIVIAEGAGQELMLESTTLKDAS----GNKLLKDVGLWLFQSIKDHFSAKKATINLK  366

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE+Q
Sbjct  367  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQ  426

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            NKVVITDRMWARLLSSTNQPSFL P
Sbjct  427  NKVVITDRMWARLLSSTNQPSFLSP  451



>ref|XP_009613574.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009613575.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=491

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++     +  +  + GNKLLQDVG+W+S++IK+ +SKQ+K  I L
Sbjct  314  GHMVIVIAEGAGQELVSESLRCTGKQDPS-GNKLLQDVGLWISERIKEHFSKQKKMLINL  372

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPFNRITE 
Sbjct  373  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITET  432

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  433  QNKVVITDRMWARLLSSTNQPSFL  456



>ref|XP_006412426.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
 gb|ESQ53879.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
Length=462

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 123/146 (84%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA       A     GNKLL+DVG+W+S KIK+Y +KQ K  ITL
Sbjct  312  GHMVIVIAEGAGQDLLAESIEQQDAS----GNKLLKDVGLWMSIKIKEYFAKQSKMDITL  367

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRITER
Sbjct  368  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITER  427

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  428  QNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_006451355.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64595.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=463

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S+  +  + GNKLLQDVG+WLSQKIKD ++K++K PI L
Sbjct  273  GHMVIVIAEGAGQDLLAESIRSATQQDAS-GNKLLQDVGLWLSQKIKDHFAKEKKMPINL  331

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI E+
Sbjct  332  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEK  391

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+ VVITDRMWARLLSSTNQPSF+
Sbjct  392  QHHVVITDRMWARLLSSTNQPSFM  415



>gb|AHB32113.1| 6-phosphofructokinase 3-like protein [Camellia sinensis]
 gb|AHE93342.1| phosphofructokinase [Camellia sinensis]
Length=495

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQE L+      +    + GN+ LQDVG+W+S +IK+ ++K+ K  +TL
Sbjct  311  GHMVIVIAEGAGQEFLSGSLQPGEERDPS-GNRQLQDVGLWISNRIKEHFAKRNKMVLTL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPFNRITER
Sbjct  370  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFNRITER  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKTPALK*  537
            QNKVVITDRMWARLLSSTNQPSFL PKE+ +  +EE+    LL   N +   S  P  + 
Sbjct  430  QNKVVITDRMWARLLSSTNQPSFLGPKEMAEAIKEEEPPTSLLDGENCQDAHSGKPPDEI  489

Query  538  SH  543
             H
Sbjct  490  EH  491



>gb|AIE47276.1| phosphofructokinase [Hevea brasiliensis]
Length=563

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S++ ++   GNKLLQDVG+W+SQ+IKDY SKQ+K  I L
Sbjct  377  GHMVIVIAEGAGQELLSQTIQSTQQDAS--GNKLLQDVGLWISQRIKDYFSKQKKMTINL  434

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS +HGAMAG+TGFT GLVNGR TYIPF RI E+
Sbjct  435  KYIDPTYMIRAIPSNASDNVYCTLLAQSVLHGAMAGYTGFTSGLVNGRQTYIPFYRIIEK  494

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
            QNKVVITDRMWARLLSSTNQPSF
Sbjct  495  QNKVVITDRMWARLLSSTNQPSF  517



>ref|NP_194651.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
 sp|Q9M0F9.1|PFKA1_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 1; Short=ATP-PFK 
1; Short=Phosphofructokinase 1; AltName: Full=Phosphohexokinase 
1 [Arabidopsis thaliana]
 emb|CAB79680.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
 gb|AAU90083.1| At4g29220 [Arabidopsis thaliana]
 gb|AEE85604.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
Length=473

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LL+     S    DASGNKLLQD+G+W+SQ+IKD+   +K  +TLK
Sbjct  312  GHMVIVIAEGAGQDLLSESMKESTTLKDASGNKLLQDIGLWISQRIKDHFA-KKMTLTLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPFNRITE+Q
Sbjct  371  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFNRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  431  NKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_010539385.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=487

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 121/143 (85%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQEL+    +   A     GNKLL+DVG+WLSQ IKD+  ++K  I LK
Sbjct  311  GHMVIVIAEGAGQELMLESMTLKDAS----GNKLLKDVGLWLSQSIKDHFSKKKTVINLK  366

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIPF RITE+Q
Sbjct  367  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHTYIPFYRITEKQ  426

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDR WARLLSSTNQPSFL
Sbjct  427  NKVVITDRTWARLLSSTNQPSFL  449



>gb|AIE47274.1| phosphofructokinase [Hevea brasiliensis]
Length=545

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    +   +  + GNKLLQDVG+W+SQKIKD ++ + K  ITL
Sbjct  367  GHMVIVIAEGAGQELLSESMRAMDQQDAS-GNKLLQDVGLWISQKIKDNFANREKMNITL  425

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+TER
Sbjct  426  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTER  485

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSF+ P
Sbjct  486  QNKVVITDRMWARLLSSTNQPSFVDP  511



>ref|XP_009613573.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Nicotiana tomentosiformis]
Length=516

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++     +  +  + GNKLLQDVG+W+S++IK+ +SKQ+K  I L
Sbjct  339  GHMVIVIAEGAGQELVSESLRCTGKQDPS-GNKLLQDVGLWISERIKEHFSKQKKMLINL  397

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPFNRITE 
Sbjct  398  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITET  457

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  458  QNKVVITDRMWARLLSSTNQPSFL  481



>gb|KFK29896.1| hypothetical protein AALP_AA7G192500 [Arabis alpina]
Length=460

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 124/146 (85%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+L+A       A     GNKLL+DVG+W+S KI++ ++KQRK  ITL
Sbjct  310  GHMVIVIAEGAGQDLVAESIEQQDAS----GNKLLKDVGLWMSLKIREHFAKQRKMEITL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRITE+
Sbjct  366  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITEK  425

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  426  QNKVVITDRMWARMLSSTNQPSFMNP  451



>ref|XP_002516495.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF45836.1| phosphofructokinase, putative [Ricinus communis]
Length=485

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+L++    S   +  + GNKLLQDVG+W+SQ+IKD ++++ +  ITL
Sbjct  315  GHMVIVIAEGAGQDLVSKSLQSMNQQDAS-GNKLLQDVGLWISQRIKDHFAREHRMNITL  373

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPFNRITE+
Sbjct  374  KYIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITEK  433

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN VVITDRMWARLLSST+QPSF+ P
Sbjct  434  QNNVVITDRMWARLLSSTDQPSFMSP  459



>gb|AIE47270.1| phosphofructokinase [Hevea brasiliensis]
Length=475

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL+    S   +  + GNKLLQDVG+W+S +IKD ++K+ K  ITL
Sbjct  311  GHMVIVIAEGAGQDLLSKSLQSMDQQDAS-GNKLLQDVGLWISHRIKDHFAKENKMNITL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPFNR+TE+
Sbjct  370  KYIDPTYMIRAIPANASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFNRVTEK  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSST+QPSF+ P
Sbjct  430  QNKVVITDRMWARLLSSTDQPSFMSP  455



>ref|XP_011078226.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=488

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S+  +  + GNKLLQDVG+W+SQ+IKD +SKQRK  I L
Sbjct  311  GHMVIVIAEGAGQELLSDSLRSTNQQDAS-GNKLLQDVGLWISQRIKDHFSKQRKMTINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPF RI E 
Sbjct  370  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFYRINES  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            +NKVVITDRMWARLLSSTNQPSFL
Sbjct  430  RNKVVITDRMWARLLSSTNQPSFL  453



>gb|KDP34145.1| hypothetical protein JCGZ_07716 [Jatropha curcas]
Length=478

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK-DYSKQRKFPITL  177
            GHMVIVIAEGAGQ+L++    S   +  + GN+LLQDVG+W+SQ+IK  ++K+ K  ITL
Sbjct  311  GHMVIVIAEGAGQDLVSESLQSLDQQDAS-GNRLLQDVGLWISQRIKAHFAKENKMNITL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNV+CTLLA S VHGAMAGFTGFT G VNGRH+YIPFNRITE+
Sbjct  370  KYIDPTYMIRAIPSNASDNVFCTLLAHSAVHGAMAGFTGFTVGSVNGRHSYIPFNRITEK  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSST+QPSFL P
Sbjct  430  QNKVVITDRMWARLLSSTDQPSFLRP  455



>ref|XP_006413209.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
 gb|ESQ54662.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
Length=489

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMV+VIAEGAGQ+L++    S   +  + GNKLL+DVG+WLSQ IKDY  Q+K  + LK
Sbjct  311  GHMVLVIAEGAGQDLMSKSMESMTLKDAS-GNKLLKDVGLWLSQSIKDYFNQKKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLSP  454



>gb|KDO51846.1| hypothetical protein CISIN_1g009394mg [Citrus sinensis]
Length=535

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    +   +  + GNKLLQDVG+W+SQKI+D + K+RK  I L
Sbjct  365  GHMVIVIAEGAGQELLSEIMHTMDQQDAS-GNKLLQDVGLWISQKIRDHFGKKRKMTINL  423

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF RITER
Sbjct  424  KYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRITER  483

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  495
            QN+VVITDRMWARLLSSTNQPSFL PK+V++ KEE KL  QL   A
Sbjct  484  QNRVVITDRMWARLLSSTNQPSFLDPKKVKQSKEEGKLDTQLFNHA  529



>ref|XP_006465714.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=535

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    +   +  + GNKLLQDVG+W+SQKI+D + K+RK  I L
Sbjct  365  GHMVIVIAEGAGQELLSEIMHTMDQQDAS-GNKLLQDVGLWISQKIRDHFGKKRKMTINL  423

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF RITER
Sbjct  424  KYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRITER  483

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  495
            QN+VVITDRMWARLLSSTNQPSFL PK+V++ KEE KL  QL   A
Sbjct  484  QNRVVITDRMWARLLSSTNQPSFLDPKKVKQSKEEGKLDTQLFNHA  529



>ref|XP_010526423.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Tarenaya 
hassleriana]
Length=489

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQELL+    S   +  + GNKLLQD+G+W+SQ+IKD+   +K  I+LK
Sbjct  311  GHMVIVIAEGAGQELLSESIQSMTLKDAS-GNKLLQDIGLWISQRIKDHFA-KKMTISLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIPF+RITE+Q
Sbjct  369  YIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFDRITEKQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSST+QPSF+
Sbjct  429  NKVVITDRMWARLLSSTHQPSFV  451



>gb|KHM99825.1| 6-phosphofructokinase 3 [Glycine soja]
Length=471

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKLLQDVG+W+SQKIKD ++KQ+   I L
Sbjct  311  GHMVIVIAEGAGQELVSESIQSLNKQDAS-GNKLLQDVGLWISQKIKDHFTKQKTMTINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  370  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEG  429

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
            QNKV+ITDRMWARLLSSTNQPSF
Sbjct  430  QNKVIITDRMWARLLSSTNQPSF  452



>ref|XP_002867225.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43484.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 124/146 (85%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+L+A  +    A     GNKLL+DVG+W+S KIK+ ++KQ    ITL
Sbjct  311  GHMVIVIAEGAGQDLVAESTDQQDAS----GNKLLKDVGLWMSLKIKEHFAKQSVMDITL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITER
Sbjct  367  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITER  426

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  427  QNKVVITDRMWARMLSSTNQPSFMNP  452



>ref|XP_011093663.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=531

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+  +     +  + GNKLLQDVG+W+SQKIKDY SK +K  I L
Sbjct  354  GHMVIVIAEGAGQELLSESAELQNQQDAS-GNKLLQDVGLWISQKIKDYFSKGKKMAINL  412

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+T FT G VNGRH YIPF+RITER
Sbjct  413  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTSFTVGPVNGRHAYIPFHRITER  472

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLL STNQPSF 
Sbjct  473  QNKVVITDRMWARLLLSTNQPSFF  496



>ref|XP_003524412.1| PREDICTED: 6-phosphofructokinase 7-like [Glycine max]
Length=471

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKLLQDVG+W+SQKIKD ++KQ+   I L
Sbjct  311  GHMVIVIAEGAGQELVSESIQSLHKQDAS-GNKLLQDVGLWISQKIKDHFTKQKTMTINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE 
Sbjct  370  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEG  429

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
            QNKV+ITDRMWARLLSSTNQPSF
Sbjct  430  QNKVIITDRMWARLLSSTNQPSF  452



>ref|XP_004302844.2| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Fragaria 
vesca subsp. vesca]
Length=528

