BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016D05 644 bp,

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003064993.1|  predicted protein                                  194   5e-59   Micromonas pusilla CCMP1545
gb|ELU18102.1|  hypothetical protein CAPTEDRAFT_143611                  172   1e-51   Capitella teleta
ref|XP_004516262.1|  PREDICTED: uncharacterized protein LOC101490042    180   2e-51   
gb|KEH16993.1|  senescence-associated protein                           182   2e-50   Medicago truncatula
gb|KEH17027.1|  senescence-associated protein                           181   5e-50   Medicago truncatula
gb|KEH17020.1|  senescence-associated protein                           182   6e-50   Medicago truncatula
gb|KEH16994.1|  senescence-associated protein                           183   8e-50   Medicago truncatula
gb|KEH17024.1|  senescence-associated protein                           181   2e-49   Medicago truncatula
ref|XP_010046011.1|  PREDICTED: uncharacterized protein LOC104434852    176   4e-49   Eucalyptus grandis [rose gum]
gb|KEH17022.1|  senescence-associated protein, putative                 182   9e-49   Medicago truncatula
gb|KEH16988.1|  senescence-associated protein, putative                 179   1e-48   Medicago truncatula
gb|KEH16991.1|  senescence-associated protein                           182   1e-48   Medicago truncatula
gb|KEH17031.1|  hypothetical protein MTR_0052s0170                      177   2e-48   Medicago truncatula
ref|XP_003614380.1|  Cytochrome P450 likeTBP                            177   2e-48   
ref|XP_009341691.1|  PREDICTED: uncharacterized protein LOC103933723    173   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_003614386.1|  hypothetical protein MTR_5g051030                  178   3e-48   
ref|XP_003614400.1|  Cytochrome P450 likeTBP                            177   3e-48   
ref|XP_003614383.1|  hypothetical protein MTR_5g051000                  179   1e-47   
ref|XP_003614395.1|  hypothetical protein MTR_5g051140                  178   1e-47   
ref|XP_003614384.1|  hypothetical protein MTR_5g051010                  177   3e-47   
ref|XP_003614396.1|  hypothetical protein MTR_5g051150                  177   7e-47   
ref|XP_003614382.1|  hypothetical protein MTR_5g050970                  176   7e-47   
ref|XP_003614394.1|  hypothetical protein MTR_5g051130                  176   1e-46   
gb|KEH17021.1|  senescence-associated protein                           171   5e-45   Medicago truncatula
emb|CDX99709.1|  BnaC02g36110D                                          158   1e-44   Brassica napus [oilseed rape]
ref|XP_002489151.1|  hypothetical protein SORBIDRAFT_0016s002040        149   2e-42   Sorghum bicolor [broomcorn]
gb|KEH17029.1|  senescence-associated protein                           159   8e-42   Medicago truncatula
ref|XP_003638451.1|  hypothetical protein MTR_132s0010                  148   5e-37   
ref|XP_003614398.1|  hypothetical protein MTR_5g051170                  144   6e-36   
ref|XP_006363638.1|  PREDICTED: uncharacterized protein LOC102601005    136   7e-36   
ref|XP_003614388.1|  hypothetical protein MTR_5g051050                  129   3e-35   
ref|XP_003627732.1|  ATP synthase subunit beta                        99.4    2e-31   
ref|XP_008348155.1|  PREDICTED: lysosomal alpha-mannosidase-like        128   3e-31   
ref|XP_002488976.1|  hypothetical protein SORBIDRAFT_0890s002010        119   3e-31   Sorghum bicolor [broomcorn]
emb|CAN61119.1|  hypothetical protein VITISV_022570                     122   5e-31   Vitis vinifera
ref|XP_003614393.1|  hypothetical protein MTR_5g051120                  122   3e-29   
ref|XP_002488914.1|  hypothetical protein SORBIDRAFT_1962s002010        108   1e-26   Sorghum bicolor [broomcorn]
ref|XP_002884233.1|  expressed protein                                  104   1e-25   Arabidopsis lyrata subsp. lyrata
pir||T02955  probable cytochrome P450 monooxygenase - maize (frag...    102   7e-25
dbj|BAA10929.1|  cytochrome P450 like_TBP                             94.4    3e-24   Nicotiana tabacum [American tobacco]
ref|XP_003614385.1|  RRNA intron-encoded homing endonuclease            108   2e-23   
gb|KEH16996.1|  senescence-associated protein, putative               88.2    2e-22   Medicago truncatula
gb|EEC70731.1|  hypothetical protein OsI_02133                        96.3    2e-22   Oryza sativa Indica Group [Indian rice]
emb|CDY19789.1|  BnaA09g04420D                                          101   6e-22   Brassica napus [oilseed rape]
emb|CDY55729.1|  BnaC08g46150D                                          101   1e-21   Brassica napus [oilseed rape]
ref|XP_002489153.1|  hypothetical protein SORBIDRAFT_0016s002480      94.4    2e-21   Sorghum bicolor [broomcorn]
ref|XP_006279316.1|  hypothetical protein CARUB_v10012757mg           95.9    2e-21   Capsella rubella
ref|XP_002450730.1|  hypothetical protein SORBIDRAFT_05g016465        91.3    3e-21   Sorghum bicolor [broomcorn]
