BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016D07 409 bp,:Filtered

Length=366
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002283240.1|  PREDICTED: R3H domain-containing protein 2       89.7    9e-19   Vitis vinifera
ref|XP_010055671.1|  PREDICTED: R3H domain-containing protein 1       86.7    1e-17   Eucalyptus grandis [rose gum]
gb|KDP23817.1|  hypothetical protein JCGZ_00069                       85.9    2e-17   Jatropha curcas
emb|CDP06226.1|  unnamed protein product                              87.0    2e-17   Coffea canephora [robusta coffee]
ref|XP_010673076.1|  PREDICTED: uncharacterized protein LOC104889530  84.3    7e-17   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011070087.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...  84.3    8e-17   Sesamum indicum [beniseed]
ref|NP_001242845.1|  uncharacterized protein LOC100814835             83.2    2e-16   Glycine max [soybeans]
ref|XP_006576254.1|  PREDICTED: uncharacterized protein LOC100814...  83.2    2e-16   Glycine max [soybeans]
gb|KHN12174.1|  R3H domain-containing protein 2                       83.2    2e-16   Glycine soja [wild soybean]
gb|KHN08910.1|  R3H domain-containing protein 2                       82.4    4e-16   Glycine soja [wild soybean]
ref|XP_003554106.1|  PREDICTED: R3H domain-containing protein 2-like  82.4    4e-16   Glycine max [soybeans]
ref|XP_007162049.1|  hypothetical protein PHAVU_001G119400g           82.0    5e-16   Phaseolus vulgaris [French bean]
gb|KDO53659.1|  hypothetical protein CISIN_1g018220mg                 80.9    6e-16   Citrus sinensis [Valencia orange]
ref|XP_011040734.1|  PREDICTED: uncharacterized protein LOC105136920  81.6    6e-16   Populus euphratica
gb|KDO53658.1|  hypothetical protein CISIN_1g018220mg                 81.3    1e-15   Citrus sinensis [Valencia orange]
ref|XP_006482042.1|  PREDICTED: R3H domain-containing protein 2-like  81.3    1e-15   Citrus sinensis [Valencia orange]
ref|XP_006430510.1|  hypothetical protein CICLE_v10012047mg           81.3    1e-15   Citrus clementina
ref|XP_002307959.2|  hypothetical protein POPTR_0006s03320g           81.3    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010247210.1|  PREDICTED: R3H domain-containing protein 2       80.9    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_002521584.1|  r3h domain containing protein, putative          80.5    2e-15   Ricinus communis
ref|XP_010243832.1|  PREDICTED: R3H domain-containing protein 1-l...  80.1    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_002322608.1|  hypothetical protein POPTR_0016s03230g           80.1    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_007145505.1|  hypothetical protein PHAVU_007G244200g           79.7    4e-15   Phaseolus vulgaris [French bean]
ref|XP_011079086.1|  PREDICTED: uncharacterized protein LOC105162694  78.2    1e-14   Sesamum indicum [beniseed]
ref|XP_010905886.1|  PREDICTED: uncharacterized protein LOC105032977  77.8    2e-14   Elaeis guineensis
ref|XP_008808576.1|  PREDICTED: uncharacterized protein LOC103720587  77.8    2e-14   Phoenix dactylifera
ref|XP_007028263.1|  Single-stranded nucleic acid binding R3H pro...  77.0    2e-14   Theobroma cacao [chocolate]
ref|XP_004493365.1|  PREDICTED: uncharacterized protein LOC101493813  77.4    3e-14   Cicer arietinum [garbanzo]
ref|XP_007028262.1|  Single-stranded nucleic acid binding R3H pro...  77.0    3e-14   Theobroma cacao [chocolate]
ref|XP_009770790.1|  PREDICTED: R3H domain-containing protein 1-like  76.3    5e-14   Nicotiana sylvestris
gb|AFK48151.1|  unknown                                               72.4    6e-14   Medicago truncatula
ref|XP_009611070.1|  PREDICTED: R3H domain-containing protein 2       75.9    9e-14   Nicotiana tomentosiformis
ref|XP_004249122.1|  PREDICTED: R3H domain-containing protein 2       75.5    1e-13   Solanum lycopersicum
ref|XP_006364781.1|  PREDICTED: R3H domain-containing protein 2-like  75.1    2e-13   Solanum tuberosum [potatoes]
ref|XP_004167787.1|  PREDICTED: uncharacterized protein LOC101224356  74.3    3e-13   
ref|XP_008443221.1|  PREDICTED: R3H domain-containing protein 2-l...  73.9    4e-13   Cucumis melo [Oriental melon]
gb|EYU18596.1|  hypothetical protein MIMGU_mgv1a009115mg              73.9    4e-13   Erythranthe guttata [common monkey flower]
ref|XP_003624915.1|  R3H domain-containing protein                    73.9    4e-13   Medicago truncatula
ref|XP_006574397.1|  PREDICTED: uncharacterized protein LOC100784...  73.2    5e-13   Glycine max [soybeans]
ref|XP_003535913.1|  PREDICTED: uncharacterized protein LOC100799336  73.6    6e-13   Glycine max [soybeans]
ref|XP_008244779.1|  PREDICTED: uncharacterized protein LOC103342896  73.6    6e-13   Prunus mume [ume]
ref|XP_007204692.1|  hypothetical protein PRUPE_ppa007799mg           73.6    6e-13   Prunus persica
ref|XP_004136625.1|  PREDICTED: uncharacterized protein LOC101215817  73.9    6e-13   
ref|XP_002517274.1|  r3h domain containing protein, putative          73.2    8e-13   Ricinus communis
ref|NP_001241328.1|  uncharacterized protein LOC100784326             73.2    8e-13   Glycine max [soybeans]
gb|EYU20818.1|  hypothetical protein MIMGU_mgv1a008714mg              71.6    4e-12   Erythranthe guttata [common monkey flower]
ref|XP_010931539.1|  PREDICTED: R3H domain-containing protein 1-like  71.2    5e-12   Elaeis guineensis
ref|XP_006402961.1|  hypothetical protein EUTSA_v10006048mg           70.5    1e-11   Eutrema salsugineum
gb|KHG23664.1|  R3H domain-containing 1                               70.1    1e-11   Gossypium arboreum [tree cotton]
ref|XP_008786865.1|  PREDICTED: uncharacterized protein LOC103705051  70.1    1e-11   Phoenix dactylifera
gb|KFK34908.1|  hypothetical protein AALP_AA5G209300                  69.7    2e-11   Arabis alpina [alpine rockcress]
ref|XP_008359462.1|  PREDICTED: R3H domain-containing protein 1-like  69.3    2e-11   Malus domestica [apple tree]
gb|KJB46182.1|  hypothetical protein B456_007G351600                  68.6    4e-11   Gossypium raimondii
ref|XP_008788551.1|  PREDICTED: R3H domain-containing protein 1-like  67.4    7e-11   
ref|XP_010909706.1|  PREDICTED: uncharacterized protein LOC105035733  66.2    3e-10   Elaeis guineensis
ref|XP_009339978.1|  PREDICTED: R3H domain-containing protein 2-like  65.9    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_002876378.1|  hypothetical protein ARALYDRAFT_486108           65.5    5e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_191227.1|  Single-stranded nucleic acid binding R3H protein    65.1    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350136.1|  PREDICTED: R3H domain-containing protein 1-like  61.6    1e-08   Malus domestica [apple tree]
ref|XP_009386294.1|  PREDICTED: uncharacterized protein LOC103973455  61.2    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_680299.4|  hAT family dimerization domain-containing protein   61.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010058748.1|  PREDICTED: uncharacterized protein LOC104446610  55.1    1e-07   Eucalyptus grandis [rose gum]
gb|KFK42320.1|  single-stranded nucleic acid binding r3h protein      57.4    4e-07   Arabis alpina [alpine rockcress]
ref|XP_010069795.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.2    4e-07   Eucalyptus grandis [rose gum]
ref|XP_009410414.1|  PREDICTED: R3H domain-containing protein 2-like  56.2    7e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009139085.1|  PREDICTED: protein encore                        55.8    1e-06   Brassica rapa
emb|CDX76005.1|  BnaA04g02690D                                        55.8    1e-06   Brassica napus [oilseed rape]
emb|CDY61685.1|  BnaCnng38270D                                        55.8    1e-06   Brassica napus [oilseed rape]
ref|XP_010543660.1|  PREDICTED: R3H domain-containing protein 2-like  55.5    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_010243833.1|  PREDICTED: R3H domain-containing protein 1-l...  54.7    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010427506.1|  PREDICTED: R3H domain-containing protein 1-like  54.7    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010504574.1|  PREDICTED: R3H domain-containing protein 1-like  54.7    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006292703.1|  hypothetical protein CARUB_v10018949mg           54.3    4e-06   Capsella rubella
ref|XP_010558120.1|  PREDICTED: uncharacterized protein LOC104826881  53.9    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_010111099.1|  R3H domain-containing protein 1                  54.3    4e-06   Morus notabilis
ref|XP_010552904.1|  PREDICTED: uncharacterized protein LOC104823164  52.8    1e-05   Tarenaya hassleriana [spider flower]
ref|NP_565947.1|  Single-stranded nucleic acid binding R3H protein    52.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64355.1|  unknown                                               52.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KDO53660.1|  hypothetical protein CISIN_1g018220mg                 51.6    3e-05   Citrus sinensis [Valencia orange]
ref|XP_002879898.1|  hypothetical protein ARALYDRAFT_483163           50.4    9e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_006294497.1|  hypothetical protein CARUB_v10023526mg           47.8    5e-04   Capsella rubella
ref|XP_010517577.1|  PREDICTED: uncharacterized protein LOC104793004  47.8    6e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010505858.1|  PREDICTED: uncharacterized protein LOC104782584  47.8    6e-04   Camelina sativa [gold-of-pleasure]