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA    +   +  + GNKLLQD G+WLSQKIKD +SK  K  I L
Sbjct  352  GHMVIVIAEGAGQELLAESMLAMNHQDAS-GNKLLQDSGLWLSQKIKDHFSKLNKMSINL  410

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF+R+TER
Sbjct  411  KYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGSVNGRHAYIPFHRVTER  470

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  471  QNKVVITDRMWARLLSSTNQPSFL  494



>ref|XP_007215486.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
 gb|EMJ16685.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
Length=560

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GH+VIVIAEGAG  LL+      + ++   GNKLLQDVG+WLSQ IKD +SK+RK  ITL
Sbjct  371  GHIVIVIAEGAGDVLLSESLPKDEQDAS--GNKLLQDVGLWLSQNIKDHFSKRRKMNITL  428

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF R+TER
Sbjct  429  KYIDPTYMIRAIPGNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFCRVTER  488

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  489  QNKVVITDRMWARLLSSTNQPSFLDP  514



>gb|EYU30678.1| hypothetical protein MIMGU_mgv1a005513mg [Erythranthe guttata]
Length=481

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQE+L+   +   A     GNKLLQDVG+W+SQKIKD +SK+RK  I L
Sbjct  311  GHMVIVIAEGAGQEMLSESLNQKDAS----GNKLLQDVGLWISQKIKDHFSKERKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPS+ASDNVYCTLLAQS VHGAMAG+TGFT G VNGR+ YIPF+RI ER
Sbjct  367  KYIDPTYMIRAIPSSASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRYAYIPFHRINER  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSST+QPSFL
Sbjct  427  QNKVVITDRMWARLLSSTSQPSFL  450



>ref|XP_006401301.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
 gb|ESQ42754.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
Length=490

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 2/178 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L++    S+  +  + GNKLL+DVG+WLSQ IKDY K+ K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMSKSMESNTLKDAS-GNKLLKDVGLWLSQSIKDYFKKIKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKTPALK  534
            N VVITDRMWARLLSSTNQPSFL PK+V + K+E      L G ANG       P  K
Sbjct  430  NNVVITDRMWARLLSSTNQPSFLGPKDVSEEKQEMAETPHLDG-ANGDGAIDIPPVTK  486



>gb|KDP40841.1| hypothetical protein JCGZ_24840 [Jatropha curcas]
Length=542

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    +   +  + GNKLLQDVG+W+SQKIKD ++KQ+   ITL
Sbjct  368  GHMVIVIAEGAGQELLSESIRAMDHQDAS-GNKLLQDVGLWISQKIKDHFAKQKNMNITL  426

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNV CTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+TER
Sbjct  427  KYIDPTYMIRAVPSNASDNVCCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTER  486

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  487  QNKVVITDRMWARLLSSTNQPSFLDP  512



>gb|AAM65566.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
Length=462

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+Y +K     ITL
Sbjct  312  GHMVIVIAEGAGQDLVAESIEQQDAS----GNKLLKDVGLWMSLKIKEYFAKHNVMDITL  367

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITER
Sbjct  368  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITER  427

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  428  QNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_006451353.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64593.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=512

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S+  +  + GNKLLQDVG+WLSQKIKD ++K++K PI L
Sbjct  322  GHMVIVIAEGAGQDLLAESIRSATQQDAS-GNKLLQDVGLWLSQKIKDHFAKEKKMPINL  380

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI E+
Sbjct  381  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEK  440

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+ VVITDRMWARLLSSTNQPSF+
Sbjct  441  QHHVVITDRMWARLLSSTNQPSFM  464



>ref|XP_006426847.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
 gb|ESR40087.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
Length=576

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    +   +  + GNKLLQDVG+W+SQKI+D + K+RK  I L
Sbjct  365  GHMVIVIAEGAGQELLSEIMHTMDQQDAS-GNKLLQDVGLWISQKIRDHFGKKRKMTINL  423

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF RITER
Sbjct  424  KYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRITER  483

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN+VVITDRMWARLLSSTNQPSFL P
Sbjct  484  QNRVVITDRMWARLLSSTNQPSFLDP  509



>ref|NP_195010.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
 sp|Q9M076.1|PFKA6_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 6; Short=ATP-PFK 
6; Short=Phosphofructokinase 6; AltName: Full=Phosphohexokinase 
6 [Arabidopsis thaliana]
 emb|CAB80001.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AAO64936.1| At4g32840 [Arabidopsis thaliana]
 dbj|BAE99473.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AEE86125.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
Length=462

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+Y +K     ITL
Sbjct  312  GHMVIVIAEGAGQDLVAESIEQQDAS----GNKLLKDVGLWMSLKIKEYFAKHNVMDITL  367

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITER
Sbjct  368  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITER  427

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  428  QNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_004135681.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 ref|XP_004158426.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 gb|KGN66195.1| hypothetical protein Csa_1G575110 [Cucumis sativus]
Length=492

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S K ++   GNKLLQD+G+WLSQ+IKD +SK+ K  I L
Sbjct  315  GHMVIVIAEGAGQELLSGSCGSDKQDAS--GNKLLQDIGLWLSQRIKDHFSKEHKMTINL  372

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI ++
Sbjct  373  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRIVDK  432

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  433  QNKVVITDRMWARLLSSTNQPSFL  456



>ref|XP_006451354.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64594.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=561

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S+  +  + GNKLLQDVG+WLSQKIKD ++K++K PI L
Sbjct  371  GHMVIVIAEGAGQDLLAESIRSATQQDAS-GNKLLQDVGLWLSQKIKDHFAKEKKMPINL  429

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI E+
Sbjct  430  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEK  489

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+ VVITDRMWARLLSSTNQPSF+
Sbjct  490  QHHVVITDRMWARLLSSTNQPSFM  513



>gb|AAM91591.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=473

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LL+     S    DASGNKLLQD+G+W+SQ+IKD+   +K  +TLK
Sbjct  312  GHMVIVIAEGAGQDLLSESMKESTTLKDASGNKLLQDIGLWISQRIKDHFA-KKMTLTLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG +AG+ GFT GLVNGRHTYIPFNRITE+Q
Sbjct  371  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVVAGYNGFTVGLVNGRHTYIPFNRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  431  NKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_006475360.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=561

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S+  +  + GNKLLQDVG+WLSQKIKD ++K++K PI L
Sbjct  371  GHMVIVIAEGAGQDLLAESIRSATQQDAS-GNKLLQDVGLWLSQKIKDHFAKEKKMPINL  429

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI E+
Sbjct  430  KYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEK  489

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+ VVITDRMWARLLSSTNQPSF+
Sbjct  490  QHHVVITDRMWARLLSSTNQPSFM  513



>gb|KCW79599.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=487

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFPITL  177
            GHMVIVIAEGAGQEL++  + S     DASGNKL QDVG+W+SQKIKD+  QR K  ITL
Sbjct  306  GHMVIVIAEGAGQELMSQSNQSLDNGKDASGNKLFQDVGLWISQKIKDHFSQRGKMGITL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPS ASDNVYCTLLAQS VHG MAG+TGFT GLVNGR TYIPF RITE+
Sbjct  366  KYIDPTYMIRAIPSIASDNVYCTLLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYRITEK  425

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN VVITDRMWARLLSSTNQPSF  P
Sbjct  426  QNNVVITDRMWARLLSSTNQPSFWSP  451



>ref|XP_004513074.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=488

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+  S    A     GNKLLQDVG+W+SQ IKD +++++   ITL
Sbjct  308  GHMVIVIAEGAGQELLSESSDKQDAS----GNKLLQDVGLWISQSIKDHFAREKTLAITL  363

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITER
Sbjct  364  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITER  423

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSF+
Sbjct  424  QNNVVITDRMWARLLSSTNQPSFM  447



>gb|AAB88875.1| pyrophosphate-dependent phosphofructo-1-kinase [Prunus armeniaca]
Length=282

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 135/169 (80%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL+    S   +  + GNKLL+DV   +SQKIK+ + +Q+K  I L
Sbjct  102  GHMVIVIAEGAGQDLLSESLQSMNQQDAS-GNKLLKDVAYGISQKIKNHFGRQQKISINL  160

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHG M G+TGF CG VNGRH+YIPFN ITE+
Sbjct  161  KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGPMGGYTGFICGPVNGRHSYIPFNHITEK  220

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            QNKVVITDRMWARLLSSTNQP+FL PK+V +V+E E+   QLL   N K
Sbjct  221  QNKVVITDRMWARLLSSTNQPTFLNPKDVIEVQEGEEPPTQLLEGENCK  269



>ref|XP_008354543.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=447

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPITL  177
            GHMVIV+AEGAGQELL+    S   +  + GNKLLQDVG+W+SQKIKD+ K+  K  I L
Sbjct  267  GHMVIVMAEGAGQELLSESIHSMTKQDAS-GNKLLQDVGLWISQKIKDHFKEGNKMSINL  325

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF+RI E+
Sbjct  326  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQ  385

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  386  QNKVVITDRMWARLLSSTNQPSFL  409



>ref|XP_008450803.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis melo]
Length=495

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S K ++   GNKLLQD+G+WLSQ+IKD +SK+ K  I L
Sbjct  315  GHMVIVIAEGAGQELLSGSFGSDKQDAS--GNKLLQDIGLWLSQRIKDHFSKEHKMTINL  372

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI ++
Sbjct  373  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRIIDK  432

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  433  QNKVVITDRMWARLLSSTNQPSFL  456



>ref|XP_007012201.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
 gb|EOY29820.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
Length=479

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LL+    S   +  + GNKLLQDVG+W+S +IK++  +++ PI LK
Sbjct  300  GHMVIVIAEGAGQDLLSESLQSMGQQDAS-GNKLLQDVGLWISHRIKEHFSKKRMPINLK  358

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGF  G VNGRH YIPFNRI E+Q
Sbjct  359  YIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFIVGPVNGRHAYIPFNRIIEKQ  418

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            NKVVITDRMWARLLSSTNQPSFL P+++ + K+E++    LL   N K   S T
Sbjct  419  NKVVITDRMWARLLSSTNQPSFLNPRDISEAKKEDQPATGLLDGENCKDRKSMT  472



>gb|KHN40360.1| 6-phosphofructokinase 3 [Glycine soja]
Length=561

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKL QDVG+W+SQKI+D ++ Q+  PITL
Sbjct  376  GHMVIVIAEGAGQELVSESVQSMSKQDAS-GNKLFQDVGLWISQKIRDHFAAQKTLPITL  434

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGA AG+TG+T GLVNGR TYIPF RITER
Sbjct  435  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGATAGYTGYTSGLVNGRQTYIPFYRITER  494

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSFL
Sbjct  495  QNHVVITDRMWARLLSSTNQPSFL  518



>ref|XP_008375840.1| PREDICTED: 6-phosphofructokinase 3-like isoform X3 [Malus domestica]
Length=463

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 119/143 (83%), Gaps = 5/143 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ IKDY SKQRK  I L
Sbjct  286  GHMVIVIAEGAGQELLSERMNQQDAS----GNKLLQDVGLWLSQNIKDYFSKQRKMTINL  341

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+ GF  G VNGRH YIPF+R+TER
Sbjct  342  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTER  401

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
             NKVVITDRMWARLLSSTNQPSF
Sbjct  402  LNKVVITDRMWARLLSSTNQPSF  424



>ref|XP_009763926.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009763927.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
Length=490

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGA QEL++     +  +  + GNKLLQDVG+W+S++IK+ +SKQ+K  I L
Sbjct  313  GHMVIVIAEGAAQELVSESLRCTGKQDPS-GNKLLQDVGLWISERIKEHFSKQKKMLINL  371

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPFN ITE 
Sbjct  372  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNGITET  431

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  432  QNKVVITDRMWARLLSSTNQPSFL  455



>ref|XP_010447334.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Camelina sativa]
Length=462

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQ    ITL
Sbjct  312  GHMVIVVAEGAGQDLVAESVEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQSVLDITL  367

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITE+
Sbjct  368  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEK  427

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  428  QNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_011007273.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=566

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S   +  + GNKLLQDVG+W+SQ IKDY S+Q+   I L
Sbjct  379  GHMVIVIAEGAGQELLSESMQSRNQQDAS-GNKLLQDVGLWISQGIKDYFSRQKTMAINL  437

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E+
Sbjct  438  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEK  497

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSF+
Sbjct  498  QNKVVITDRMWARLLSSTNQPSFM  521



>ref|XP_010437846.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Camelina 
sativa]
Length=462

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQ    ITL
Sbjct  312  GHMVIVVAEGAGQDLVAESVEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQSVLDITL  367

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITE+
Sbjct  368  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEK  427