gb|KDP37477.1|  hypothetical protein JCGZ_06917                       97.4    3e-21   Jatropha curcas
emb|CDY43697.1|  BnaC08g47040D                                        97.8    3e-21   Brassica napus [oilseed rape]
gb|KJB11774.1|  hypothetical protein B456_001G276600                  66.6    3e-20   Gossypium raimondii
ref|XP_006286106.1|  hypothetical protein CARUB_v10007654mg           66.2    5e-20   Capsella rubella
ref|XP_002488971.1|  hypothetical protein SORBIDRAFT_1020s002020      89.0    1e-19   Sorghum bicolor [broomcorn]
ref|XP_001624693.1|  predicted protein                                90.1    3e-19   Nematostella vectensis
ref|WP_040007287.1|  hypothetical protein                             86.7    2e-18   Elizabethkingia anophelis
gb|EHK21457.1|  hypothetical protein TRIVIDRAFT_53758                 86.3    3e-18   Trichoderma virens Gv29-8
ref|XP_002488965.1|  hypothetical protein SORBIDRAFT_1138s002030      60.8    5e-18   Sorghum bicolor [broomcorn]
gb|KDP27127.1|  hypothetical protein JCGZ_22036                       86.3    6e-18   Jatropha curcas
ref|XP_002449481.1|  hypothetical protein SORBIDRAFT_05g016420        82.4    4e-17   Sorghum bicolor [broomcorn]
ref|XP_006279318.1|  hypothetical protein CARUB_v10012759mg           66.2    6e-17   Capsella rubella
gb|KGN59815.1|  hypothetical protein Csa_3G848246                     81.6    2e-16   Cucumis sativus [cucumbers]
gb|ACG27180.1|  hypothetical protein                                  60.8    2e-16   Zea mays [maize]
ref|XP_005842765.1|  hypothetical protein CHLNCDRAFT_28884            82.4    2e-16   Chlorella variabilis
ref|XP_007297914.1|  hypothetical protein MBM_10038                   84.3    4e-16   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KDO39226.1|  hypothetical protein CISIN_1g0366582mg                82.0    1e-15   Citrus sinensis [apfelsine]
ref|XP_003379707.1|  hypothetical protein Tsp_03361                   80.1    1e-15   Trichinella spiralis
gb|AAR25996.1|  cytochrome P450 monooxygenase                         78.2    2e-15   Pyrus communis
gb|EFX60441.1|  hypothetical protein DAPPUDRAFT_124183                79.7    2e-15   Daphnia pulex
gb|KDR65248.1|  hypothetical protein GALMADRAFT_82091                 77.8    4e-15   Galerina marginata CBS 339.88
gb|KFM81627.1|  hypothetical protein X975_03524                       77.4    6e-15   Stegodyphus mimosarum
emb|CDW75723.1|  UNKNOWN                                              81.6    6e-15   Stylonychia lemnae
gb|EMT15825.1|  hypothetical protein F775_00529                       78.2    7e-15   Aegilops tauschii
ref|XP_008045834.1|  hypothetical protein TRAVEDRAFT_137643           75.9    1e-14   Trametes versicolor FP-101664 SS1
gb|EMD30280.1|  hypothetical protein CERSUDRAFT_146047                76.3    2e-14   Gelatoporia subvermispora B
ref|XP_001785944.1|  predicted protein                                76.3    2e-14   Physcomitrella patens
ref|XP_003366344.1|  conserved hypothetical protein                   75.1    3e-14   Trichinella spiralis
ref|XP_001621925.1|  hypothetical protein NEMVEDRAFT_v1g143181        75.9    3e-14   Nematostella vectensis
ref|XP_003367113.1|  conserved hypothetical protein                   77.0    4e-14   Trichinella spiralis
ref|XP_001626156.1|  predicted protein                                73.9    5e-14   Nematostella vectensis
gb|EMT25146.1|  hypothetical protein F775_27689                       77.8    5e-14   Aegilops tauschii
emb|CDW60529.1|  hypothetical protein TTRE_0000891601                 77.4    9e-14   Trichuris trichiura
ref|XP_002484510.1|  hypothetical protein TSTA_040370                 53.9    1e-13   Talaromyces stipitatus ATCC 10500
emb|CDW61027.1|  hypothetical protein TTRE_0000944101                 77.4    1e-13   Trichuris trichiura
emb|CDW60818.1|  hypothetical protein TTRE_0000921701                 77.4    1e-13   Trichuris trichiura
emb|CCD58992.1|  hypothetical protein Smp_183040                      75.9    1e-13   Schistosoma mansoni
ref|XP_003367073.1|  conserved hypothetical protein                   74.3    1e-13   Trichinella spiralis
emb|CDW61211.1|  hypothetical protein TTRE_0000965201                 77.4    2e-13   Trichuris trichiura
emb|CDW61033.1|  hypothetical protein TTRE_0000944801                 77.4    2e-13   Trichuris trichiura
ref|XP_001624699.1|  predicted protein                                73.6    2e-13   Nematostella vectensis
gb|EJY66653.1|  hypothetical protein OXYTRI_13058                     60.8    2e-13   Oxytricha trifallax
gb|EJY65597.1|  hypothetical protein OXYTRI_14248                     60.8    2e-13   Oxytricha trifallax
ref|XP_003370555.1|  conserved hypothetical protein                   75.5    2e-13   Trichinella spiralis
emb|CDW61046.1|  hypothetical protein TTRE_0000946501                 77.0    3e-13   Trichuris trichiura
emb|CDW60983.1|  hypothetical protein TTRE_0000939101                 77.4    4e-13   Trichuris trichiura