>ref|XP_002283240.1| PREDICTED: R3H domain-containing protein 2 [Vitis vinifera]
 ref|XP_010653643.1| PREDICTED: R3H domain-containing protein 2 [Vitis vinifera]
 emb|CAN73572.1| hypothetical protein VITISV_007445 [Vitis vinifera]
 emb|CBI32816.3| unnamed protein product [Vitis vinifera]
Length=356

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS DAVY+QWP+ SMMYAHSYE+ RH VFQ PF QQPLSFDYSQNH
Sbjct  307  GLNQTSRDAVYLQWPSHSMMYAHSYEQFRHAVFQAPFCQQPLSFDYSQNH  356



>ref|XP_010055671.1| PREDICTED: R3H domain-containing protein 1 [Eucalyptus grandis]
 gb|KCW90005.1| hypothetical protein EUGRSUZ_A02200 [Eucalyptus grandis]
Length=361

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  ++DA YMQWPT +MMYAHSY++LRHGVFQ P  QQPLSFDYSQNH
Sbjct  312  GLNQNTSDAGYMQWPTAAMMYAHSYDQLRHGVFQAPVCQQPLSFDYSQNH  361



>gb|KDP23817.1| hypothetical protein JCGZ_00069 [Jatropha curcas]
Length=352

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS DA Y+QWP+ SMMYAHSYE+ RH VFQVPF QQPLSFDYSQNH
Sbjct  303  GSNQTSGDAAYVQWPSASMMYAHSYEQFRHAVFQVPFCQQPLSFDYSQNH  352