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  428  QNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_010267094.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=490

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 5/177 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHM+IV+AEGAGQELL+    +   +  + GNKLLQDVG+W+S+ IKD ++K+RK  I L
Sbjct  311  GHMIIVMAEGAGQELLSESMHTMDQQDAS-GNKLLQDVGLWISESIKDHFTKKRKMIINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+P NASDNVYCTLLA S VHGA AG+TGFT G VNGRH YIPF+R+TE+
Sbjct  370  KYIDPTYMIRAVPGNASDNVYCTLLAHSVVHGAFAGYTGFTVGPVNGRHAYIPFHRVTEK  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN---GKTPASK  519
            QNKVVITDRMWARLLSSTNQPSFL PK++   K E++   QLL   N    + P SK
Sbjct  430  QNKVVITDRMWARLLSSTNQPSFLKPKDITVSKREKEPPTQLLDGENCTDDRKPVSK  486



>ref|XP_010047648.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW79597.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=544

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFPITL  177
            GHMVIVIAEGAGQEL++  + S     DASGNKL QDVG+W+SQKIKD+  QR K  ITL
Sbjct  363  GHMVIVIAEGAGQELMSQSNQSLDNGKDASGNKLFQDVGLWISQKIKDHFSQRGKMGITL  422

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPS ASDNVYCTLLAQS VHG MAG+TGFT GLVNGR TYIPF RITE+
Sbjct  423  KYIDPTYMIRAIPSIASDNVYCTLLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYRITEK  482

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN VVITDRMWARLLSSTNQPSF  P
Sbjct  483  QNNVVITDRMWARLLSSTNQPSFWSP  508



>ref|XP_007012199.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
 gb|EOY29818.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
Length=490

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LL+    S   +  + GNKLLQDVG+W+S +IK++  +++ PI LK
Sbjct  311  GHMVIVIAEGAGQDLLSESLQSMGQQDAS-GNKLLQDVGLWISHRIKEHFSKKRMPINLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGF  G VNGRH YIPFNRI E+Q
Sbjct  370  YIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFIVGPVNGRHAYIPFNRIIEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            NKVVITDRMWARLLSSTNQPSFL P+++ + K+E++    LL   N K   S T
Sbjct  430  NKVVITDRMWARLLSSTNQPSFLNPRDISEAKKEDQPATGLLDGENCKDRKSMT  483



>ref|XP_010447333.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Camelina sativa]
Length=464

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQ    ITL
Sbjct  314  GHMVIVVAEGAGQDLVAESVEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQSVLDITL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITE+
Sbjct  370  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEK  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  430  QNKVVITDRMWARMLSSTNQPSFMNP  455



>ref|XP_009763925.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Nicotiana sylvestris]
Length=515

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGA QEL++     +  +  + GNKLLQDVG+W+S++IK+ +SKQ+K  I L
Sbjct  338  GHMVIVIAEGAAQELVSESLRCTGKQDPS-GNKLLQDVGLWISERIKEHFSKQKKMLINL  396

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPFN ITE 
Sbjct  397  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNGITET  456

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  457  QNKVVITDRMWARLLSSTNQPSFL  480



>ref|XP_010432655.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Camelina sativa]
Length=462

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 5/146 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQ    ITL
Sbjct  312  GHMVIVVAEGAGQDLVAESVEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQSVLDITL  367

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITE+
Sbjct  368  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEK  427

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  428  QNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|NP_001056831.1| Os06g0151900 [Oryza sativa Japonica Group]
 dbj|BAF18745.1| Os06g0151900, partial [Oryza sativa Japonica Group]
Length=156

 Score =   194 bits (492),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKDYSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVH  270
            GN +L DVG+WLSQKIK++ K+ K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S VH
Sbjct  4    GNSILLDVGLWLSQKIKEHFKKIKTTINLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVH  63

Query  271  GAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  429
            GAMAG+TGFT G VNGRH YIPF RITE+QNKV ITDRMWARLLSSTNQPSFL
Sbjct  64   GAMAGYTGFTVGQVNGRHCYIPFYRITEKQNKVSITDRMWARLLSSTNQPSFL  116



>ref|XP_006371963.1| phosphofructokinase family protein [Populus trichocarpa]
 gb|ERP49760.1| phosphofructokinase family protein [Populus trichocarpa]
Length=492

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 6/144 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+       +     GNKLLQDVG+W+SQ IKDY SKQ+K  I L
Sbjct  311  GHMVIVIAEGAGQELLSESMQQDAS-----GNKLLQDVGLWISQGIKDYFSKQKKMTINL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+P NA+DNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E+
Sbjct  366  KYIDPTYMIRAVPGNAADNVYCTLLAQSVVHGAMAGYTGFTSGLVNGRQTYIPFYRINEK  425

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+KVVITDRMWARLLSSTNQPSF+
Sbjct  426  QHKVVITDRMWARLLSSTNQPSFI  449



>emb|CDX94352.1| BnaC01g18320D [Brassica napus]
 emb|CDX89351.1| BnaA01g15420D [Brassica napus]
Length=489

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMV+VIAEGAGQ+L++    S   +  + GNKLL DVG+WLSQ IKD+  Q+K  + LK
Sbjct  311  GHMVLVIAEGAGQDLMSKSMESMTLKDAS-GNKLLNDVGLWLSQSIKDHFNQKKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLSP  454



>ref|XP_002867573.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43832.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMV+VIAEGAGQ+L++    S   +  + GNKLL+DVG+WLSQ IKD+  Q+K  + LK
Sbjct  300  GHMVLVIAEGAGQDLMSKSMESMTLKDAS-GNKLLKDVGLWLSQSIKDHFNQKKMVMNLK  358

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  359  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQ  418

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  419  NHVVITDRMWARLLSSTNQPSFLGP  443



>ref|XP_008228400.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=532

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 1/116 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  267
            GNKLLQDVG+WLSQ IKD +SK+R   ITLKYIDPTYMIRAIP NASDNVYCTLLA S +
Sbjct  395  GNKLLQDVGLWLSQNIKDHFSKRRNMNITLKYIDPTYMIRAIPGNASDNVYCTLLAHSAI  454

Query  268  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  435
            HGAMAG+TGFT G VNGRH YIPF R+TERQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  455  HGAMAGYTGFTVGPVNGRHAYIPFCRVTERQNKVVITDRMWARLLSSTNQPSFLDP  510



>ref|XP_006357682.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=504

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S+       GNKLLQDVG+W+S++IK+ +SKQ+K  I L
Sbjct  333  GHMVIVIAEGAGQELVSESLKSTDPS----GNKLLQDVGLWISERIKEHFSKQKKMLINL  388

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VN RH YIPFNRI E+
Sbjct  389  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNHRHAYIPFNRIIEK  448

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  449  QNKVVITDRMWARLLSSTNQPSFL  472



>ref|XP_002867420.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43679.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     S    DASGNKLLQD+G+W+SQ+IKD+   +K  +TLK
Sbjct  312  GHMVIVIAEGAGQDLLAESMEESTTLKDASGNKLLQDIGLWISQRIKDHFA-KKMTLTLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  371  YIDPTYMIRAIPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  431  NKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_010925504.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Elaeis guineensis]
Length=498

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--SKQRKFPIT  174
            GHMV+V+AEGAGQEL+A    S   E  + GNKLL DVG+WLSQKIKD+  S+++K  I 
Sbjct  311  GHMVLVVAEGAGQELMAENMRSMGHEDAS-GNKLLLDVGLWLSQKIKDHFASRKKKMAIN  369

Query  175  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  354
            LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+RITE
Sbjct  370  LKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRITE  429

Query  355  RQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
             QNKVVITDRMWARLLSSTNQPSFL  K+VE  ++EE    QLL   N K
Sbjct  430  AQNKVVITDRMWARLLSSTNQPSFLSHKDVEDARKEEAPPTQLLDGENCK  479



>ref|XP_008348488.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=540

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  267
            GNKLLQDVG+WLSQ I+D +SKQR   I LKYIDPTYMIRAIPSNASDNVYCTLLA S +
Sbjct  389  GNKLLQDVGLWLSQNIRDHFSKQRNMAINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAI  448

Query  268  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  429
            HGAMAG+TGFT G VNGRH YIPF R+TERQNKVVITDRMWARLLSSTNQPSFL
Sbjct  449  HGAMAGYTGFTVGPVNGRHAYIPFRRVTERQNKVVITDRMWARLLSSTNQPSFL  502



>ref|XP_010483140.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
 ref|XP_010483141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
Length=485

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L++    S+  ++   GNKLL+DVG+WL+Q IKDY K+ K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMSKSMESTLKDAS--GNKLLKDVGLWLAQSIKDYFKKIKMVMNLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  369  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  429  NNVVITDRMWARLLSSTNQPSFLGP  453



>ref|XP_010443317.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Camelina 
sativa]
Length=485

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L++    S+  ++   GNKLL+DVG+WL+Q IKDY K+ K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMSKSMESTLKDAS--GNKLLKDVGLWLAQSIKDYFKKIKMVMNLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  369  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  429  NNVVITDRMWARLLSSTNQPSFLGP  453



>ref|XP_011006431.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=486

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 6/144 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+       +     GNKLLQDVG+W+SQ IKDY SKQ+K  I L
Sbjct  311  GHMVIVIAEGAGQELLSESMQQDAS-----GNKLLQDVGLWISQGIKDYFSKQKKMTINL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+P NASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI E+
Sbjct  366  KYIDPTYMIRAVPGNASDNVYCTLLAQSVVHGAMAGYTGYTSGLVNGRQTYIPFYRINEK  425

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+KVVITDRMWARLLSSTNQPSF+
Sbjct  426  QHKVVITDRMWARLLSSTNQPSFI  449



>ref|XP_004517277.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=517

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LL     +   +  + GNKLL DVG+W+S KIKD ++K+ K  I L
Sbjct  312  GHMVIVIAEGAGQDLLTESMQAMDQKDAS-GNKLLLDVGLWISHKIKDHFAKENKMAIVL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS +HGAMAG+TGFT GLVNGRHTYIPFNRITE+
Sbjct  371  KYIDPTYMIRAIPSNASDNVYCTLLAQSAIHGAMAGYTGFTAGLVNGRHTYIPFNRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
             N+VV+TDRM+AR+LSSTNQPSFL P
Sbjct  431  MNQVVVTDRMFARMLSSTNQPSFLKP  456



>ref|XP_009142127.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Brassica rapa]
Length=490

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMV+VIAEGAGQ+L++    S   +  + GNKLL DVG+WLSQ IKD+  Q+K  + LK
Sbjct  311  GHMVLVIAEGAGQDLMSKSMESMTLKDAS-GNKLLNDVGLWLSQSIKDHFNQKKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLSP  454



>emb|CDY69051.1| BnaAnng29210D, partial [Brassica napus]
Length=477

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMV+VIAEGAGQ+L++    S   +  + GNKLL DVG+WLSQ IKD+  Q+K  + LK
Sbjct  296  GHMVLVIAEGAGQDLMSKSMESMTLKDAS-GNKLLNDVGLWLSQSIKDHFNQKKMVMNLK  354

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  355  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQ  414

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  415  NHVVITDRMWARLLSSTNQPSFLSP  439



>ref|NP_567742.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
 sp|Q94AA4.1|PFKA3_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 3; Short=ATP-PFK 
3; Short=Phosphofructokinase 3; AltName: Full=Phosphohexokinase 
3 [Arabidopsis thaliana]
 gb|AAK83587.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AAL90928.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AEE85178.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
Length=489

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMV+VIAEGAGQ+L++    S   +  + GNKLL+DVG+WLSQ IKD+  Q+K  + LK
Sbjct  311  GHMVLVIAEGAGQDLMSKSMESMTLKDAS-GNKLLKDVGLWLSQSIKDHFNQKKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_011016327.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=484

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 6/144 (4%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+       +     GNKLLQDVG+W+SQ IKDY SKQ+K  I L
Sbjct  311  GHMVIVIAEGAGQELLSESMQQDAS-----GNKLLQDVGLWISQGIKDYFSKQKKMTINL  365

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+P NASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI E+
Sbjct  366  KYIDPTYMIRAVPGNASDNVYCTLLAQSVVHGAMAGYTGYTSGLVNGRQTYIPFYRINEK  425

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+KVVITDRMWARLLSSTNQPSF+
Sbjct  426  QHKVVITDRMWARLLSSTNQPSFI  449



>ref|XP_010924465.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 isoform X2 [Elaeis 
guineensis]
Length=363