ref|XP_003366891.1|  conserved hypothetical protein                   70.9    5e-13   Trichinella spiralis
emb|CDW61241.1|  hypothetical protein TTRE_0000968701                 73.6    6e-13   Trichuris trichiura
gb|KDQ32286.1|  hypothetical protein PLEOSDRAFT_22346                 71.6    8e-13   Pleurotus ostreatus PC15
ref|XP_003370331.1|  conserved hypothetical protein                   70.5    9e-13   Trichinella spiralis
ref|NP_671477.1|  rRNA promoter binding protein                       73.6    2e-12   Rattus norvegicus [brown rat]
ref|XP_003366704.1|  conserved hypothetical protein                   69.7    2e-12   Trichinella spiralis
gb|EXD08168.1|  hypothetical protein J457_4177                        72.4    3e-12   Acinetobacter baumannii 136706
gb|ESA03491.1|  hypothetical protein GLOINDRAFT_67222                 69.7    3e-12   Rhizophagus irregularis DAOM 181602
ref|XP_001891759.1|  alpha-L1 nicotinic acetyl choline receptor       68.9    3e-12   Brugia malayi [agent of lymphatic filariasis]
emb|CDW60997.1|  hypothetical protein TTRE_0000940701                 73.2    4e-12   Trichuris trichiura
ref|XP_008768405.1|  PREDICTED: collagen alpha-1(I) chain-like        74.3    4e-12   
ref|XP_005646644.1|  hypothetical protein COCSUDRAFT_83496            68.6    4e-12   Coccomyxa subellipsoidea C-169
ref|XP_004482538.1|  PREDICTED: uncharacterized protein LOC101444772  72.0    4e-12   
ref|XP_001893546.1|  unspecific monooxygenase                         68.6    5e-12   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003460741.1|  PREDICTED: collagen alpha-1(I) chain-like        73.9    6e-12   
ref|XP_003367080.1|  conserved hypothetical protein                   67.8    6e-12   Trichinella spiralis
ref|XP_003370393.1|  conserved hypothetical protein                   67.8    1e-11   Trichinella spiralis
ref|XP_001897189.1|  rRNA promoter binding protein                    63.2    1e-11   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001891902.1|  rRNA promoter binding protein                    63.2    1e-11   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001892138.1|  rRNA promoter binding protein                    62.8    1e-11   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001619057.1|  hypothetical protein NEMVEDRAFT_v1g152505        68.6    1e-11   Nematostella vectensis
emb|CDY66173.1|  BnaAnng21760D                                        72.8    2e-11   Brassica napus [oilseed rape]
ref|XP_008251357.1|  PREDICTED: basic proline-rich protein-like       71.2    2e-11   
ref|XP_001891797.1|  rRNA promoter binding protein                    66.6    4e-11   Brugia malayi [agent of lymphatic filariasis]
gb|KFM67743.1|  hypothetical protein X975_21862                       67.4    4e-11   Stegodyphus mimosarum
gb|EUB55374.1|  rRNA promoter binding protein                         71.6    5e-11   Echinococcus granulosus
ref|XP_004933958.1|  PREDICTED: uncharacterized protein LOC101742759  68.2    5e-11   
gb|KIK74323.1|  hypothetical protein PAXRUDRAFT_176054                65.1    7e-11   Paxillus rubicundulus Ve08.2h10
emb|CDW61222.1|  hypothetical protein TTRE_0000966501                 70.5    8e-11   Trichuris trichiura
gb|EMD30503.1|  hypothetical protein CERSUDRAFT_163809                65.9    8e-11   Gelatoporia subvermispora B
ref|XP_011402156.1|  hypothetical protein F751_0061                   64.7    1e-10   Auxenochlorella protothecoides
ref|XP_007154095.1|  hypothetical protein PHAVU_003G090100g           65.9    1e-10   Phaseolus vulgaris [French bean]
gb|EFX59851.1|  hypothetical protein DAPPUDRAFT_73479                 64.7    2e-10   Daphnia pulex
gb|EJW71374.1|  hypothetical protein WUBG_17720                       63.9    2e-10   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|EGZ74207.1|  hypothetical protein NEUTE2DRAFT_76231                62.8    4e-10   Neurospora tetrasperma FGSC 2509
ref|XP_001640372.1|  predicted protein                                63.9    5e-10   Nematostella vectensis
ref|XP_004210189.1|  PREDICTED: uncharacterized protein LOC101240867  62.8    5e-10   
gb|EFX59870.1|  hypothetical protein DAPPUDRAFT_73464                 63.2    5e-10   Daphnia pulex
ref|XP_011065976.1|  PREDICTED: uncharacterized protein LOC105153053  65.1    6e-10   Acromyrmex echinatior
gb|EFN65035.1|  hypothetical protein EAG_01178                        66.6    7e-10   Camponotus floridanus
gb|EFN71375.1|  hypothetical protein EAG_03557                        66.6    7e-10   Camponotus floridanus
ref|XP_003367168.1|  conserved hypothetical protein                   63.9    7e-10   Trichinella spiralis
gb|KFK40657.1|  hypothetical protein AALP_AA2G024900                  63.5    1e-09   Arabis alpina [alpine rockcress]
emb|CCD58974.1|  hypothetical protein Smp_177580                      45.8    2e-09   Schistosoma mansoni