>emb|CDP06226.1| unnamed protein product [Coffea canephora]
Length=464

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS DAVYMQWP+QSMMYA SY++ RH VFQ PF QQPLSFDYSQN+
Sbjct  415  GLNQTSRDAVYMQWPSQSMMYAQSYDQFRHAVFQAPFCQQPLSFDYSQNY  464



>ref|XP_010673076.1| PREDICTED: uncharacterized protein LOC104889530 [Beta vulgaris 
subsp. vulgaris]
Length=362

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            GL+  S DAVYMQWP+ +MMYAHSYE+ RH VFQ PF QQPLSFDYSQN
Sbjct  313  GLNQASRDAVYMQWPSPAMMYAHSYEQFRHSVFQAPFCQQPLSFDYSQN  361



>ref|XP_011070087.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Sesamum indicum]
Length=367

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL   S DA+YMQWPT SMMYA SY++LRHG FQ PF QQPLSFDYSQNH
Sbjct  316  GLSQISRDALYMQWPTPSMMYAQSYDQLRHGFFQGPFCQQPLSFDYSQNH  365



>ref|NP_001242845.1| uncharacterized protein LOC100814835 [Glycine max]
 gb|ACU23119.1| unknown [Glycine max]
Length=336

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS++  Y+QWP+ +MMYAHSY++ RHGVFQ PF QQPLSFDYSQN+
Sbjct  287  GLNQTSSEGAYLQWPSAAMMYAHSYDQFRHGVFQAPFGQQPLSFDYSQNY  336



>ref|XP_006576254.1| PREDICTED: uncharacterized protein LOC100814835 isoform X1 [Glycine 
max]
Length=356

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS++  Y+QWP+ +MMYAHSY++ RHGVFQ PF QQPLSFDYSQN+
Sbjct  307  GLNQTSSEGAYLQWPSAAMMYAHSYDQFRHGVFQAPFGQQPLSFDYSQNY  356



>gb|KHN12174.1| R3H domain-containing protein 2 [Glycine soja]
Length=356

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS++  Y+QWP+ +MMYAHSY++ RHGVFQ PF QQPLSFDYSQN+
Sbjct  307  GLNQTSSEGAYLQWPSAAMMYAHSYDQFRHGVFQAPFGQQPLSFDYSQNY  356



>gb|KHN08910.1| R3H domain-containing protein 2 [Glycine soja]
Length=355

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS++ VY+QWP+ +MMYAHSY++ RH VFQ PF QQPLSFDYSQN+
Sbjct  306  GLNQTSSEGVYLQWPSAAMMYAHSYDQFRHAVFQAPFGQQPLSFDYSQNY  355



>ref|XP_003554106.1| PREDICTED: R3H domain-containing protein 2-like [Glycine max]
Length=355

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS++ VY+QWP+ +MMYAHSY++ RH VFQ PF QQPLSFDYSQN+
Sbjct  306  GLNQTSSEGVYLQWPSAAMMYAHSYDQFRHAVFQAPFGQQPLSFDYSQNY  355



>ref|XP_007162049.1| hypothetical protein PHAVU_001G119400g [Phaseolus vulgaris]
 gb|ESW34043.1| hypothetical protein PHAVU_001G119400g [Phaseolus vulgaris]
Length=355

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ T TD  Y+QWP+ +MMYAHSY++ RH VFQ PF QQPLSFDYSQN+
Sbjct  306  GLNQTPTDGAYLQWPSAAMMYAHSYDQFRHAVFQAPFGQQPLSFDYSQNY  355



>gb|KDO53659.1| hypothetical protein CISIN_1g018220mg [Citrus sinensis]
Length=273

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS +A YMQWP+ +MMYAHSYE+ R   FQVPF QQPLSFDYSQNH
Sbjct  223  GPNQTSVEAAYMQWPSAAMMYAHSYEQFRQAAFQVPFCQQPLSFDYSQNH  272



>ref|XP_011040734.1| PREDICTED: uncharacterized protein LOC105136920 [Populus euphratica]
Length=354

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS DA Y+QWP+ +MMYAHSYE+ RH  FQ PF QQPLSFDYSQNH
Sbjct  305  GSNQTSRDAAYVQWPSAAMMYAHSYEQFRHAAFQAPFCQQPLSFDYSQNH  354



>gb|KDO53658.1| hypothetical protein CISIN_1g018220mg [Citrus sinensis]
Length=359

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS +A YMQWP+ +MMYAHSYE+ R   FQVPF QQPLSFDYSQNH
Sbjct  309  GPNQTSVEAAYMQWPSAAMMYAHSYEQFRQAAFQVPFCQQPLSFDYSQNH  358



>ref|XP_006482042.1| PREDICTED: R3H domain-containing protein 2-like [Citrus sinensis]
Length=359

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS +A YMQWP+ +MMYAHSYE+ R   FQVPF QQPLSFDYSQNH
Sbjct  309  GPNQTSVEAAYMQWPSAAMMYAHSYEQFRQAAFQVPFCQQPLSFDYSQNH  358



>ref|XP_006430510.1| hypothetical protein CICLE_v10012047mg [Citrus clementina]
 gb|ESR43750.1| hypothetical protein CICLE_v10012047mg [Citrus clementina]
Length=359

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS +A YMQWP+ +MMYAHSYE+ R   FQVPF QQPLSFDYSQNH
Sbjct  309  GPNQTSVEAAYMQWPSAAMMYAHSYEQFRQAAFQVPFCQQPLSFDYSQNH  358



>ref|XP_002307959.2| hypothetical protein POPTR_0006s03320g [Populus trichocarpa]
 gb|EEE91482.2| hypothetical protein POPTR_0006s03320g [Populus trichocarpa]
Length=386