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S + E  + GNKLL DVG WLSQKIKD +++++   I L
Sbjct  192  GHMVIVVAEGAGQDLIAESLRSMQHEDAS-GNKLLDDVGFWLSQKIKDHFTRKQMMVINL  250

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT GLVNGRHTYIPF+R+TE 
Sbjct  251  KYIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGLVNGRHTYIPFHRMTE-  309

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  486
             NKVVITDRMWAR+LSSTNQPSFLC K++E+ K  E+   QLL
Sbjct  310  TNKVVITDRMWARVLSSTNQPSFLCAKDIEEAKMVEQQPTQLL  352



>ref|XP_006856644.1| hypothetical protein AMTR_s01089p00001250 [Amborella trichopoda]
 gb|ERN18111.1| hypothetical protein AMTR_s01089p00001250 [Amborella trichopoda]
Length=284

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQEL+A        +  + GN+LL DVG+WLS+KIKD+   RK  I LK
Sbjct  112  GHMVIVVAEGAGQELVAESIREMGKQDAS-GNRLLLDVGLWLSEKIKDHFT-RKMVINLK  169

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF R+TE Q
Sbjct  170  YIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFYRVTETQ  229

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSFL
Sbjct  230  NKVVITDRMWARLLSSTNQPSFL  252



>ref|XP_008375839.1| PREDICTED: 6-phosphofructokinase 6-like isoform X2 [Malus domestica]
Length=488

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 119/143 (83%), Gaps = 5/143 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ IKDY SKQRK  I L
Sbjct  311  GHMVIVIAEGAGQELLSERMNQQDAS----GNKLLQDVGLWLSQNIKDYFSKQRKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+ GF  G VNGRH YIPF+R+TER
Sbjct  367  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTER  426

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
             NKVVITDRMWARLLSSTNQPSF
Sbjct  427  LNKVVITDRMWARLLSSTNQPSF  449



>ref|XP_008375838.1| PREDICTED: 6-phosphofructokinase 6-like isoform X1 [Malus domestica]
Length=491

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 119/143 (83%), Gaps = 5/143 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ IKDY SKQRK  I L
Sbjct  314  GHMVIVIAEGAGQELLSERMNQQDAS----GNKLLQDVGLWLSQNIKDYFSKQRKMTINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+ GF  G VNGRH YIPF+R+TER
Sbjct  370  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTER  429

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
             NKVVITDRMWARLLSSTNQPSF
Sbjct  430  LNKVVITDRMWARLLSSTNQPSF  452



>ref|XP_010526087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Tarenaya hassleriana]
Length=459

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 121/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  4    HMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITLK  180
            HMVIVIAEGAGQEL+A       A     GNKLL+DVG+W+S KIK+ ++K  K  ITLK
Sbjct  315  HMVIVIAEGAGQELVAESMEQQDAS----GNKLLKDVGLWMSDKIKEHFAKLNKMAITLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+P+NASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIP NRITERQ
Sbjct  371  YIDPTYMIRAVPANASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRQTYIPLNRITERQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSF+ P
Sbjct  431  NNVVITDRMWARLLSSTNQPSFMNP  455



>emb|CDP03227.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S+  +  + GNKLLQDVG+W+SQ IK+ ++K++K  I L
Sbjct  311  GHMVIVIAEGAGQELLSQSLQSTDQQDAS-GNKLLQDVGLWISQSIKNHFAKEQKMAINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPF+RI ER
Sbjct  370  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHCYIPFHRINER  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+KVVITDRMWARLLSSTNQPSFL
Sbjct  430  QHKVVITDRMWARLLSSTNQPSFL  453



>ref|XP_009126929.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=490

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQEL++    S+  E  + GNKLL+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  311  GHMVIVLAEGAGQELMSKSMESNALEDAS-GNKLLKDVGLWLSQSIKDHFKKNKMEMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYC+LLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_006283577.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
 gb|EOA16475.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
Length=502

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+L+A       A     GNKLL+DVG+W+S KIK+ ++KQ    ITL
Sbjct  360  GHMVIVIAEGAGQDLVAESIEQQDAS----GNKLLKDVGLWMSLKIKEHFAKQSVMDITL  415

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRITER
Sbjct  416  KYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITER  475

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWAR+LSSTNQPSF+
Sbjct  476  QNKVVITDRMWARMLSSTNQPSFM  499



>ref|XP_009337906.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337907.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337917.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337918.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=484

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL    +   A     GNKLLQDVG+WLSQ I+D +SKQRK  I L
Sbjct  311  GHMVIVIAEGAGQELLPESMNQQDAS----GNKLLQDVGLWLSQNIRDHFSKQRKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP NASDNVY TLLAQS VHGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  367  KYIDPTYMIRAIPGNASDNVYSTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  427  QNKVVITDRMWARLLSSTNQPSFL  450



>gb|AIE47275.1| phosphofructokinase [Hevea brasiliensis]
Length=551

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S++ ++   GNKLL+D+G+W+S +IK+ +SKQ+K  I L
Sbjct  365  GHMVIVIAEGAGQELLSETMQSNQQDAS--GNKLLRDIGLWISHRIKEHFSKQKKMTINL  422

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE+
Sbjct  423  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEK  482

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
            QNKVVITDRMWARLLSSTNQPSF
Sbjct  483  QNKVVITDRMWARLLSSTNQPSF  505



>ref|XP_010925503.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Elaeis guineensis]
Length=552

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--SKQRKFPIT  174
            GHMV+V+AEGAGQEL+A    S   E  + GNKLL DVG+WLSQKIKD+  S+++K  I 
Sbjct  365  GHMVLVVAEGAGQELMAENMRSMGHEDAS-GNKLLLDVGLWLSQKIKDHFASRKKKMAIN  423

Query  175  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  354
            LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+RITE
Sbjct  424  LKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRITE  483

Query  355  RQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
             QNKVVITDRMWARLLSSTNQPSFL  K+VE  ++EE    QLL   N K
Sbjct  484  AQNKVVITDRMWARLLSSTNQPSFLSHKDVEDARKEEAPPTQLLDGENCK  533



>ref|XP_002275308.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 ref|XP_010648295.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 emb|CBI20597.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQELL+    S   ++   GN LLQDVG+W+S +IKD +++QRK  I L
Sbjct  312  GHMVIVMAEGAGQELLSESLLSMGQDAS--GNNLLQDVGLWMSHRIKDHFARQRKIAINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP NASDNVYCTLLAQS VHGAMAG+TGFT G+VNGRH YIPF+RI E 
Sbjct  370  KYIDPTYMIRAIPGNASDNVYCTLLAQSAVHGAMAGYTGFTIGIVNGRHAYIPFHRINES  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            +NKVVITDRMWARLLSSTNQPSF  PK+V +VK+EE     LL   N K
Sbjct  430  RNKVVITDRMWARLLSSTNQPSFQNPKDVAEVKKEEAPATGLLDGDNSK  478



>emb|CDY20715.1| BnaA02g08550D [Brassica napus]
Length=490

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L++    S+  E  + GNKLL+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMSKSMESNTLEDAS-GNKLLKDVGLWLSQSIKDHFKKNKMEMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYC+LLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLGP  454



>emb|CAN74837.1| hypothetical protein VITISV_023326 [Vitis vinifera]
Length=488

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIV+AEGAGQELL+    S   ++   GN LLQDVG+W+S +IKDY ++QRK  I L
Sbjct  312  GHMVIVMAEGAGQELLSESLLSMGQDAS--GNNLLQDVGLWMSHRIKDYFARQRKIAINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP NASDNVYCTLLAQS VHGAMAG+TGFT G+VNGRH YIPF+RI E 
Sbjct  370  KYIDPTYMIRAIPGNASDNVYCTLLAQSAVHGAMAGYTGFTIGIVNGRHAYIPFHRINES  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            +NKVVITDRMWARLLSSTNQPSF  P
Sbjct  430  RNKVVITDRMWARLLSSTNQPSFQNP  455



>ref|XP_008387449.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
 ref|XP_008344002.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=538

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPITL  177
            GHMVIV+AEGAGQELL+    S   +  + GNKLLQDVG+W+SQKIKD+ K+  K  I L
Sbjct  358  GHMVIVMAEGAGQELLSESIHSMTKQDAS-GNKLLQDVGLWISQKIKDHFKEGNKMSINL  416

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF+RI E+
Sbjct  417  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQ  476

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  477  QNKVVITDRMWARLLSSTNQPSFL  500



>emb|CDY32873.1| BnaC09g33200D [Brassica napus]
Length=488

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQEL++    S+   S   GNKLL+DVG+WLSQ IKDY K+    + LK
Sbjct  311  GHMVIVLAEGAGQELMSKSMESNTDAS---GNKLLKDVGLWLSQSIKDYFKKINMVMNLK  367

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  368  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  427

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  428  NNVVITDRMWARLLSSTNQPSFLGP  452



>ref|XP_007160266.1| hypothetical protein PHAVU_002G306800g [Phaseolus vulgaris]
 gb|ESW32260.1| hypothetical protein PHAVU_002G306800g [Phaseolus vulgaris]
Length=471

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S   +  + GNKLLQDVG+W+SQKIK+ +S+Q+   I L
Sbjct  311  GHMVIVIAEGAGQELVSESIQSMHKQDAS-GNKLLQDVGLWISQKIKEHFSRQKTMNINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E 
Sbjct  370  KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEG  429

Query  358  QNKVVITDRMWARLLSSTNQPSF  426
            QNKVVITDRMWARLLSSTNQPSF
Sbjct  430  QNKVVITDRMWARLLSSTNQPSF  452



>ref|XP_006412866.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54319.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=437

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     S    DASGNKLLQD+G+W+SQ+IKD+   +K  + LK
Sbjct  280  GHMVIVIAEGAGQDLLAESEEQSTTLKDASGNKLLQDIGLWISQRIKDHFA-KKMTLNLK  338

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITERQ
Sbjct  339  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITERQ  398

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            N+VVITDRMWARLLSSTNQPSF+
Sbjct  399  NQVVITDRMWARLLSSTNQPSFM  421



>ref|XP_009120176.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Brassica rapa]
Length=488

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQEL++    S+   S   GNKLL+DVG+WLSQ IKDY K+    + LK
Sbjct  311  GHMVIVLAEGAGQELMSKSMESNTDAS---GNKLLKDVGLWLSQSIKDYFKKINMVMNLK  367

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  368  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  427

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  428  NNVVITDRMWARLLSSTNQPSFLGP  452



>ref|XP_004158491.1| PREDICTED: 6-phosphofructokinase 3-like [Cucumis sativus]
Length=511

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPITL  177
            GHMVIVIAEGAGQEL++        +  + GNKL QDVG+W+SQ+IKDY K+ RK  I L
Sbjct  332  GHMVIVIAEGAGQELMSESIHKLDQQDAS-GNKLHQDVGLWISQQIKDYFKEKRKMVINL  390

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH YIPF RITER
Sbjct  391  KYIDPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITER  450

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  451  QNKVVITDRMWARLLSSTNQPSFLHP  476



>emb|CAB38956.1| pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana]
 emb|CAB79482.1| pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana]
Length=500

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMV+VIAEGAGQ+L++    S   +  + GNKLL+DVG+WLSQ IKD+  Q+K  + LK
Sbjct  322  GHMVLVIAEGAGQDLMSKSMESMTLKDAS-GNKLLKDVGLWLSQSIKDHFNQKKMVMNLK  380

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+Q
Sbjct  381  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQ  440

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  441  NHVVITDRMWARLLSSTNQPSFLGP  465



>ref|XP_010051556.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW82287.1| hypothetical protein EUGRSUZ_C03703 [Eucalyptus grandis]
Length=486

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S+  +  + GNKLL+DVG+WLSQKIK+ ++K+ K  I L
Sbjct  308  GHMVIVIAEGAGQELLSESMQSADKKDAS-GNKLLRDVGLWLSQKIKEHFAKKAKMIINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            K+IDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRH+YIPF RITE+
Sbjct  367  KHIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHSYIPFYRITEK  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN VVITDRMWARLLSSTNQPSF+
Sbjct  427  QNNVVITDRMWARLLSSTNQPSFM  450



>dbj|BAB09881.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=488

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+     S+  ++   GNKLL+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  314  GHMVIVLAEGAGQDLMCKSMESTPMDAS--GNKLLKDVGLWLSQSIKDHFKKNKMVMNLK  371

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITE Q
Sbjct  372  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITETQ  431

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  432  NNVVITDRMWARLLSSTNQPSFLGP  456



>ref|XP_010438324.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
 ref|XP_010438325.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
Length=472

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  312  GHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  371  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  431  NKVVITDRMWARLLSSTNQPSFM  453