gb|ABR25643.1|  unknown                                               60.8    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002488927.1|  hypothetical protein SORBIDRAFT_1610s002010      62.0    2e-09   Sorghum bicolor [broomcorn]
emb|CCD58990.1|  hypothetical protein Smp_184280                      43.5    2e-09   Schistosoma mansoni
ref|XP_009056830.1|  hypothetical protein LOTGIDRAFT_145533           60.5    3e-09   Lottia gigantea
ref|XP_007157256.1|  hypothetical protein PHAVU_002G055400g           60.8    5e-09   Phaseolus vulgaris [French bean]
gb|EFX62988.1|  hypothetical protein DAPPUDRAFT_67487                 61.6    6e-09   Daphnia pulex
emb|CDS30780.1|  expressed protein                                    45.1    8e-09   Hymenolepis microstoma
emb|CCD58314.1|  unnamed protein product                              42.4    1e-08   Schistosoma mansoni
gb|KDO43533.1|  hypothetical protein CISIN_1g045002mg                 60.5    2e-08   Citrus sinensis [apfelsine]
ref|XP_003850790.1|  hypothetical protein MYCGRDRAFT_30868            58.2    2e-08   Zymoseptoria tritici IPO323
ref|XP_002959387.1|  hypothetical protein VOLCADRAFT_84876            57.8    4e-08   Volvox carteri f. nagariensis
ref|XP_002954151.1|  hypothetical protein VOLCADRAFT_64350            57.8    5e-08   Volvox carteri f. nagariensis
dbj|GAA96382.1|  hypothetical protein E5Q_03049                       61.2    6e-08   Mixia osmundae IAM 14324
ref|XP_004213354.1|  PREDICTED: uncharacterized protein LOC101237314  57.0    6e-08   
gb|KEI36131.1|  hypothetical protein L969DRAFT_613963                 61.2    6e-08   Mixia osmundae IAM 14324
ref|XP_006678622.1|  hypothetical protein BATDEDRAFT_88304            58.2    7e-08   Batrachochytrium dendrobatidis JAM81
ref|XP_002068663.1|  GK12697                                          59.3    7e-08   
ref|XP_002449486.1|  hypothetical protein SORBIDRAFT_05g016472        55.8    1e-07   Sorghum bicolor [broomcorn]
gb|EMF07896.1|  hypothetical protein SEPMUDRAFT_11882                 55.5    2e-07   Sphaerulina musiva SO2202
ref|XP_002488908.1|  hypothetical protein SORBIDRAFT_2026s002010      55.5    2e-07   Sorghum bicolor [broomcorn]
ref|XP_007682034.1|  hypothetical protein BAUCODRAFT_127550           56.2    2e-07   Baudoinia panamericana UAMH 10762
ref|XP_006301481.1|  hypothetical protein CARUB_v10021904mg           55.5    3e-07   Capsella rubella
emb|CDI96790.1|  rRNA promoter binding protein                        43.5    4e-07   
ref|XP_002169999.2|  PREDICTED: uncharacterized protein LOC100210481  55.5    7e-07   
ref|XP_010835501.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  57.0    9e-07   Bison bison bison
gb|EHK22827.1|  hypothetical protein TRIVIDRAFT_29449                 54.3    1e-06   Trichoderma virens Gv29-8
emb|CDI99531.1|  rRNA promoter binding protein                        42.4    2e-06   
gb|KFD59988.1|  LOW QUALITY PROTEIN: hypothetical protein M514_27836  50.8    2e-06   Trichuris suis
ref|XP_005706714.1|  rRNA promoter binding protein                    52.8    4e-06   Galdieria sulphuraria
ref|XP_007417427.1|  hypothetical protein MELLADRAFT_94724            52.0    6e-06   Melampsora larici-populina 98AG31
ref|XP_004213260.1|  PREDICTED: uncharacterized protein LOC100200968  52.0    1e-05   
gb|EYC33859.1|  hypothetical protein Y032_0001g130                    51.2    1e-05   Ancylostoma ceylanicum
gb|ELR45475.1|  hypothetical protein M91_21675                        54.3    1e-05   Bos mutus
ref|XP_007335730.1|  hypothetical protein AGABI1DRAFT_49526           50.4    1e-05   Agaricus bisporus var. burnettii JB137-S8
emb|CDS21134.1|  rRNA promoter binding protein                        40.0    1e-05   Echinococcus granulosus
ref|XP_001618573.1|  hypothetical protein NEMVEDRAFT_v1g77308         49.3    4e-05   Nematostella vectensis
gb|EJS85218.1|  hypothetical protein AAUPMB_20797                     48.9    8e-05   Pasteurella multocida subsp. multocida str. Anand1_buffalo
ref|XP_001869359.1|  conserved hypothetical protein                   51.6    9e-05   Culex quinquefasciatus
gb|EJS83295.1|  hypothetical protein AAUPMC_21151                     48.9    1e-04   Pasteurella multocida subsp. multocida str. Anand1_cattle
ref|XP_002167660.2|  PREDICTED: uncharacterized protein LOC100208907  49.3    1e-04   
ref|XP_002948757.1|  hypothetical protein VOLCADRAFT_58557            48.1    1e-04   Volvox carteri f. nagariensis
ref|XP_007371707.1|  hypothetical protein DICSQDRAFT_150876           47.0    2e-04   Dichomitus squalens LYAD-421 SS1
ref|XP_003190886.1|  hypothetical protein AOR_1_208044                35.4    2e-04   Aspergillus oryzae RIB40
ref|XP_009354582.1|  PREDICTED: uncharacterized protein LOC103945712  36.2    3e-04   Pyrus x bretschneideri [bai li]
ref|WP_035397696.1|  hypothetical protein                             43.9    5e-04   Chlamydia psittaci
ref|XP_007419020.1|  hypothetical protein MELLADRAFT_84525            48.9    9e-04   Melampsora larici-populina 98AG31