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS DA Y+QWP+ +MMYAHSYE+ RH  FQ PF QQPLSFDYSQNH
Sbjct  337  GSNQTSRDAAYVQWPSAAMMYAHSYEQFRHAAFQAPFCQQPLSFDYSQNH  386



>ref|XP_010247210.1| PREDICTED: R3H domain-containing protein 2 [Nelumbo nucifera]
Length=357

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS D +YM WP+ +MMYA SYE+LRH VFQ PF QQPLSFDYSQNH
Sbjct  308  GLNQTSRDPMYMHWPSPAMMYAQSYEQLRHAVFQAPFYQQPLSFDYSQNH  357



>ref|XP_002521584.1| r3h domain containing protein, putative [Ricinus communis]
 gb|EEF40855.1| r3h domain containing protein, putative [Ricinus communis]
Length=349

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS D  Y+QWP+ SMMYAHSYE+ RH VFQ PF QQPLSF+YSQNH
Sbjct  300  GSNQTSRDPAYVQWPSASMMYAHSYEQFRHAVFQAPFCQQPLSFEYSQNH  349



>ref|XP_010243832.1| PREDICTED: R3H domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=355

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS D +YMQWP+ +MMYA SY++ RH VFQ PF QQPLSFDYSQNH
Sbjct  306  GLNQTSRDPMYMQWPSPAMMYAQSYDQFRHAVFQAPFYQQPLSFDYSQNH  355



>ref|XP_002322608.1| hypothetical protein POPTR_0016s03230g [Populus trichocarpa]
 gb|EEF04369.1| hypothetical protein POPTR_0016s03230g [Populus trichocarpa]
Length=354

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS DA Y+QWP+ +MMYAHSY++ RH  FQ PF QQPLSFDYSQNH
Sbjct  305  GSNQTSRDAAYVQWPSTAMMYAHSYDQFRHATFQAPFCQQPLSFDYSQNH  354



>ref|XP_007145505.1| hypothetical protein PHAVU_007G244200g [Phaseolus vulgaris]
 gb|ESW17499.1| hypothetical protein PHAVU_007G244200g [Phaseolus vulgaris]
Length=356

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  S+D  Y+QWP+ SMMYAHSY++ RH +FQ PF Q+PLSFDYSQN+
Sbjct  307  GLNQASSDVTYLQWPSASMMYAHSYDQFRHAIFQAPFGQRPLSFDYSQNY  356



>ref|XP_011079086.1| PREDICTED: uncharacterized protein LOC105162694 [Sesamum indicum]
Length=364

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            GL+ TSTD +YMQW T S+M+ HSY++LRH VFQ P  QQPLSFDYSQN
Sbjct  315  GLNQTSTDGLYMQWQTPSIMHGHSYDQLRHAVFQAPLCQQPLSFDYSQN  363



>ref|XP_010905886.1| PREDICTED: uncharacterized protein LOC105032977 [Elaeis guineensis]
Length=354

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G   T  D VYMQWPT +MMYAHSYE  RHG+FQ PF QQPLSFD+ +NH
Sbjct  305  GCQQTPRDPVYMQWPTPAMMYAHSYEHFRHGIFQAPFYQQPLSFDHMRNH  354



>ref|XP_008808576.1| PREDICTED: uncharacterized protein LOC103720587 [Phoenix dactylifera]
Length=354

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G      DAVYMQWPT +MMYAHSYE  RHG+FQ PF QQPLSFD+ +NH
Sbjct  305  GCQQAPGDAVYMQWPTPAMMYAHSYEHFRHGIFQAPFYQQPLSFDHMRNH  354



>ref|XP_007028263.1| Single-stranded nucleic acid binding R3H protein isoform 2 [Theobroma 
cacao]
 gb|EOY08765.1| Single-stranded nucleic acid binding R3H protein isoform 2 [Theobroma 
cacao]
Length=315

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS D  YMQWP+ +MMY++SY++ RH VFQ PF  QPLSFDYSQN 
Sbjct  266  GLNQTSRDGAYMQWPSATMMYSNSYDQFRHAVFQAPFCHQPLSFDYSQNR  315



>ref|XP_004493365.1| PREDICTED: uncharacterized protein LOC101493813 [Cicer arietinum]
Length=354

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+PTS D  Y+QWP+ +MMYAHSY++ RH V+Q PF  QPLSFDYSQN+
Sbjct  306  GLNPTSADGAYLQWPSPTMMYAHSYDQFRHAVYQAPFG-QPLSFDYSQNY  354



>ref|XP_007028262.1| Single-stranded nucleic acid binding R3H protein isoform 1 [Theobroma 
cacao]
 gb|EOY08764.1| Single-stranded nucleic acid binding R3H protein isoform 1 [Theobroma 
cacao]
Length=357

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS D  YMQWP+ +MMY++SY++ RH VFQ PF  QPLSFDYSQN 
Sbjct  308  GLNQTSRDGAYMQWPSATMMYSNSYDQFRHAVFQAPFCHQPLSFDYSQNR  357



>ref|XP_009770790.1| PREDICTED: R3H domain-containing protein 1-like [Nicotiana sylvestris]
Length=343

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS + V+MQWPTQSM+YAHSY++LRH   Q PF QQPLSF Y+Q H
Sbjct  293  GLNQTSNNGVFMQWPTQSMIYAHSYDQLRHAFIQPPFCQQPLSFAYTQTH  342



>gb|AFK48151.1| unknown [Medicago truncatula]
Length=73

 Score = 72.4 bits (176),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+P S D  Y+QWP+ +MMYAHSY++ RH V+Q PF  QPLSFDYSQN+
Sbjct  25   GLNPASGDGAYLQWPSPTMMYAHSYDQFRHAVYQSPFG-QPLSFDYSQNY  73