>ref|NP_568842.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
 sp|Q9C5J7.1|PFKA7_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 7; Short=ATP-PFK 
7; Short=Phosphofructokinase 7; AltName: Full=Phosphohexokinase 
7 [Arabidopsis thaliana]
 gb|AAK25917.1|AF360207_1 putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AAK64113.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AED96790.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
Length=485

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+     S+  ++   GNKLL+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMCKSMESTPMDAS--GNKLLKDVGLWLSQSIKDHFKKNKMVMNLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITE Q
Sbjct  369  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITETQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  429  NNVVITDRMWARLLSSTNQPSFLGP  453



>gb|KGN58020.1| hypothetical protein Csa_3G435010 [Cucumis sativus]
Length=529

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPITL  177
            GHMVIVIAEGAGQEL++        +  + GNKL QDVG+W+SQ+IKDY K+ RK  I L
Sbjct  350  GHMVIVIAEGAGQELMSESIHKLDQQDAS-GNKLHQDVGLWISQQIKDYFKEKRKMVINL  408

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH YIPF RITER
Sbjct  409  KYIDPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITER  468

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  469  QNKVVITDRMWARLLSSTNQPSFLHP  494



>gb|KDO79936.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=458

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S   +  + GNKLLQDVG+W+S KIKD +++  K  I L
Sbjct  297  GHMVIVIAEGAGQDLLAESLQSMNQQDAS-GNKLLQDVGLWISHKIKDHFARLHKMAINL  355

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGA+AG+TGFT G VNGRH YIPFNRI ER
Sbjct  356  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAVAGYTGFTVGPVNGRHAYIPFNRINER  415

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN+VVITDRMWAR+LSSTNQPSFL
Sbjct  416  QNQVVITDRMWARVLSSTNQPSFL  439



>ref|XP_006285234.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
 gb|EOA18132.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
Length=473

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LL+     SK   DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  313  GHMVIVIAEGAGQDLLSESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  371

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  372  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  431

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  432  NKVVITDRMWARLLSSTNQPSFM  454



>ref|XP_010447879.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
 ref|XP_010447880.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
Length=472

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  312  GHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  371  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  431  NKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_009128951.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 [Brassica rapa]
 emb|CDY48604.1| BnaA01g07610D [Brassica napus]
Length=473

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA  +  S    DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  312  GHMVIVIAEGAGQDLLAESNEQSTTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  371  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  431  NKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_006450746.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
 gb|ESR63986.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
Length=472

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S   +  + GNKLLQD G+W+S KIKD +++  K  I L
Sbjct  311  GHMVIVIAEGAGQDLLAESLQSMNQQDAS-GNKLLQDFGLWISHKIKDHFARLHKMAINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPFNRI ER
Sbjct  370  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTAGPVNGRHAYIPFNRINER  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN+VVITDRMWAR+LSSTNQPSFL
Sbjct  430  QNQVVITDRMWARVLSSTNQPSFL  453



>gb|KDO79934.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=472

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQ+LLA    S   +  + GNKLLQDVG+W+S KIKD +++  K  I L
Sbjct  311  GHMVIVIAEGAGQDLLAESLQSMNQQDAS-GNKLLQDVGLWISHKIKDHFARLHKMAINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGA+AG+TGFT G VNGRH YIPFNRI ER
Sbjct  370  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAVAGYTGFTVGPVNGRHAYIPFNRINER  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN+VVITDRMWAR+LSSTNQPSFL
Sbjct  430  QNQVVITDRMWARVLSSTNQPSFL  453



>ref|XP_004243602.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Solanum 
lycopersicum]
Length=490

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S+       GNKLLQDVG+W+S++IK+ +SKQ+K  I L
Sbjct  314  GHMVIVIAEGAGQELVSESLKSTDPS----GNKLLQDVGLWISERIKEHFSKQKKMLINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VN R+ YIPFNRI E+
Sbjct  370  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRIIEK  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  430  QNKVVITDRMWARLLSSTNQPSFL  453



>ref|XP_006280374.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
 gb|EOA13272.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
Length=487

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L++    S+  ++   GNKLL+DVG+WLSQ IKD+  + K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMSKSMESTLKDAS--GNKLLKDVGLWLSQSIKDHFNKNKMVMNLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  369  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  429  NNVVITDRMWARLLSSTNQPSFLGP  453



>emb|CDY06829.1| BnaC01g09280D [Brassica napus]
Length=479

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA  +  S    DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  318  GHMVIVIAEGAGQDLLAESNEQSTTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  376

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  377  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  436

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  437  NKVVITDRMWARLLSSTNQPSFM  459



>emb|CDY41800.1| BnaC02g12110D [Brassica napus]
Length=485

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L++    S+  E  + GNKLL+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMSKRMESNTLEDAS-GNKLLKDVGLWLSQSIKDHFKKNKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYC+LLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NHVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_009395051.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S   E  + GNKLL DVG+WLSQ IK+Y + ++K  I L
Sbjct  370  GHMVIVVAEGAGQDLIAESMKSMDHEDAS-GNKLLLDVGLWLSQGIKNYFTSRQKMTINL  428

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF+R+TE+
Sbjct  429  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFDRVTEK  488

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            +NKVVITDRMWARLLSSTNQPSFL
Sbjct  489  RNKVVITDRMWARLLSSTNQPSFL  512



>ref|XP_006412865.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54318.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=469

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     S    DASGNKLLQD+G+W+SQ+IKD+   +K  + LK
Sbjct  312  GHMVIVIAEGAGQDLLAESEEQSTTLKDASGNKLLQDIGLWISQRIKDHFA-KKMTLNLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITERQ
Sbjct  371  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITERQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            N+VVITDRMWARLLSSTNQPSF+
Sbjct  431  NQVVITDRMWARLLSSTNQPSFM  453



>ref|XP_009395050.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S   E  + GNKLL DVG+WLSQ IK+Y + ++K  I L
Sbjct  370  GHMVIVVAEGAGQDLIAESMKSMDHEDAS-GNKLLLDVGLWLSQGIKNYFTSRQKMTINL  428

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF+R+TE+
Sbjct  429  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFDRVTEK  488

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            +NKVVITDRMWARLLSSTNQPSFL
Sbjct  489  RNKVVITDRMWARLLSSTNQPSFL  512



>gb|KJB06662.1| hypothetical protein B456_001G025000 [Gossypium raimondii]
Length=548

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQELL+    S   +  + GNKLLQDVG+W+S KIK++  ++K PI LK
Sbjct  377  GHMVIVIAEGAGQELLSESLQSVDQQDAS-GNKLLQDVGLWISHKIKEHFAKKKMPINLK  435

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPS ASDNVYCTLLA   VHGAM G+TGFT G VNGRH YIPFNRI E+Q
Sbjct  436  YIDPTYMIRAIPSIASDNVYCTLLAHGAVHGAMTGYTGFTVGPVNGRHAYIPFNRIIEKQ  495

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            NKVVITDRMWARLLSSTNQPSFL P
Sbjct  496  NKVVITDRMWARLLSSTNQPSFLKP  520



>ref|XP_004243600.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Solanum 
lycopersicum]
Length=509

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQEL++    S+       GNKLLQDVG+W+S++IK+ +SKQ+K  I L
Sbjct  333  GHMVIVIAEGAGQELVSESLKSTDPS----GNKLLQDVGLWISERIKEHFSKQKKMLINL  388

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VN R+ YIPFNRI E+
Sbjct  389  KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRIIEK  448

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  449  QNKVVITDRMWARLLSSTNQPSFL  472



>ref|XP_002309230.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
 gb|EEE92753.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
Length=552

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIVIAEGAGQELL+    S   +  + GNKLLQDVG+W+SQ IKDY S+Q+   I L
Sbjct  365  GHMVIVIAEGAGQELLSESMQSRNQQDAS-GNKLLQDVGLWISQGIKDYFSRQKTMAINL  423

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVY TLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E+
Sbjct  424  KYIDPTYMIRAVPSNASDNVYSTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEK  483

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSF+
Sbjct  484  QNKVVITDRMWARLLSSTNQPSFM  507



>gb|AFW75541.1| hypothetical protein ZEAMMB73_660971 [Zea mays]
Length=531

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+A    S   ++   GN+LL DVG+WLSQKI +Y K+ K  I LK
Sbjct  350  GHMVIVVAEGAGQKLIAETMQSIGKDAS--GNQLLLDVGLWLSQKINEYFKKNKMTINLK  407

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  408  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITEKQ  467

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  495
            N+V ITDRMWARLLSSTNQPSFLC K +E+ K+E++   QLL  +
Sbjct  468  NRVSITDRMWARLLSSTNQPSFLCNKVIEEAKKEQERAAQLLDGS  512



>ref|XP_010668815.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=487

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQELL+   +   A     GNKLL+DVG+W+S KIK++  ++   I LK
Sbjct  320  GHMVIVMAEGAGQELLSENRNEKDAS----GNKLLKDVGLWMSHKIKEHFARKSMIINLK  375

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAGFTG T GLVNGRHTYIPF RITE+Q
Sbjct  376  YIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGFTGSTVGLVNGRHTYIPFERITEQQ  435

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            N+V ITDRMWARLLSSTNQPSFL
Sbjct  436  NQVCITDRMWARLLSSTNQPSFL  458



>ref|XP_008794086.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008794087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
Length=505

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--SKQRKFPIT  174
            GHMV+V+AEGAGQE +A    S      + GNK L DVG WLSQKIKD+  S+++K  I 
Sbjct  311  GHMVLVVAEGAGQEFIAENMRSMDHADAS-GNKQLLDVGFWLSQKIKDHFASRKKKMVIN  369

Query  175  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  354
            LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+RITE
Sbjct  370  LKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTIGPVNGRHAYIPFHRITE  429

Query  355  RQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
             QNKVVITDRMWARLLSSTNQPSFL  K+VE  K+EE+ + QLL   N K
Sbjct  430  TQNKVVITDRMWARLLSSTNQPSFLSHKDVEDSKKEEEEQTQLLDGENCK  479



>ref|XP_008648820.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Zea mays]
 gb|AFW75540.1| hypothetical protein ZEAMMB73_660971 [Zea mays]
Length=552

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+A    S   ++   GN+LL DVG+WLSQKI +Y K+ K  I LK
Sbjct  371  GHMVIVVAEGAGQKLIAETMQSIGKDAS--GNQLLLDVGLWLSQKINEYFKKNKMTINLK  428

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  429  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITEKQ  488

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  495
            N+V ITDRMWARLLSSTNQPSFLC K +E+ K+E++   QLL  +
Sbjct  489  NRVSITDRMWARLLSSTNQPSFLCNKVIEEAKKEQERAAQLLDGS  533



>ref|XP_010433524.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Camelina sativa]
Length=488

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+L++    S   +  + GNKLL+DVG+WLSQ IKD+   +K  + LK
Sbjct  311  GHMVIVIAEGAGQDLMSKSMESMTLKDAS-GNKLLKDVGLWLSQSIKDHF-NKKMVMNLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE Q
Sbjct  369  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFLCP
Sbjct  429  NHVVITDRMWARLLSSTNQPSFLCP  453



>ref|XP_004149188.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphofructokinase 7-like 
[Cucumis sativus]
Length=512

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--SKQRKFPIT  174
            GHMVIVIAEGAGQEL++        +  + GNKL QDVG+W+SQ+IKDY   K+ K  I 
Sbjct  332  GHMVIVIAEGAGQELMSESIHKLDQQDAS-GNKLHQDVGLWISQQIKDYFKEKKEKMVIN  390

Query  175  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  354
            LKYIDPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH YIPF RITE
Sbjct  391  LKYIDPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITE  450

Query  355  RQNKVVITDRMWARLLSSTNQPSFLCP  435
            RQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  451  RQNKVVITDRMWARLLSSTNQPSFLHP  477



>ref|XP_008795495.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X3 [Phoenix dactylifera]
Length=323

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  267
            GNKLL DVG+WLSQKIKD +++++K  I LKYIDPTYMIRAIPSNASDNV CTLLAQ  V
Sbjct  171  GNKLLHDVGLWLSQKIKDHFTRKQKMAINLKYIDPTYMIRAIPSNASDNVACTLLAQCAV  230

Query  268  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkeve  447
            HGAMAG+TGFT GLVNGRHTYIPF+R+T + NKVVITDRMWARLLSSTNQPSFL  K++E
Sbjct  231  HGAMAGYTGFTVGLVNGRHTYIPFHRLT-KTNKVVITDRMWARLLSSTNQPSFLSAKDIE  289