>ref|XP_003064993.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH50840.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=152

 Score =   194 bits (492),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/100 (96%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGFGTGTP PSPQSQSFSRSYGSILPTSLAYIVP  RGCSPWRPDAVMSTTGR RHSVLR
Sbjct  53   DGFGTGTPEPSPQSQSFSRSYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGRERHSVLR  112

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR  195
            IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR
Sbjct  113  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR  152



>gb|ELU18102.1| hypothetical protein CAPTEDRAFT_143611, partial [Capitella teleta]
Length=89

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = -3

Query  461  PQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGH  282
            PQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGH
Sbjct  1    PQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGH  60

Query  281  HATCGALPAAGPYLRLSRFQGGQAVKQKR  195
            HATCGALPAAGPYLRLSRFQGGQAVKQKR
Sbjct  61   HATCGALPAAGPYLRLSRFQGGQAVKQKR  89



>ref|XP_004516262.1| PREDICTED: uncharacterized protein LOC101490042, partial [Cicer 
arietinum]
Length=348

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGFGTGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  15   DGFGTGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  74

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ
Sbjct  75   IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQ  108



>gb|KEH16993.1| senescence-associated protein [Medicago truncatula]
Length=574

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  191  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  250

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  251  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  286



>gb|KEH17027.1| senescence-associated protein [Medicago truncatula]
Length=545

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVL+
Sbjct  191  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLQ  250

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  251  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  286



>gb|KEH17020.1| senescence-associated protein [Medicago truncatula]
Length=621

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  191  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  250

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  251  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  286



>gb|KEH16994.1| senescence-associated protein [Medicago truncatula]
Length=881

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  191  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  250

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  251  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  286



>gb|KEH17024.1| senescence-associated protein [Medicago truncatula]
Length=691

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            +GF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  191  NGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  250

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  251  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  286



>ref|XP_010046011.1| PREDICTED: uncharacterized protein LOC104434852 [Eucalyptus grandis]
Length=435

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGFG  TPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTGRGRHSVL+
Sbjct  157  DGFGIRTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGRGRHSVLQ  216

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR  195
            IFKGRRGRTGHHATCGALPAAGPYLRLSRFQG   + Q +
Sbjct  217  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGACYIPQSQ  256



>gb|KEH17022.1| senescence-associated protein, putative [Medicago truncatula]
Length=1550

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494   DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
             DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  1003  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  1062

Query  314   IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
             IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  1063  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  1098


 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            +GF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  191  NGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  250

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  251  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  286



>gb|KEH16988.1| senescence-associated protein, putative [Medicago truncatula]
Length=755

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  332  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  391

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAG YLRLSRFQGGQA+
Sbjct  392  IFKGRQGRTGHHATCGALPAAGTYLRLSRFQGGQAI  427



>gb|KEH16991.1| senescence-associated protein [Medicago truncatula]
Length=1771

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  191  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  250

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  251  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  286


 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  494   DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
             DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  1224  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  1283

Query  314   IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
             IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQA+
Sbjct  1284  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQAI  1319



>gb|KEH17031.1| hypothetical protein MTR_0052s0170 [Medicago truncatula]
Length=628

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  74   DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  133

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRF GGQ
Sbjct  134  IFKGRQGRTGHHATCGALPAAGPYLRLSRFHGGQ  167



>ref|XP_003614380.1| Cytochrome P450 likeTBP [Medicago truncatula]
 gb|KEH16986.1| hypothetical protein MTR_0055s0030 [Medicago truncatula]
Length=593

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  20   DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  79

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRF GGQ
Sbjct  80   IFKGRQGRTGHHATCGALPAAGPYLRLSRFHGGQ  113



>ref|XP_009341691.1| PREDICTED: uncharacterized protein LOC103933723 [Pyrus x bretschneideri]
Length=368

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF  GTPVP PQSQSFSRSYGSILPTSLAYIVP  RGCSPWRPDAVMSTTGR R+SVLR
Sbjct  175  DGFQAGTPVPIPQSQSFSRSYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGRERYSVLR  234

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVK  204
            IFKGRRGRTGH ATCGALPAAGPYLRLSRFQGGQ + 
Sbjct  235  IFKGRRGRTGHRATCGALPAAGPYLRLSRFQGGQHIN  271



>ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago truncatula]
Length=795

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  241  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  300

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ
Sbjct  301  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQ  334



>ref|XP_003614400.1| Cytochrome P450 likeTBP [Medicago truncatula]
Length=656

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  74   DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  133

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRF GGQ
Sbjct  134  IFKGRQGRTGHHATCGALPAAGPYLRLSRFHGGQ  167



>ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula]
Length=1735

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  879  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  938

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ
Sbjct  939  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQ  972



>ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago truncatula]
Length=1186

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  274  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  333

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQA  210
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ 
Sbjct  334  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQC  368



>ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago truncatula]
Length=1153

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  368  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  427

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ
Sbjct  428  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQ  461


 Score =   176 bits (446),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVL+
Sbjct  599  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLQ  658

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ
Sbjct  659  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQ  692



>ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago truncatula]
Length=2133

 Score =   177 bits (449),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  494   DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
             DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVL+
Sbjct  1623  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLQ  1682

Query  314   IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
             IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ
Sbjct  1683  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQ  1716


 Score =   177 bits (448),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            +GF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  672  NGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  731

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAGPYLRLSRFQGGQ
Sbjct  732  IFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGQ  765


 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  207  NSLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSPR  374
            N LPTLETAQPEVGSSGWKST RRVVSGAP AALENPEDRVPS PGRTHNR + PR
Sbjct  252  NPLPTLETAQPEVGSSGWKSTARRVVSGAPLAALENPEDRVPSMPGRTHNRSQMPR  307



>ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago truncatula]
Length=1065

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  370  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  429

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAG YLRLSRFQGGQ
Sbjct  430  IFKGRQGRTGHHATCGALPAAGTYLRLSRFQGGQ  463



>ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula]
Length=1337

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  285  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  344

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQ  213
            IFKGR+GRTGHHATCGALPAAG YLRLSRFQGGQ
Sbjct  345  IFKGRQGRTGHHATCGALPAAGTYLRLSRFQGGQ  378



>gb|KEH17021.1| senescence-associated protein [Medicago truncatula]
Length=1097

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  195  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  254

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQ  222
            IFKGR+GRTGHHATCGALPAAG YLRLSRFQ
Sbjct  255  IFKGRQGRTGHHATCGALPAAGTYLRLSRFQ  285