>ref|XP_009611070.1| PREDICTED: R3H domain-containing protein 2 [Nicotiana tomentosiformis]
Length=342

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+ TS + V+MQWPTQSM+YAHSY++LRH   Q PF QQPLSF Y+Q H
Sbjct  292  GLNHTSNNGVFMQWPTQSMIYAHSYDQLRHAFIQPPFCQQPLSFGYTQTH  341



>ref|XP_004249122.1| PREDICTED: R3H domain-containing protein 2 [Solanum lycopersicum]
Length=342

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + T  D V+MQWPTQSM+YAHSY+++RH  FQ  F QQPLSF YSQNH
Sbjct  292  GFNQTLNDGVFMQWPTQSMIYAHSYDQVRHAFFQPSFCQQPLSFGYSQNH  341



>ref|XP_006364781.1| PREDICTED: R3H domain-containing protein 2-like [Solanum tuberosum]
Length=342

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G   T  D V+MQWPTQSM+YAHSY+++RH  FQ  F QQPLSF YSQNH
Sbjct  292  GFSQTPNDGVFMQWPTQSMIYAHSYDQVRHAFFQPAFCQQPLSFGYSQNH  341



>ref|XP_004167787.1| PREDICTED: uncharacterized protein LOC101224356 [Cucumis sativus]
 gb|KGN59412.1| hypothetical protein Csa_3G817720 [Cucumis sativus]
Length=354

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  S DA Y QW + +MMYAHSY + RH  FQ PF QQPLSFDYSQNH
Sbjct  305  GLNQASRDASYEQWQSAAMMYAHSYNQFRHSAFQAPFCQQPLSFDYSQNH  354



>ref|XP_008443221.1| PREDICTED: R3H domain-containing protein 2-like isoform X2 [Cucumis 
melo]
Length=354

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  S DA Y QW   +MMYAHSY + RH  FQ PF QQPLSFDYSQNH
Sbjct  305  GLNQASRDASYEQWQNAAMMYAHSYNQFRHSAFQAPFCQQPLSFDYSQNH  354



>gb|EYU18596.1| hypothetical protein MIMGU_mgv1a009115mg [Erythranthe guttata]
Length=353

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  22   DAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            + +YMQWPTQSMMYA SY++LRH  FQ PF QQPLSFDYSQN+
Sbjct  310  NGLYMQWPTQSMMYAQSYDQLRHAYFQAPFYQQPLSFDYSQNN  352



>ref|XP_003624915.1| R3H domain-containing protein [Medicago truncatula]
 gb|ABN09177.1| Single-stranded nucleic acid binding R3H [Medicago truncatula]
 gb|AES81133.1| single-stranded nucleic acid-binding protein R3H [Medicago truncatula]
Length=353

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+P S D  Y+QWP+ +MMYAHSY++ RH V+Q PF  QPLSFDYSQN+
Sbjct  305  GLNPASGDGAYLQWPSPTMMYAHSYDQFRHAVYQSPFG-QPLSFDYSQNY  353



>ref|XP_006574397.1| PREDICTED: uncharacterized protein LOC100784326 isoform X1 [Glycine 
max]
Length=315

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+    DA Y+QWP+ ++MYAHSY++ R  VFQ PF Q+PLSFDYSQN+
Sbjct  266  GLNQVPRDAAYVQWPSAAVMYAHSYDQFRQAVFQAPFGQRPLSFDYSQNY  315



>ref|XP_003535913.1| PREDICTED: uncharacterized protein LOC100799336 [Glycine max]
 gb|KHN25128.1| R3H domain-containing protein 2 [Glycine soja]
Length=352

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G +  S D  Y+QWP+ +MMYAHSY++ RH VFQ P +Q+PLSFDYSQN+
Sbjct  303  GSNQVSRDGAYVQWPSAAMMYAHSYDQFRHAVFQAPIAQRPLSFDYSQNY  352



>ref|XP_008244779.1| PREDICTED: uncharacterized protein LOC103342896 [Prunus mume]
Length=355

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + T  DA YMQWP+ +MMY+HSY++ R  V Q PF Q PLSFDYSQNH
Sbjct  306  GFNQTYRDATYMQWPSAAMMYSHSYDQFRQAVIQAPFCQHPLSFDYSQNH  355



>ref|XP_007204692.1| hypothetical protein PRUPE_ppa007799mg [Prunus persica]
 gb|EMJ05891.1| hypothetical protein PRUPE_ppa007799mg [Prunus persica]
Length=355

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + T  DA YMQWP+ +MMY+HSY++ R  V Q PF Q PLSFDYSQNH
Sbjct  306  GFNQTYRDATYMQWPSAAMMYSHSYDQFRQAVIQAPFCQHPLSFDYSQNH  355



>ref|XP_004136625.1| PREDICTED: uncharacterized protein LOC101215817 [Cucumis sativus]
Length=401

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  S DA Y QW + +MMYAHSY + RH  FQ PF QQPLSFDYSQNH
Sbjct  352  GLNQASRDASYEQWQSAAMMYAHSYNQFRHSAFQAPFCQQPLSFDYSQNH  401



>ref|XP_002517274.1| r3h domain containing protein, putative [Ricinus communis]
 gb|EEF45067.1| r3h domain containing protein, putative [Ricinus communis]
Length=350

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G +    D  Y+QWP+ +MMY HSYE+ RH VFQ PFSQQPLSF Y+QNH
Sbjct  301  GSNQAPRDTAYVQWPSTAMMYTHSYEQFRHAVFQAPFSQQPLSFGYAQNH  350