Query  448  kvkeeeklkeQLL  486
            + K+ E+   QLL
Sbjct  290  EAKKVEQQPTQLL  302



>ref|XP_010438323.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X1 [Camelina sativa]
Length=547

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  387  GHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  445

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  446  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  505

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSF+
Sbjct  506  NKVVITDRMWARLLSSTNQPSFM  528



>ref|XP_010438777.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Camelina 
sativa]
Length=486

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 121/145 (83%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+L++    + K  S   GNKLL+DVG+WLSQ IKD+   +K  + LK
Sbjct  311  GHMVIVIAEGAGQDLMSKSMETLKDAS---GNKLLKDVGLWLSQSIKDHF-NKKMVMNLK  366

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE Q
Sbjct  367  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQ  426

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFLCP
Sbjct  427  NHVVITDRMWARLLSSTNQPSFLCP  451



>gb|KFK27231.1| hypothetical protein AALP_AA8G354500 [Arabis alpina]
Length=489

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L++    S   +  + GNKLL+DVG+WLSQ IKD+  + K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMSKSMESMTLKDAS-GNKLLKDVGLWLSQSIKDHFNKIKMVMNLK  369

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+Q
Sbjct  370  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQ  429

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  430  NNVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_009132191.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=485

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQE++     ++  E  + GNK+L+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  306  GHMVIVLAEGAGQEMMTKSMETNTLEDAS-GNKVLKDVGLWLSQSIKDHFKKIKMVMNLK  364

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLV+GR TYIPF RITE+Q
Sbjct  365  YIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQ  424

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  425  NSVVITDRMWARLLSSTNQPSFLGP  449



>ref|XP_008375836.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=484

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 121/144 (84%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ I+D +SKQRK  I L
Sbjct  311  GHMVIVIAEGAGQELLSESMNQQDAS----GNKLLQDVGLWLSQNIRDHFSKQRKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVY TLLAQS +HGAMAG+TGFT G VN RH YIPF+R+T+ 
Sbjct  367  KYIDPTYMIRAIPSNASDNVYSTLLAQSAIHGAMAGYTGFTVGPVNRRHAYIPFHRVTQG  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  427  QNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_008375837.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=484

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ I+D + K+RK  I L
Sbjct  311  GHMVIVIAEGAGQELLSESMNQQDAS----GNKLLQDVGLWLSQNIRDHFLKRRKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T  
Sbjct  367  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTRG  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  427  QNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_002437847.1| hypothetical protein SORBIDRAFT_10g003650 [Sorghum bicolor]
 gb|EER89214.1| hypothetical protein SORBIDRAFT_10g003650 [Sorghum bicolor]
Length=539

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+A    S   ++   GN+LL DVG+WLSQKI +Y K+ K  I LK
Sbjct  371  GHMVIVVAEGAGQKLIAETMQSIGKDAS--GNELLLDVGLWLSQKINEYFKKNKMTINLK  428

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  429  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITEKQ  488

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  495
            N+V ITDRMWARLLSSTNQPSFLC K VE+ K+E++   QLL  +
Sbjct  489  NRVSITDRMWARLLSSTNQPSFLCNKVVEEAKKEQERAAQLLDGS  533



>emb|CDY11911.1| BnaC03g13370D [Brassica napus]
Length=478

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQE++     ++  E  + GNK+L+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  306  GHMVIVLAEGAGQEMMTKSMETNTLEDAS-GNKVLKDVGLWLSQSIKDHFKKIKMVMNLK  364

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLV+GR TYIPF RITE+Q
Sbjct  365  YIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQ  424

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  425  NSVVITDRMWARLLSSTNQPSFLGP  449



>ref|XP_002515946.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF46366.1| phosphofructokinase, putative [Ricinus communis]
Length=543

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  4    HMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITLK  180
            HMVIVIAEGAGQELL+    +   +  + GN+LLQDVG+W+SQKIKD +S+ +K  ITLK
Sbjct  371  HMVIVIAEGAGQELLSESMRTMDKQDAS-GNRLLQDVGLWISQKIKDHFSQDQKMNITLK  429

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH++IPF+R+ ER+
Sbjct  430  YIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHSHIPFHRVNERR  489

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  498
            NKVVITDRMWARLLSSTNQPSFL P  V + K EE+ +  LL   N
Sbjct  490  NKVVITDRMWARLLSSTNQPSFLDPMHVIEDKLEEEPESPLLDGEN  535



>ref|XP_010668810.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=514

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQELL+   +   A     GNKLL+DVG+W+S KIK++  ++   I LK
Sbjct  347  GHMVIVMAEGAGQELLSENRNEKDAS----GNKLLKDVGLWMSHKIKEHFARKSMIINLK  402

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAGFTG T GLVNGRHTYIPF RITE+Q
Sbjct  403  YIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGFTGSTVGLVNGRHTYIPFERITEQQ  462

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            N+V ITDRMWARLLSSTNQPSFL
Sbjct  463  NQVCITDRMWARLLSSTNQPSFL  485



>gb|KDO79935.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=441

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  267
            GNKLLQDVG+W+S KIKD +++  K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS V
Sbjct  309  GNKLLQDVGLWISHKIKDHFARLHKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAV  368

Query  268  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  429
            HGA+AG+TGFT G VNGRH YIPFNRI ERQN+VVITDRMWAR+LSSTNQPSFL
Sbjct  369  HGAVAGYTGFTVGPVNGRHAYIPFNRINERQNQVVITDRMWARVLSSTNQPSFL  422



>ref|XP_008795494.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
Length=370

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S      + GNKLL DVG+WLSQKIKD +++++K  I L
Sbjct  189  GHMVIVVAEGAGQDLIAESPQSFHHADAS-GNKLLHDVGLWLSQKIKDHFTRKQKMAINL  247

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNV CTLLAQ  VHGAMAG+TGFT GLVNGRHTYIPF+R+T +
Sbjct  248  KYIDPTYMIRAIPSNASDNVACTLLAQCAVHGAMAGYTGFTVGLVNGRHTYIPFHRLT-K  306

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  486
             NKVVITDRMWARLLSSTNQPSFL  K++E+ K+ E+   QLL
Sbjct  307  TNKVVITDRMWARLLSSTNQPSFLSAKDIEEAKKVEQQPTQLL  349



>ref|XP_006412864.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54317.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=555

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     S    DASGNKLLQD+G+W+SQ+IKD+   +K  + LK
Sbjct  398  GHMVIVIAEGAGQDLLAESEEQSTTLKDASGNKLLQDIGLWISQRIKDHFA-KKMTLNLK  456

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITERQ
Sbjct  457  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITERQ  516

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            N+VVITDRMWARLLSSTNQPSF+
Sbjct  517  NQVVITDRMWARLLSSTNQPSFM  539



>ref|XP_009337915.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X4 [Pyrus x bretschneideri]
Length=451

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ I+D + KQ K  I L
Sbjct  281  GHMVIVIAEGAGQELLSESMNQQDAS----GNKLLQDVGLWLSQNIRDHFLKQGKMTINL  336

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  337  KYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  396

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  397  QNKVVITDRMWARLLSSTNQPSFL  420



>ref|XP_010433122.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433123.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
Length=472

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  312  GHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  371  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVV TDRMWARLLSSTNQPSF+
Sbjct  431  NKVVTTDRMWARLLSSTNQPSFM  453



>ref|XP_008795493.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Phoenix dactylifera]
Length=373

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S      + GNKLL DVG+WLSQKIKD +++++K  I L
Sbjct  192  GHMVIVVAEGAGQDLIAESPQSFHHADAS-GNKLLHDVGLWLSQKIKDHFTRKQKMAINL  250

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNV CTLLAQ  VHGAMAG+TGFT GLVNGRHTYIPF+R+T +
Sbjct  251  KYIDPTYMIRAIPSNASDNVACTLLAQCAVHGAMAGYTGFTVGLVNGRHTYIPFHRLT-K  309

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  486
             NKVVITDRMWARLLSSTNQPSFL  K++E+ K+ E+   QLL
Sbjct  310  TNKVVITDRMWARLLSSTNQPSFLSAKDIEEAKKVEQQPTQLL  352



>ref|XP_008794084.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Phoenix dactylifera]
Length=559

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--SKQRKFPIT  174
            GHMV+V+AEGAGQE +A    S      + GNK L DVG WLSQKIKD+  S+++K  I 
Sbjct  365  GHMVLVVAEGAGQEFIAENMRSMDHADAS-GNKQLLDVGFWLSQKIKDHFASRKKKMVIN  423

Query  175  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  354
            LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+RITE
Sbjct  424  LKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTIGPVNGRHAYIPFHRITE  483

Query  355  RQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
             QNKVVITDRMWARLLSSTNQPSFL  K+VE  K+EE+ + QLL   N K
Sbjct  484  TQNKVVITDRMWARLLSSTNQPSFLSHKDVEDSKKEEEEQTQLLDGENCK  533



>ref|XP_010541000.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Tarenaya 
hassleriana]
Length=488

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQELL+    S   +  + GNKLL D+G+W+S +IKD+   +K  I LK
Sbjct  311  GHMVIVIAEGAGQELLSESMQSMTLKDAS-GNKLLHDIGLWISHRIKDHFA-KKMTINLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRH+YIPF RITE+Q
Sbjct  369  YIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHSYIPFYRITEKQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            N+VVITDRMWARLLSSTNQPSF+
Sbjct  429  NEVVITDRMWARLLSSTNQPSFM  451



>ref|XP_009337910.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Pyrus 
x bretschneideri]
Length=474

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 119/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL    +   A     GNKL QDVG+WLSQ I+D +SK+RK  I L
Sbjct  311  GHMVIVIAEGAGQELLPESMNQRDAS----GNKLPQDVGLWLSQNIRDHFSKRRKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGF  G VNGRH YIPF+R+TER
Sbjct  367  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFAVGPVNGRHAYIPFHRVTER  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
             NKVVITDRMWARLLSSTNQPSFL
Sbjct  427  LNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_009395732.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Musa acuminata subsp. malaccensis]
Length=522

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIV+AEGAGQEL+A    S   E  + GNKLL DVG+WLSQKIK+Y + +++  I L
Sbjct  364  GHMVIVVAEGAGQELIADSVRSMGHEDAS-GNKLLLDVGLWLSQKIKNYFTSRQRMTINL  422

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQ+ VHGAMAG+TGFT G+VNGRHTYIPF R+TE+
Sbjct  423  KYIDPTYMIRAIPSNASDNVYCTLLAQNAVHGAMAGYTGFTIGVVNGRHTYIPFYRVTEK  482

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            +NKV+ITDRMWARLLSSTNQPSFL
Sbjct  483  RNKVIITDRMWARLLSSTNQPSFL  506



>gb|KJB65625.1| hypothetical protein B456_010G103900 [Gossypium raimondii]
Length=483

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 132/174 (76%), Gaps = 8/174 (5%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+L++    S   +  + GNKLLQDVG+W+S  IK        PI LK
Sbjct  311  GHMVIVIAEGAGQDLVSESLQSMDQQDAS-GNKLLQDVGLWISHGIK-------MPINLK  362

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPFNRITE+Q
Sbjct  363  YIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITEKQ  422

Query  361  NKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKT  522
            NKVVITDRMWARLLSSTNQPSFL PK++ + KEE++    LL   N K   S T
Sbjct  423  NKVVITDRMWARLLSSTNQPSFLNPKDIAEAKEEKQPATGLLDGENCKDKKSNT  476



>ref|NP_001054859.1| Os05g0194900 [Oryza sativa Japonica Group]
 dbj|BAF16773.1| Os05g0194900, partial [Oryza sativa Japonica Group]
Length=288

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+++A     + A   + GNK+L DVG+WL  KIKD + K+  FPITL
Sbjct  99   GHMVIVVAEGAGQDVIARSMRLADAHDAS-GNKVLLDVGLWLCAKIKDHFKKKANFPITL  157

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYC+LLA S +HGAMAG+TGFT   VNGRH YIPF RITE+
Sbjct  158  KYIDPTYMIRAVPSNASDNVYCSLLAHSAIHGAMAGYTGFTVAPVNGRHAYIPFYRITEK  217

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWAR+L STNQP FL
Sbjct  218  QNKVVITDRMWARVLCSTNQPCFL  241



>ref|XP_008447566.1| PREDICTED: 6-phosphofructokinase 6-like [Cucumis melo]
Length=530

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPITL  177
            GHMVIVIAEGAGQEL++        +  + GNKL QDVG+W+SQ+IKD+ K+ RK  I L
Sbjct  351  GHMVIVIAEGAGQELMSESIHKLDQQDAS-GNKLHQDVGLWISQQIKDFFKEKRKMVINL  409