>emb|CDX99709.1| BnaC02g36110D [Brassica napus]
Length=199

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGFGTGTP PSPQSQSFSRSYGSILPTSLAYIVPL RGCSPWRPDAVMS TG  RHSVLR
Sbjct  32   DGFGTGTPEPSPQSQSFSRSYGSILPTSLAYIVPLTRGCSPWRPDAVMSMTGCERHSVLR  91

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLSRFQG  219
            IFKGRR  T HH T GALPAAGPYLRLSRFQ 
Sbjct  92   IFKGRRECTRHHMTRGALPAAGPYLRLSRFQA  123



>ref|XP_002489151.1| hypothetical protein SORBIDRAFT_0016s002040 [Sorghum bicolor]
 gb|EES20331.1| hypothetical protein SORBIDRAFT_0016s002040 [Sorghum bicolor]
Length=79

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -3

Query  431  GSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAA  252
            GS+LPTSLAYIVPLARGCSPWRPDAVMSTTGRGR+SVLRIFKGRRGRTGH ATCGALP A
Sbjct  1    GSVLPTSLAYIVPLARGCSPWRPDAVMSTTGRGRYSVLRIFKGRRGRTGHRATCGALPTA  60

Query  251  GPYLRLSRFQGGQAVKQKR  195
            GPYLRL+RFQG QAVKQKR
Sbjct  61   GPYLRLNRFQGWQAVKQKR  79



>gb|KEH17029.1| senescence-associated protein [Medicago truncatula]
Length=615

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR+YGSILPTSLAYIVP  RGCSPWRPD VMSTTG GRHSVLR
Sbjct  230  DGFETGTPVPSPQSQSFSRAYGSILPTSLAYIVPSTRGCSPWRPDTVMSTTGHGRHSVLR  289

Query  314  IFKGRRGRTGHHATCGALPAAGPYLRLS  231
            IFKGR+G TGHHATCGAL AAGPYLRLS
Sbjct  290  IFKGRQGCTGHHATCGALLAAGPYLRLS  317



>ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula]
Length=1458

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTG GRHSVLR
Sbjct  398  DGFETGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGHGRHSVLR  457

Query  314  IFKGRRGRTGHHATCGALPA  255
            IFKGR+G TGHHATCGALPA
Sbjct  458  IFKGRQGCTGHHATCGALPA  477



>ref|XP_003614398.1| hypothetical protein MTR_5g051170 [Medicago truncatula]
Length=950

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLR  315
            DGF TGTPVPSPQSQSFSR+YGSILPTSLAYIVP  RGCSPWRPD VMSTTG GRHSVLR
Sbjct  268  DGFETGTPVPSPQSQSFSRAYGSILPTSLAYIVPSTRGCSPWRPDTVMSTTGHGRHSVLR  327

Query  314  IFKGRRGRTGHHATCGALPA  255
            IFKGR+G TGHHATCGAL A
Sbjct  328  IFKGRQGCTGHHATCGALLA  347



>ref|XP_006363638.1| PREDICTED: uncharacterized protein LOC102601005 [Solanum tuberosum]
Length=212

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 90/137 (66%), Gaps = 17/137 (12%)
 Frame = +3

Query  192  LSFLFNSLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSP  371
            LSFLFNSLPTLE+AQPEVGSSGWKST RRVVSGA PAALENPEDR+PST       +   
Sbjct  35   LSFLFNSLPTLESAQPEVGSSGWKSTARRVVSGALPAALENPEDRMPSTLW----SMEQC  90

Query  372  R*TASGQW-NNVGKGSRQNGSVTSGKGLALRAGHGGPSPEPVGCSADCSSCYRGESGSPR  548
            R   S +W  N GK   + GS    +G   R             S DCSSC RGESGSPR
Sbjct  91   RQGKSAKWIRNFGK---RIGSEGWARGSQSRTRR---------LSVDCSSCSRGESGSPR  138

Query  549  AGRGTDWERLFRGPSPG  599
            AGRGTDWER  RGPSPG
Sbjct  139  AGRGTDWERFLRGPSPG  155



>ref|XP_003614388.1| hypothetical protein MTR_5g051050, partial [Medicago truncatula]
Length=596

 Score =   129 bits (323),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 77/128 (60%), Gaps = 31/128 (24%)
 Frame = -3

Query  386  RGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            RGCSPWRPDAVMSTTG GRHSVLRIFKGR+GRTGHHATCGALPAAGPYLRLSRFQGG   
Sbjct  402  RGCSPWRPDAVMSTTGHGRHSVLRIFKGRQGRTGHHATCGALPAAGPYLRLSRFQGGNFN  461

Query  206  KQKR*LFprppptspesltlpstatSrfrnfnpipfrrtRKTRCLSGFPRPLGSTNPCAS  27
                 ++         S                               P PLGSTNPCA 
Sbjct  462  PIPLSVYALRGAIRRAS-------------------------------PGPLGSTNPCAR  490

Query  26   AVHMEPFP  3
            AVHMEPFP
Sbjct  491  AVHMEPFP  498


 Score = 46.6 bits (109),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  598  PGEGPRKSRSQSVPRPARGDPLSPR*QLEQSAE  500
            PG+  ++SRSQSVPRPAR DPLSPR QL+QSA 
Sbjct  349  PGKRTKRSRSQSVPRPARVDPLSPREQLKQSAN  381



>ref|XP_003627732.1| ATP synthase subunit beta [Medicago truncatula]
Length=1098

 Score = 99.4 bits (246),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  476  TPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVL  318
            TPVPSPQSQSFSR YGSILPTSLAYIVP  RGCSPWRPDAVMSTTGRGRHS+ 
Sbjct  587  TPVPSPQSQSFSRGYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGRGRHSLF  639


 Score = 63.5 bits (153),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  607  CSTPGEGPRKSRSQSVPRPARGDPLSPR*QLEQSAE  500
            CSTPGEGPR SRSQSVPRPARGDPLSPR QLEQS +
Sbjct  544  CSTPGEGPRGSRSQSVPRPARGDPLSPREQLEQSTD  579