>ref|NP_001241328.1| uncharacterized protein LOC100784326 [Glycine max]
 gb|ACU18394.1| unknown [Glycine max]
 gb|KHN21668.1| cAMP-regulated phosphoprotein 21 [Glycine soja]
Length=355

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+    DA Y+QWP+ ++MYAHSY++ R  VFQ PF Q+PLSFDYSQN+
Sbjct  306  GLNQVPRDAAYVQWPSAAVMYAHSYDQFRQAVFQAPFGQRPLSFDYSQNY  355



>gb|EYU20818.1| hypothetical protein MIMGU_mgv1a008714mg [Erythranthe guttata]
Length=364

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYA-HSYEELRHGVFQVPFSQQPLSFDYSQN  147
            GL+ +S DA+Y+QWPTQSMMYA  SY++LRH  FQ P  QQPLSFDYS N
Sbjct  313  GLNHSSRDALYVQWPTQSMMYAAQSYDQLRHAYFQAPTCQQPLSFDYSHN  362



>ref|XP_010931539.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
Length=362

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            G + T+T+ VYMQWP  +MMYA+SYE  RH VFQ PF QQPL F+++QN
Sbjct  313  GCNQTTTEGVYMQWPNPTMMYANSYEHFRHAVFQAPFYQQPLRFEHTQN  361



>ref|XP_006402961.1| hypothetical protein EUTSA_v10006048mg [Eutrema salsugineum]
 gb|ESQ44414.1| hypothetical protein EUTSA_v10006048mg [Eutrema salsugineum]
Length=364

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            LH  STDA+YMQWP  +MMYAHSY++ R+   Q  F QQPLSFDY QN 
Sbjct  316  LHQPSTDAMYMQWPNAAMMYAHSYDQFRNASLQAQFCQQPLSFDYMQNR  364



>gb|KHG23664.1| R3H domain-containing 1 [Gossypium arboreum]
Length=361

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQ-PLSFDYSQN  147
            GL+PTS D  YMQWP+ +MMY+HSY++  H VFQ PF  Q PLS+DYS N
Sbjct  311  GLNPTSRDGAYMQWPSANMMYSHSYDQFMHAVFQAPFVHQPPLSYDYSMN  360



>ref|XP_008786865.1| PREDICTED: uncharacterized protein LOC103705051 [Phoenix dactylifera]
Length=354

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            G + T T+ VYMQWP  +MMYA+SYE  RH VFQVP  QQPLSF+++QN
Sbjct  305  GCNQTITEGVYMQWPNPAMMYANSYEHFRHAVFQVPSYQQPLSFEHTQN  353



>gb|KFK34908.1| hypothetical protein AALP_AA5G209300 [Arabis alpina]
Length=354

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            LH    DA+YMQWP  +MMYAHSYE++R+   Q  FSQQPLSFDY QN 
Sbjct  306  LHQPPRDAMYMQWPNAAMMYAHSYEQVRNASLQAQFSQQPLSFDYMQNR  354



>ref|XP_008359462.1| PREDICTED: R3H domain-containing protein 1-like [Malus domestica]
Length=353

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS DA YMQWP+ SMMYAHSY++ R  V Q PF  QPLSF +SQNH
Sbjct  305  GFNQTSRDATYMQWPSASMMYAHSYDQFRQAVIQAPFCHQPLSF-HSQNH  353



>gb|KJB46182.1| hypothetical protein B456_007G351600 [Gossypium raimondii]
Length=362

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQ-PLSFDYSQN  147
            GL+PTS D  YMQWP+ +MM++HSY++  H VFQ PF  Q PLS+DYS N
Sbjct  312  GLNPTSRDGAYMQWPSANMMFSHSYDQFMHAVFQAPFVHQPPLSYDYSMN  361



>ref|XP_008788551.1| PREDICTED: R3H domain-containing protein 1-like [Phoenix dactylifera]
Length=308

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            G + T+ +AVYMQWP  ++ Y +SYE  RHGVF+ PF QQPLSF+++QN
Sbjct  259  GCNQTTKEAVYMQWPNPAVSYENSYEHFRHGVFEAPFYQQPLSFEHTQN  307



>ref|XP_010909706.1| PREDICTED: uncharacterized protein LOC105035733 [Elaeis guineensis]
Length=361

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            G   T+ + VYMQW + +M+Y +SYE  RHGVFQ PF QQPLSF+++QN
Sbjct  312  GCDQTTKETVYMQWSSPAMIYENSYEHFRHGVFQAPFYQQPLSFEHTQN  360



>ref|XP_009339978.1| PREDICTED: R3H domain-containing protein 2-like [Pyrus x bretschneideri]
Length=353

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            G + TS+DA YMQWP+ SMMYAHSY++ R  V Q PF   PLSF + QNH
Sbjct  305  GFNQTSSDATYMQWPSASMMYAHSYDQFRQAVIQAPFCHHPLSF-HPQNH  353



>ref|XP_002876378.1| hypothetical protein ARALYDRAFT_486108 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52637.1| hypothetical protein ARALYDRAFT_486108 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  13   TSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            ++ DA+YM WP  +MMYAH YE+LR+G  Q  F QQPLSFDY QN 
Sbjct  309  STMDAMYMHWPNAAMMYAHPYEQLRNGSLQAQFVQQPLSFDYMQNR  354



>ref|NP_191227.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
 emb|CAC00731.1| putative protein [Arabidopsis thaliana]
 gb|AAL67112.1| AT3g56680/T8M16_10 [Arabidopsis thaliana]
 gb|AAM51574.1| AT3g56680/T8M16_10 [Arabidopsis thaliana]
 gb|AAM63842.1| unknown [Arabidopsis thaliana]
 gb|AEE79551.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
Length=353