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH YIPF+RI ER
Sbjct  410  KYIDPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFHRIIER  469

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  470  QNKVVITDRMWARLLSSTNQPSFLHP  495



>ref|XP_009337911.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Pyrus x bretschneideri]
Length=484

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ I+D + KQ K  I L
Sbjct  314  GHMVIVIAEGAGQELLSESMNQQDAS----GNKLLQDVGLWLSQNIRDHFLKQGKMTINL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  370  KYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  430  QNKVVITDRMWARLLSSTNQPSFL  453



>ref|XP_010924464.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 isoform X1 [Elaeis 
guineensis]
Length=483

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S + E  + GNKLL DVG WLSQKIKD +++++   I L
Sbjct  312  GHMVIVVAEGAGQDLIAESLRSMQHEDAS-GNKLLDDVGFWLSQKIKDHFTRKQMMVINL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT GLVNGRHTYIPF+R+TE 
Sbjct  371  KYIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGLVNGRHTYIPFHRMTE-  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  486
             NKVVITDRMWAR+LSSTNQPSFLC K++E+ K  E+   QLL
Sbjct  430  TNKVVITDRMWARVLSSTNQPSFLCAKDIEEAKMVEQQPTQLL  472



>ref|XP_009337913.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Pyrus x bretschneideri]
Length=471

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ I+D + KQ K  I L
Sbjct  301  GHMVIVIAEGAGQELLSESMNQQDAS----GNKLLQDVGLWLSQNIRDHFLKQGKMTINL  356

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  357  KYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  416

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  417  QNKVVITDRMWARLLSSTNQPSFL  440



>ref|XP_009337914.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X3 [Pyrus x bretschneideri]
Length=471

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ I+D + KQ K  I L
Sbjct  301  GHMVIVIAEGAGQELLSESMNQQDAS----GNKLLQDVGLWLSQNIRDHFLKQGKMTINL  356

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  357  KYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  416

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  417  QNKVVITDRMWARLLSSTNQPSFL  440



>ref|XP_002309528.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
 gb|EEE93051.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
Length=466

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+LLA    S   +  + GN LLQDVG+W+S KI D +++ +K  ITL
Sbjct  295  GHMVIVVAEGAGQDLLAKYLQSMNQQDAS-GNNLLQDVGLWISHKINDHFARVQKMAITL  353

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+P NASDNVYC+LLAQS VHGAMAG+TGFT G VNGRH+YIPF RI ER
Sbjct  354  KYIDPTYMIRAVPGNASDNVYCSLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFERINER  413

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN+VVITDRMWARLLSSTNQPSF+ P
Sbjct  414  QNQVVITDRMWARLLSSTNQPSFISP  439



>ref|XP_008799762.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=538

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S   E  + GNKLL DVG+WLSQKIKD +++ +K  + L
Sbjct  366  GHMVIVVAEGAGQDLIAESLRSMHNEDPS-GNKLLLDVGLWLSQKIKDHFARIQKMVMNL  424

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT GLVNGRHTYIPF+R+TE+
Sbjct  425  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGLVNGRHTYIPFHRVTEK  484

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  486
            +N+VVITDRMWARLLSSTNQPSFL  K++E+ K+ E    QLL
Sbjct  485  RNRVVITDRMWARLLSSTNQPSFLSAKDIEEAKKAEPQPTQLL  527



>ref|XP_009337916.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X5 [Pyrus x bretschneideri]
Length=481

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+   +   A     GNKLLQDVG+WLSQ I+D + KQ K  I L
Sbjct  311  GHMVIVIAEGAGQELLSESMNQQDAS----GNKLLQDVGLWLSQNIRDHFLKQGKMTINL  366

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  367  KYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  426

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSFL
Sbjct  427  QNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_010915352.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Elaeis 
guineensis]
Length=548

 Score =   199 bits (506),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 133/169 (79%), Gaps = 2/169 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMV+V+AEGAGQEL+A    S   E  + GNKLL DVG+WLSQKIKD +++ +K  I L
Sbjct  365  GHMVLVVAEGAGQELIAESMRSMDHEDAS-GNKLLLDVGLWLSQKIKDHFARSKKVAINL  423

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+RITE 
Sbjct  424  KYIDPTYMIRAIPGNASDNVYCTLLAHSVIHGAMAGYTGFTVGPVNGRHAYIPFHRITET  483

Query  358  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  504
            +NKVVITDRMWARLLSSTNQPSFL  K+VE  K E +   QLL   N K
Sbjct  484  RNKVVITDRMWARLLSSTNQPSFLSHKDVEDAKTEGEPVTQLLDGENCK  532



>ref|XP_010433121.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Camelina 
sativa]
Length=549

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K  + LK
Sbjct  389  GHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNLK  447

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+Q
Sbjct  448  YIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQ  507

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVV TDRMWARLLSSTNQPSF+
Sbjct  508  NKVVTTDRMWARLLSSTNQPSFM  530



>ref|XP_006643863.1| PREDICTED: 6-phosphofructokinase 3-like [Oryza brachyantha]
Length=534

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A   +       + GNKLL DVG+WLSQKIKD + K+R FPITL
Sbjct  347  GHMVIVVAEGAGQDLIAKSMNLVDTRDAS-GNKLLLDVGLWLSQKIKDHFKKKRNFPITL  405

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RITE+
Sbjct  406  KYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEK  465

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWAR+LSSTNQP FL
Sbjct  466  QNKVVITDRMWARVLSSTNQPCFL  489



>ref|XP_010540999.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQELL+    S   +  + GNKLL D+G+W+S +IKD+   +K  I LK
Sbjct  378  GHMVIVIAEGAGQELLSESMQSMTLKDAS-GNKLLHDIGLWISHRIKDHFA-KKMTINLK  435

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRH+YIPF RITE+Q
Sbjct  436  YIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHSYIPFYRITEKQ  495

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            N+VVITDRMWARLLSSTNQPSF+
Sbjct  496  NEVVITDRMWARLLSSTNQPSFM  518



>ref|NP_001151911.1| 6-phosphofructokinase [Zea mays]
 gb|ACG44918.1| 6-phosphofructokinase [Zea mays]
Length=538

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+A    S   ++   GN+LL DVG+WLSQKI ++ K+ K  I LK
Sbjct  370  GHMVIVVAEGAGQKLIAETMQSIGKDAS--GNELLLDVGLWLSQKINEHFKKNKMTINLK  427

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  428  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITEKQ  487

Query  361  NKVVITDRMWARLLSSTNQPSFLC  432
            N+V ITDRMWARLLSSTNQPSFLC
Sbjct  488  NRVSITDRMWARLLSSTNQPSFLC  511



>ref|XP_009387228.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=538

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A    S   E  + GNKLL DVG+WLSQ+IK+Y + ++K  I L
Sbjct  366  GHMVIVVAEGAGQDLIAESMRSMNHEDAS-GNKLLLDVGLWLSQRIKNYFTSRQKMVINL  424

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLAQ  VHGAMAG+TGFT GLVNGRHTYIPF+R+TE 
Sbjct  425  KYIDPTYMIRAIPSNASDNVYCTLLAQCAVHGAMAGYTGFTVGLVNGRHTYIPFDRVTET  484

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            +N VVITDRMWARLLSSTNQPSFL
Sbjct  485  RNTVVITDRMWARLLSSTNQPSFL  508



>ref|XP_004964832.1| PREDICTED: 6-phosphofructokinase 7-like [Setaria italica]
Length=556

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+A    S   ++   GN+LL DVG+WLSQKI +Y K+ K  I LK
Sbjct  375  GHMVIVVAEGAGQKLIAETMQSIGKDAS--GNELLLDVGLWLSQKINEYFKKNKMTINLK  432

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHG MAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  433  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGTMAGYTGFTIGQVNGRHCYIPFYRITEKQ  492

Query  361  NKVVITDRMWARLLSSTNQPSFLC  432
            N+V ITDRMWARLLSSTNQPSFLC
Sbjct  493  NRVSITDRMWARLLSSTNQPSFLC  516



>gb|ACL53548.1| unknown [Zea mays]
 gb|ACN28560.1| unknown [Zea mays]
 gb|AFW85827.1| 6-phosphofructokinase [Zea mays]
Length=538

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+A    S   ++   GN+LL DVG+WLSQKI ++ K+ K  I LK
Sbjct  370  GHMVIVVAEGAGQKLIAETMQSIGKDAS--GNELLLDVGLWLSQKINEHFKKNKMTINLK  427

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  428  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITEKQ  487

Query  361  NKVVITDRMWARLLSSTNQPSFLC  432
            N+V ITDRMWARLLSSTNQPSFLC
Sbjct  488  NRVSITDRMWARLLSSTNQPSFLC  511



>ref|XP_003564328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Brachypodium 
distachyon]
Length=551

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L A    +   ++   GN LL DVG+WLSQKI ++ K+ K  I LK
Sbjct  370  GHMVIVVAEGAGQKLFAETMKAMGQDAS--GNALLLDVGLWLSQKINEHFKKTKTTINLK  427

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  428  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGQVNGRHCYIPFYRITEKQ  487

Query  361  NKVVITDRMWARLLSSTNQPSFLC  432
            NKV ITDRMWARLLSSTNQPSFLC
Sbjct  488  NKVSITDRMWARLLSSTNQPSFLC  511



>ref|XP_006583042.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=464

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVI+EGAG EL++   S++  +  + GNKLLQDVG+WLSQKIKD ++K +K  ITL
Sbjct  310  GHMVIVISEGAGHELISESLSATNKQEAS-GNKLLQDVGLWLSQKIKDHFTKSQKMDITL  368

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PS ASDNV+CTLLAQS VHGAMAG+TGF  G VNG+H YIPF RI E 
Sbjct  369  KYIDPTYMIRAVPSIASDNVHCTLLAQSAVHGAMAGYTGFAVGTVNGKHAYIPFYRINEI  428

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            + KVVITDRMWARLLSSTNQPSFL P
Sbjct  429  EKKVVITDRMWARLLSSTNQPSFLNP  454



>gb|AFW80261.1| hypothetical protein ZEAMMB73_064922 [Zea mays]
 gb|AFW80262.1| hypothetical protein ZEAMMB73_064922 [Zea mays]
Length=375

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFPITL  177
            GHMVIV+AEGAGQ+L+A   +    +  + GNKLL DVG+WLSQKIKD+ K++  FPITL
Sbjct  192  GHMVIVVAEGAGQDLIARSMNFVDTQDAS-GNKLLLDVGLWLSQKIKDHFKKKPSFPITL  250

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RITE+
Sbjct  251  KYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEK  310

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWAR+L STNQP FL
Sbjct  311  QNKVVITDRMWARVLCSTNQPCFL  334



>gb|KCW69691.1| hypothetical protein EUGRSUZ_F03086 [Eucalyptus grandis]
Length=422

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELL+    + +    + GNKLL DVG+W+SQKIKD +++ +K  I L
Sbjct  224  GHMVIVIAEGAGQELLSESMRNMQQADAS-GNKLLNDVGLWISQKIKDHFARTQKMLINL  282

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF RI E 
Sbjct  283  KYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRINET  342

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            Q+KVVITDRMWARLLSSTNQPSFL
Sbjct  343  QHKVVITDRMWARLLSSTNQPSFL  366



>gb|KHN05322.1| 6-phosphofructokinase 3 [Glycine soja]
Length=458

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAG EL++   S++  +  + GNKL  DVG+WLSQKIKD ++K RK  ITL
Sbjct  310  GHMVIVIAEGAGHELISESLSATNKQDAS-GNKLFLDVGLWLSQKIKDHFTKSRKMDITL  368

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PS ASDNVYCTLLAQS VHGAMAG+TGF  G VNG+H YIPF RI E 
Sbjct  369  KYIDPTYMIRAVPSIASDNVYCTLLAQSAVHGAMAGYTGFAAGAVNGKHAYIPFYRINEI  428

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            + KVVITDRMWARLLSSTNQPSFL P
Sbjct  429  EKKVVITDRMWARLLSSTNQPSFLKP  454



>ref|XP_010086908.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB24699.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=485

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQELL+    S   E  + GNKLL+DVG+W+SQ+IKD ++K+ K  I L
Sbjct  305  GHMVIVVAEGAGQELLSESIHSMTKEDAS-GNKLLKDVGLWISQQIKDHFAKKNKMTINL  363

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVY TLLAQS VHGAMAG+TGFT GLVNGR +YIPF +ITE+
Sbjct  364  KYIDPTYMIRAIPSNASDNVYSTLLAQSAVHGAMAGYTGFTVGLVNGRQSYIPFYKITEK  423