>ref|XP_008348155.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=468

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 86/141 (61%), Gaps = 20/141 (14%)
 Frame = +3

Query  192  LSFLFNSLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSP  371
            L    N    LETAQPEVGSSGWKST RR VSGAPPAALENPEDRVP  PGRTHNRIR  
Sbjct  308  LIHYVNKPAXLETAQPEVGSSGWKSTARRAVSGAPPAALENPEDRVPFAPGRTHNRIRQG  367

Query  372  R*TASGQW-NNVGK--GSRQNGSVTSGKGLALRAGHGGPSPEPVGCSADCSSCYRGESGS  542
            +   S +W  N GK  GS +                 G  P     SA+CSSC RGESG 
Sbjct  368  K---SAKWIRNFGKRIGSEERAR--------------GSXPGTRRLSANCSSCSRGESGP  410

Query  543  PRAGRGTDWERLFRGPSPGVE  605
            PRAGRG D ER  RGPSPG E
Sbjct  411  PRAGRGKDRERSPRGPSPGSE  431



>ref|XP_002488976.1| hypothetical protein SORBIDRAFT_0890s002010 [Sorghum bicolor]
 gb|EES20560.1| hypothetical protein SORBIDRAFT_0890s002010 [Sorghum bicolor]
Length=63

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  383  GCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVK  204
            GCSPWRPDAVMSTTGRGR+SVLRIFKGRRGRTGH ATCGALP AGPYLRL+RFQG QAVK
Sbjct  1    GCSPWRPDAVMSTTGRGRYSVLRIFKGRRGRTGHRATCGALPTAGPYLRLNRFQGWQAVK  60

Query  203  QKR  195
            QKR
Sbjct  61   QKR  63



>emb|CAN61119.1| hypothetical protein VITISV_022570 [Vitis vinifera]
Length=157

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 71/103 (69%), Gaps = 11/103 (11%)
 Frame = +3

Query  192  LSFLFNSLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSP  371
            + F  NS PTLETAQ +VG S WKS  RRVVS AP    ENPEDRVP TPGRT+NRIRSP
Sbjct  17   VIFSVNSPPTLETAQSKVGFSVWKSNVRRVVSDAPSTTPENPEDRVPPTPGRTYNRIRSP  76

Query  372  R*TASGQWNNVGKGSRQNGSVTSGKGLALRAGHGGPSPEPVGC  500
                        K SRQNG VTSGKG  LRAGHGGPSPEPV C
Sbjct  77   -----------SKESRQNGFVTSGKGFTLRAGHGGPSPEPVDC  108



>ref|XP_003614393.1| hypothetical protein MTR_5g051120 [Medicago truncatula]
Length=385

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 82/132 (62%), Gaps = 20/132 (15%)
 Frame = +3

Query  207  NSLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSPR*TAS  386
            N LPTLETAQPEVGSSGWKST RRVVSGAP AALENPEDRVPS PGRTHNR        S
Sbjct  255  NPLPTLETAQPEVGSSGWKSTARRVVSGAPLAALENPEDRVPSMPGRTHNR-------KS  307

Query  387  GQW-NNVGKGSRQNGSVTSGKGLALRAGHGGPSPEPVGCSADCSSCYRGESGSPRAGRGT  563
             +W  N+GK   + GS    +G   R              ADC SC RGESG  RAGRGT
Sbjct  308  AKWIRNLGK---RIGSEGWARGSQFRTRR---------LLADCLSCSRGESGLTRAGRGT  355

Query  564  DWERLFRGPSPG  599
            DWER      PG
Sbjct  356  DWERDLLVLFPG  367



>ref|XP_002488914.1| hypothetical protein SORBIDRAFT_1962s002010 [Sorghum bicolor]
 gb|EES20364.1| hypothetical protein SORBIDRAFT_1962s002010 [Sorghum bicolor]
Length=77

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  192  LSFLFNSLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSP  371
            +SFL N LPTLE+ QPEVGSSG KST RR VSGAPPAALENPEDRVPSTPGRTHNRIRSP
Sbjct  17   VSFLLNGLPTLESVQPEVGSSGRKSTARRAVSGAPPAALENPEDRVPSTPGRTHNRIRSP  76

Query  372  R  374
            R
Sbjct  77   R  77



>ref|XP_002884233.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002884234.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002884238.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002886323.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002886324.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002886325.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002886326.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60492.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60493.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60497.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62582.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62583.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62584.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62585.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
Length=53

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR  195
            MSTTGR RHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR
Sbjct  1    MSTTGRERHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR  53



>pir||T02955 probable cytochrome P450 monooxygenase - maize (fragment)
Length=270

 Score =   102 bits (255),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGR  336
            DGFG GTP P+PQSQSFSRSYGS+LPTSLAYIVPLARGCSPWRPDAVMSTTG+
Sbjct  214  DGFGAGTPEPNPQSQSFSRSYGSVLPTSLAYIVPLARGCSPWRPDAVMSTTGQ  266


 Score = 38.1 bits (87),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = -2

Query  606  VRRPGKAPERAVPSPSPGRH  547
            VRRPGKAPE AVP PSPGRH
Sbjct  177  VRRPGKAPEGAVPGPSPGRH  196



>dbj|BAA10929.1| cytochrome P450 like_TBP [Nicotiana tabacum]
Length=530

 Score = 94.4 bits (233),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVM  351
            DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVP  RGCSPWRPDA +
Sbjct  213  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPSTRGCSPWRPDAFV  260


 Score = 44.3 bits (103),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  606  VRRPGKAPERAVPSPSPGRHAAT  538
            VRRPGKAPE  VPSPSPGRHAAT
Sbjct  176  VRRPGKAPEGTVPSPSPGRHAAT  198