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  13   TSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            T+ DA+YM WP  +MMYAH YE+ R+G  Q  F QQPLSFDY QN 
Sbjct  308  TTMDAMYMHWPNAAMMYAHPYEQFRNGSLQAQFVQQPLSFDYMQNR  353



>ref|XP_008350136.1| PREDICTED: R3H domain-containing protein 1-like [Malus domestica]
Length=352

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query  22   DAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            DA YMQWP+ SMMYAHSY++ R  V Q PF   PLSF +SQNH
Sbjct  311  DATYMQWPSASMMYAHSYDQFRQAVIQAPFCHHPLSF-HSQNH  352



>ref|XP_009386294.1| PREDICTED: uncharacterized protein LOC103973455 [Musa acuminata 
subsp. malaccensis]
Length=360

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            G +  + +AVY+QWP+ +MMY++SYE L H +FQ PF QQ LSF+++QN
Sbjct  311  GCNQNAKNAVYLQWPSPAMMYSNSYEHLGHAMFQAPFYQQHLSFEHTQN  359



>ref|NP_680299.4| hAT family dimerization domain-containing protein [Arabidopsis 
thaliana]
 gb|AED93902.1| hAT family dimerization domain-containing protein [Arabidopsis 
thaliana]
Length=509

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  13   TSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            T+ DA+YM  P  +MMYAH YE+LR+G  Q  F QQPLSFDY +N
Sbjct  445  TTMDAMYMHLPNAAMMYAHPYEQLRNGPLQAQFVQQPLSFDYCRN  489



>ref|XP_010058748.1| PREDICTED: uncharacterized protein LOC104446610, partial [Eucalyptus 
grandis]
Length=33

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  19   TDAVYMQWPTQSMMYAHSYEELRHGVFQVPFS  114
            +DA YMQWP  +MMYAHSY++LRHGVFQV  S
Sbjct  1    SDAGYMQWPIAAMMYAHSYDQLRHGVFQVKIS  32



>gb|KFK42320.1| single-stranded nucleic acid binding r3h protein [Arabis alpina]
Length=351

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 2/52 (4%)
 Frame = +1

Query  1    GLHPTSTDA-VYMQWPTQS-MMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  S DA +YMQWP  + MMY HSYE  R+  FQ  F  QPLSFDY QN 
Sbjct  300  GLNQPSRDAAMYMQWPNAAAMMYTHSYEHFRNAPFQAQFCPQPLSFDYMQNR  351



>ref|XP_010069795.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104456640 
[Eucalyptus grandis]
Length=1324

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQV  105
            GL+  ++DA YMQWPT +MMYA+SY++LRHGVFQ+
Sbjct  219  GLNQNTSDAGYMQWPTAAMMYAYSYDQLRHGVFQI  253



>ref|XP_009410414.1| PREDICTED: R3H domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=339

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            G    + DA  MQWP  +MMYA+SYE  R   FQ P  QQPLSF++ +N
Sbjct  290  GYDQNTKDAFCMQWPNPAMMYAYSYEHFRQAKFQAPLYQQPLSFEHPRN  338



>ref|XP_009139085.1| PREDICTED: protein encore [Brassica rapa]
Length=338

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 5/49 (10%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            +HP   DA+YMQ P   MMYAHSYE+LR+   Q  F QQPLSF+Y QN 
Sbjct  295  VHPG--DAMYMQVP---MMYAHSYEQLRNASLQAQFCQQPLSFEYMQNR  338



>emb|CDX76005.1| BnaA04g02690D [Brassica napus]
Length=338

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 5/49 (10%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            +HP   DA+YMQ P   MMYAHSYE+LR+   Q  F QQPLSF+Y QN 
Sbjct  295  VHPG--DAMYMQVP---MMYAHSYEQLRNASLQAQFCQQPLSFEYMQNR  338



>emb|CDY61685.1| BnaCnng38270D [Brassica napus]
Length=341

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 5/49 (10%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            +HP   DA+YMQ P   MMYAHSYE+LR+   Q  F QQPLSF+Y QN 
Sbjct  298  VHPG--DAMYMQVP---MMYAHSYEQLRNASLQAQFCQQPLSFEYMQNR  341



>ref|XP_010543660.1| PREDICTED: R3H domain-containing protein 2-like [Tarenaya hassleriana]
Length=328

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  16   STDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            +  A+  QWP  +MMYAHSYE+ R   FQ  F QQPLSF+Y QN 
Sbjct  284  NNTAIQTQWPNAAMMYAHSYEQFRQASFQGMFFQQPLSFEYLQNR  328



>ref|XP_010243833.1| PREDICTED: R3H domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=348

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVP--FSQ  117
            GL+ TS D +YMQWP+ +MMYA SY++ RH VFQ P  FSQ
Sbjct  306  GLNQTSRDPMYMQWPSPAMMYAQSYDQFRHAVFQKPSYFSQ  346



>ref|XP_010427506.1| PREDICTED: R3H domain-containing protein 1-like [Camelina sativa]
Length=361

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPF-SQQPLSFDYSQN  147
            L+  S DA+YMQWP  +M+YAH YE+  +   Q  F SQQP+SFD  QN
Sbjct  312  LNQASRDAMYMQWPNAAMLYAHPYEQFMNASLQAQFCSQQPMSFDDRQN  360



>ref|XP_010504574.1| PREDICTED: R3H domain-containing protein 1-like [Camelina sativa]
Length=360

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPF-SQQPLSFDYSQN  147
            L+  S DA+YMQWP  +M+YAH YE+  +   Q  F SQQP+SFD  QN
Sbjct  311  LNQASRDAMYMQWPNAAMLYAHPYEQFMNASLQAQFCSQQPMSFDDRQN  359