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
             NKVVITDRMWARLLSSTNQPSFL
Sbjct  424  MNKVVITDRMWARLLSSTNQPSFL  447



>gb|KHN39263.1| 6-phosphofructokinase 3 [Glycine soja]
Length=464

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVI+EGAG EL++   S++  +  + GNKLLQDVG+WLSQKIKD ++K +K  ITL
Sbjct  310  GHMVIVISEGAGHELISESLSATNKQEAS-GNKLLQDVGLWLSQKIKDHFTKSQKMDITL  368

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PS ASDNV+CTLLAQS VHGAMAG+TGF  G VNG+H YIPF RI E 
Sbjct  369  KYIDPTYMIRAVPSIASDNVHCTLLAQSAVHGAMAGYTGFAVGTVNGKHAYIPFYRINEI  428

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            + KVVITDRMWARLLSSTNQPSFL P
Sbjct  429  EKKVVITDRMWARLLSSTNQPSFLNP  454



>ref|XP_011072633.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Sesamum indicum]
Length=457

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAGQELLA           +   KLLQDVG+W+++KIKD ++K+RK  I +
Sbjct  311  GHMVIVIAEGAGQELLAKNMHDMDQLDPSE-TKLLQDVGLWITEKIKDHFTKERKMIINV  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGF  G VNGRH YIPF+RI ER
Sbjct  370  KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFVVGPVNGRHAYIPFHRINER  429

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            +NKVVITDRMWARLLSSTNQPSFL P
Sbjct  430  RNKVVITDRMWARLLSSTNQPSFLNP  455



>ref|XP_003533035.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=458

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIVIAEGAG EL++   S++  +  + GNKL  DVG+WLSQKIKD ++K RK  ITL
Sbjct  310  GHMVIVIAEGAGHELISESLSATNKQDAS-GNKLFLDVGLWLSQKIKDHFTKSRKMDITL  368

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PS ASDNVYCTLLAQS VHGAMAG+TGF  G VNG+H YIPF RI E 
Sbjct  369  KYIDPTYMIRAVPSIASDNVYCTLLAQSAVHGAMAGYTGFAAGAVNGKHAYIPFYRINEI  428

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            + KVVITDRMWARLLSSTNQPSFL P
Sbjct  429  EKKVVITDRMWARLLSSTNQPSFLKP  454



>tpg|DAA57730.1| TPA: hypothetical protein ZEAMMB73_790705 [Zea mays]
Length=226

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKDYSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVH  270
            GNKLL DVG+WL+ KIKDY K +K  +T+KYIDPTYMIRAIPSNASDNVYCTLLA S +H
Sbjct  78   GNKLLLDVGLWLTHKIKDYCKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIH  137

Query  271  GAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  429
            GAMAG++ FT G+VNGRH YIPF+R+T  +NKV ITDRMWARLLSSTNQPSFL
Sbjct  138  GAMAGYS-FTVGMVNGRHAYIPFHRVTSTRNKVRITDRMWARLLSSTNQPSFL  189



>ref|XP_009388585.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQEL+     S + +  + GNKLL DVG+WLS KIKD +++ +K  I L
Sbjct  312  GHMVIVVAEGAGQELITESMRSMEHQDAS-GNKLLLDVGLWLSHKIKDHFARNQKMAINL  370

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLA S +HG MAG+TGFT G VNGRH YIPF+RITE+
Sbjct  371  KYIDPTYMIRAVPSNASDNVYCTLLAHSALHGTMAGYTGFTVGPVNGRHAYIPFHRITEK  430

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSF+
Sbjct  431  QNKVVITDRMWARLLSSTNQPSFI  454



>ref|XP_010451175.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Camelina sativa]
Length=456

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIVIAEGAGQ+L++    + K  S   GNKLL+DVG+WLSQ IKD+   +K  + LK
Sbjct  311  GHMVIVIAEGAGQDLMSKSMETLKDAS---GNKLLKDVGLWLSQSIKDHF-NKKMVMNLK  366

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE Q
Sbjct  367  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQ  426

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  427  NHVVITDRMWARLLSSTNQPSFLGP  451



>emb|CDX88580.1| BnaA03g10690D [Brassica napus]
Length=485

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQE++     S+  E  + GNK+L+DVG+WLSQ IKD+ K+ K  + LK
Sbjct  306  GHMVIVLAEGAGQEMMTKSMESTTLEDAS-GNKVLKDVGLWLSQSIKDHFKKIKMVMNLK  364

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLV+GR TYIPF RITE+Q
Sbjct  365  YIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQ  424

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQ SFL P
Sbjct  425  NSVVITDRMWARLLSSTNQLSFLGP  449



>ref|NP_001042273.1| Os01g0191700 [Oryza sativa Japonica Group]
 dbj|BAD72228.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAD72231.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAF04187.1| Os01g0191700 [Oryza sativa Japonica Group]
 gb|EAY72859.1| hypothetical protein OsI_00730 [Oryza sativa Indica Group]
Length=531

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A   +    +  + GNKLL DVG+WLSQKIKD + K+R FPITL
Sbjct  346  GHMVIVVAEGAGQDLIAKSMNFVDTQDAS-GNKLLLDVGLWLSQKIKDHFKKKRNFPITL  404

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RITE+
Sbjct  405  KYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEK  464

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWAR+L STNQP FL
Sbjct  465  QNKVVITDRMWARVLCSTNQPCFL  488



>gb|KJB18571.1| hypothetical protein B456_003G061100, partial [Gossypium raimondii]
Length=418

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+ EGAGQELL+  + +      + GNK LQDVG W+SQKIKD +SK++K  I L
Sbjct  251  GHMVIVVTEGAGQELLSGNTCTMDNIDAS-GNKQLQDVGFWISQKIKDHFSKKQKLTINL  309

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMI A+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNG+H+ IPF RITER
Sbjct  310  KYIDPTYMICAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGKHSCIPFQRITER  369

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QNKVVITDRMWAR LSSTNQPSF  P
Sbjct  370  QNKVVITDRMWARCLSSTNQPSFFSP  395



>gb|EAZ10866.1| hypothetical protein OsJ_00706 [Oryza sativa Japonica Group]
Length=503

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+L+A   +    +  + GNKLL DVG+WLSQKIKD + K+R FPITL
Sbjct  311  GHMVIVVAEGAGQDLIAKSMNFVDTQDAS-GNKLLLDVGLWLSQKIKDHFKKKRNFPITL  369

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RITE+
Sbjct  370  KYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEK  429

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWAR+L STNQP FL
Sbjct  430  QNKVVITDRMWARVLCSTNQPCFL  453



>ref|XP_009388583.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQEL+     S + +  + GNKLL DVG+WLS KIKD +++ +K  I L
Sbjct  362  GHMVIVVAEGAGQELITESMRSMEHQDAS-GNKLLLDVGLWLSHKIKDHFARNQKMAINL  420

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLA S +HG MAG+TGFT G VNGRH YIPF+RITE+
Sbjct  421  KYIDPTYMIRAVPSNASDNVYCTLLAHSALHGTMAGYTGFTVGPVNGRHAYIPFHRITEK  480

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWARLLSSTNQPSF+
Sbjct  481  QNKVVITDRMWARLLSSTNQPSFI  504



>ref|XP_006853746.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
 gb|ERN15213.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
Length=480

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQEL+A        +  + GN+LL DVG+WLS+KIKD+   RK  I LK
Sbjct  308  GHMVIVVAEGAGQELVAESIREMGKQDAS-GNRLLLDVGLWLSEKIKDHFT-RKMVINLK  365

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF R+TE Q
Sbjct  366  YIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFYRVTETQ  425

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKVVITDRMWARLLSSTNQPSFL
Sbjct  426  NKVVITDRMWARLLSSTNQPSFL  448



>ref|XP_009344489.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=540

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +1

Query  91   GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  267
            GNKLLQDVG+WLSQ I+D + KQR   I LKYIDPTYMIRAIPSNASDNVYCTLLA S +
Sbjct  389  GNKLLQDVGLWLSQNIRDHFLKQRNITINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAI  448

Query  268  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  429
            HGAMAG+TGFT G VNGRH YIPF  +TE+QNKVVITDRMWARLLSSTNQPSFL
Sbjct  449  HGAMAGYTGFTVGPVNGRHAYIPFRWVTEKQNKVVITDRMWARLLSSTNQPSFL  502



>dbj|BAK01448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+         ++   GN LL DVG+WLSQKI ++ K+ K  I LK
Sbjct  313  GHMVIVVAEGAGQKLIVENMKEMGQDAS--GNALLLDVGLWLSQKINEHFKKNKTTINLK  370

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+Q
Sbjct  371  YIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGQVNGRHCYIPFYRITEKQ  430

Query  361  NKVVITDRMWARLLSSTNQPSFL  429
            NKV ITDRMWARLLSSTNQPSFL
Sbjct  431  NKVSITDRMWARLLSSTNQPSFL  453



>ref|XP_004494953.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=562

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQEL++  + S      + GN LLQDVG W+SQ IKD ++K++   ITL
Sbjct  400  GHMVIVVAEGAGQELISKSTPSVDKHDAS-GNNLLQDVGPWISQNIKDHFAKEKMLDITL  458

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+PSNASDNVYCTLLAQS +HGAMAG+TGFT GLVNG+ TYIPF RITE+
Sbjct  459  KYIDPTYMIRAVPSNASDNVYCTLLAQSAIHGAMAGYTGFTSGLVNGKQTYIPFYRITEK  518

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QN +VITDRMW+RLLSSTNQPSF+
Sbjct  519  QNNIVITDRMWSRLLSSTNQPSFM  542



>ref|XP_002864472.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40731.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLK  180
            GHMVIV+AEGAGQ+L+     S+  ++   GNKLL+DVG+WLSQ IK +  + K  + LK
Sbjct  311  GHMVIVLAEGAGQDLMCKSMESTLKDAS--GNKLLKDVGLWLSQSIKVHFNKNKMVMNLK  368

Query  181  YIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQ  360
            YIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE Q
Sbjct  369  YIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITETQ  428

Query  361  NKVVITDRMWARLLSSTNQPSFLCP  435
            N VVITDRMWARLLSSTNQPSFL P
Sbjct  429  NNVVITDRMWARLLSSTNQPSFLGP  453



>ref|XP_008798601.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=552

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMV+V+AEGAGQEL+A    S   E  + GNKLL DVG+WLSQKIKD ++  +K  I L
Sbjct  365  GHMVLVVAEGAGQELIAESMRSMNHEDAS-GNKLLLDVGLWLSQKIKDHFASSKKLAINL  423

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG++GFT G VNGRH YIPF+RITE 
Sbjct  424  KYIDPTYMIRAIPGNASDNVYCTLLAHSAIHGAMAGYSGFTVGPVNGRHAYIPFHRITET  483

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            +NKVVITDRMWARLLSSTNQPSFL
Sbjct  484  RNKVVITDRMWARLLSSTNQPSFL  507



>ref|NP_001147976.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACG29308.1| 6-phosphofructokinase 2 [Zea mays]
Length=525

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 122/144 (85%), Gaps = 2/144 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFPITL  177
            GHMVIV+AEGAGQ+L+A   +S   +  + GNKLL DVG+WLSQKIKD+ K++ +FPITL
Sbjct  352  GHMVIVVAEGAGQDLIAKSMNSVDTQDAS-GNKLLLDVGLWLSQKIKDHFKKKPRFPITL  410

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RITE+
Sbjct  411  KYIDPTYMIRAVSSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEK  470

Query  358  QNKVVITDRMWARLLSSTNQPSFL  429
            QNKVVITDRMWAR+L STNQP FL
Sbjct  471  QNKVVITDRMWARVLCSTNQPCFL  494



>ref|XP_011019558.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Populus 
euphratica]
Length=480

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  177
            GHMVIV+AEGAGQ+LLA    S   +  + GN LLQDVG+W+S KI D +++ +K  ITL
Sbjct  309  GHMVIVVAEGAGQDLLAKYLQSMNQQDAS-GNHLLQDVGLWISHKINDHFARVQKMTITL  367

Query  178  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  357
            KYIDPTYMIRA+P NASDNVYC LLAQS VHGAMAG+TGFT G VNG+H+YIPF RI ER
Sbjct  368  KYIDPTYMIRAVPGNASDNVYCYLLAQSAVHGAMAGYTGFTVGPVNGQHSYIPFERINER  427

Query  358  QNKVVITDRMWARLLSSTNQPSFLCP  435
            QN+VVITDRMWARLLSSTNQPSF+ P
Sbjct  428  QNQVVITDRMWARLLSSTNQPSFISP  453



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230