>ref|XP_006292703.1| hypothetical protein CARUB_v10018949mg [Capsella rubella]
 gb|EOA25601.1| hypothetical protein CARUB_v10018949mg [Capsella rubella]
Length=355

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +1

Query  4    LHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPF-SQQPLSFDYSQN  147
            L+  S DA+YMQWP  +M+YAH YE+  +   Q  F SQQP+SFDY +N
Sbjct  306  LNHASRDAMYMQWPNAAMLYAHPYEQFMNASLQPQFCSQQPMSFDYMRN  354



>ref|XP_010558120.1| PREDICTED: uncharacterized protein LOC104826881 [Tarenaya hassleriana]
Length=333

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +1

Query  10   PTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            P      +  WP  +MMYAHSY + R   F+ PF QQPLSF+Y QN 
Sbjct  287  PRGASTHHTPWPNAAMMYAHSYGQFRQTAFRAPFCQQPLSFEYMQNR  333



>ref|XP_010111099.1| R3H domain-containing protein 1 [Morus notabilis]
 gb|EXC30128.1| R3H domain-containing protein 1 [Morus notabilis]
Length=383

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQV  105
            GL+ TS DA YMQW T +MMYAHSYE+ RH  FQV
Sbjct  328  GLNQTSRDAAYMQWSTAAMMYAHSYEQSRHAGFQV  362



>ref|XP_010552904.1| PREDICTED: uncharacterized protein LOC104823164 [Tarenaya hassleriana]
Length=333

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +1

Query  10   PTSTDAVYMQWPTQSMMYAHSYEE-LRHGVFQVPFSQQPLSFDYSQNH  150
            P    A ++QWP  +MMYA SY++   H  F+ PF QQPLSF+Y Q +
Sbjct  285  PMGNSATHIQWPNTAMMYAQSYQQHFGHAAFRAPFCQQPLSFEYLQKN  332



>ref|NP_565947.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
 gb|AAB86456.2| expressed protein [Arabidopsis thaliana]
 gb|AAM14924.1| expressed protein [Arabidopsis thaliana]
 gb|AEC09907.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
Length=351

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 2/52 (4%)
 Frame = +1

Query  1    GLHPTSTDA-VYMQWPTQS-MMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  S DA +YMQWP  + +MY HSY+  R+  FQ  F  QPLSFDY QN 
Sbjct  300  GLNQPSRDAAMYMQWPNAAAVMYTHSYDHFRNSPFQAQFYPQPLSFDYMQNR  351



>gb|AAM64355.1| unknown [Arabidopsis thaliana]
Length=351

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 2/52 (4%)
 Frame = +1

Query  1    GLHPTSTDA-VYMQWPTQS-MMYAHSYEELRHGVFQVPFSQQPLSFDYSQNH  150
            GL+  S DA +YMQWP  + +MY HSY+  R+  FQ  F  QPLSFDY QN 
Sbjct  300  GLNQPSRDAAMYMQWPNAAAVMYTHSYDHFRNSPFQAQFYPQPLSFDYMQNR  351



>gb|KDO53660.1| hypothetical protein CISIN_1g018220mg [Citrus sinensis]
Length=348

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    GLHPTSTDAVYMQWPTQSMMYAHSYEELRHGVFQVPF  111
            G + TS +A YMQWP+ +MMYAHSYE+ R   FQV F
Sbjct  306  GPNQTSVEAAYMQWPSAAMMYAHSYEQFRQAAFQVFF  342



>ref|XP_002879898.1| hypothetical protein ARALYDRAFT_483163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56157.1| hypothetical protein ARALYDRAFT_483163 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +1

Query  1    GLHPTSTDA-VYMQWPTQS-MMYAHSYEELRHGVFQVPFSQQPLSFDYSQN  147
            GL+  S DA +YMQWP  + +MY HSY+  R+  FQ  F  QPLSF+Y QN
Sbjct  304  GLNQPSMDAAMYMQWPNAAAVMYTHSYDHFRNAPFQAQFYPQPLSFEYMQN  354



>ref|XP_006294497.1| hypothetical protein CARUB_v10023526mg [Capsella rubella]
 gb|EOA27395.1| hypothetical protein CARUB_v10023526mg [Capsella rubella]
Length=352

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +1

Query  25   AVYMQWPTQS-MMYAHSYEELRHGVFQVPFSQQPLSFDYSQ  144
            A+YMQWP  + +MY HSYE  R+  FQ  F  QPLSFDY Q
Sbjct  310  AMYMQWPNAAAVMYTHSYEHFRNSPFQGQFYPQPLSFDYMQ  350



>ref|XP_010517577.1| PREDICTED: uncharacterized protein LOC104793004 [Camelina sativa]
Length=358

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 4/54 (7%)
 Frame = +1

Query  1    GLH-PTSTDAVYMQWPTQS-MMYAHSYEELRHGVFQVPF--SQQPLSFDYSQNH  150
            GL+ P+   A+YMQWP  + +MY HSYE  R+  FQ  F    QPLSFDY QN 
Sbjct  305  GLNQPSMNAAMYMQWPNAAAVMYTHSYEHFRNAPFQGQFYPHPQPLSFDYMQNR  358



>ref|XP_010505858.1| PREDICTED: uncharacterized protein LOC104782584 [Camelina sativa]
Length=359

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 4/54 (7%)
 Frame = +1

Query  1    GLH-PTSTDAVYMQWPTQS-MMYAHSYEELRHGVFQVPF--SQQPLSFDYSQNH  150
            GL+ P+   A+YMQWP  + +MY HSYE  R+  FQ  F    QPLSFDY QN 
Sbjct  306  GLNQPSMNAAMYMQWPNAAAVMYTHSYEHFRNAPFQGQFYPHPQPLSFDYMQNR  359



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559392177135