>ref|XP_003614385.1| RRNA intron-encoded homing endonuclease [Medicago truncatula]
Length=1330

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 80/136 (59%), Gaps = 21/136 (15%)
 Frame = +3

Query  204  FNSLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSPR*TA  383
            F+ LPTLETAQPEVGSSGWKST RRVVSGAP AALENPEDRVPS        +   R   
Sbjct  4    FDILPTLETAQPEVGSSGWKSTARRVVSGAPLAALENPEDRVPSILW----SMEQCRQGK  59

Query  384  SGQW-NNVGKGSRQNGSVTSGKGLALRAGHGGPSPEPVGCSADCSSCYRGESGSPRAGRG  560
            S +W  N+GK   + GS    +G   R              ADC SC RGESG  RAGRG
Sbjct  60   SAKWIRNLGK---RIGSEGWARGSQFRTRR---------LLADCLSCSRGESGLTRAGRG  107

Query  561  TDWER----LFRGPSP  596
            TDWER    LF G  P
Sbjct  108  TDWERDLLVLFPGQMP  123



>gb|KEH16996.1| senescence-associated protein, putative, partial [Medicago truncatula]
Length=744

 Score = 88.2 bits (217),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -2

Query  351  EYDRAWTALGPPDFQGPPGAHRTPRDVWCSSSRWTLPPAEPFPG  220
            EYDRAW  LGPPDFQGPPGAHRTPRDV CSSSRWTLPPAEPFPG
Sbjct  345  EYDRAWKTLGPPDFQGPPGAHRTPRDVRCSSSRWTLPPAEPFPG  388


 Score = 44.7 bits (104),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 33/58 (57%), Gaps = 5/58 (9%)
 Frame = -1

Query  592  EGPRKSRSQSVPRPAR-----GDPLSPR*QLEQSAEQPTGSGLGPPCPALRANPFPEV  434
            +G  +S+ Q VP P R       P       +   +QPTGS LGPPCPALRANPFPE 
Sbjct  289  QGQWESQDQKVPFPVRPPTGTRRPALAAGAAQAVRQQPTGSKLGPPCPALRANPFPEY  346



>gb|EEC70731.1| hypothetical protein OsI_02133 [Oryza sativa Indica Group]
Length=53

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR  195
            MSTTGRGR+SVLRIFKGRRGRTGH ATCGALPAAGPYLRL+RFQG +AVKQKR
Sbjct  1    MSTTGRGRYSVLRIFKGRRGRTGHRATCGALPAAGPYLRLNRFQGWRAVKQKR  53



>emb|CDY19789.1| BnaA09g04420D [Brassica napus]
Length=349

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  210  SLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSPR  374
             LPTLETAQPEVGSSGWKST RRVVSGA PAALENPEDRVP TPGRTHNRIRSPR
Sbjct  295  CLPTLETAQPEVGSSGWKSTARRVVSGAFPAALENPEDRVPLTPGRTHNRIRSPR  349



>emb|CDY55729.1| BnaC08g46150D [Brassica napus]
Length=467

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  210  SLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSPR  374
             LPTLETAQPEVGSSGWKST RRVVSGA PAALENPEDRVP TPGRTHNRIRSPR
Sbjct  413  CLPTLETAQPEVGSSGWKSTARRVVSGAFPAALENPEDRVPLTPGRTHNRIRSPR  467



>ref|XP_002489153.1| hypothetical protein SORBIDRAFT_0016s002480 [Sorghum bicolor]
 gb|EES20333.1| hypothetical protein SORBIDRAFT_0016s002480 [Sorghum bicolor]
Length=52

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -3

Query  350  STTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR  195
            STTGRGR+SVLRIFKGRRGRTGH ATCGALP AGPYLRL+RFQG QAVKQKR
Sbjct  1    STTGRGRYSVLRIFKGRRGRTGHRATCGALPTAGPYLRLNRFQGWQAVKQKR  52



>ref|XP_006279316.1| hypothetical protein CARUB_v10012757mg, partial [Capsella rubella]
 ref|XP_006279320.1| hypothetical protein CARUB_v10012761mg, partial [Capsella rubella]
 gb|EOA12214.1| hypothetical protein CARUB_v10012757mg, partial [Capsella rubella]
 gb|EOA12218.1| hypothetical protein CARUB_v10012761mg, partial [Capsella rubella]
Length=122

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVK  204
            MSTTGR RHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQA++
Sbjct  1    MSTTGRERHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQALR  50



>ref|XP_002450730.1| hypothetical protein SORBIDRAFT_05g016465 [Sorghum bicolor]
 gb|EES09718.1| hypothetical protein SORBIDRAFT_05g016465 [Sorghum bicolor]
Length=106

 Score = 91.3 bits (225),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGR  330
            D F   TP P+P+SQSFSRSYGS+L TSLAYIVPLARGCSPWRPDAVMSTTG GR
Sbjct  52   DRFRARTPEPNPESQSFSRSYGSVLSTSLAYIVPLARGCSPWRPDAVMSTTGCGR  106


 Score = 37.7 bits (86),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -2

Query  606  VRRPGKAPERAVPSPSPGRHAA  541
            VRRPGKAPE  VP PSPG+HAA
Sbjct  15   VRRPGKAPEGTVPGPSPGQHAA  36



>gb|KDP37477.1| hypothetical protein JCGZ_06917 [Jatropha curcas]
Length=200

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -3

Query  386  RGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            RG S WRPDA+MSTTGRGRHSVLRIF G +GRTGH A CGALPAAGPYLRLS F+ G  +
Sbjct  111  RGYSLWRPDAIMSTTGRGRHSVLRIFIGHQGRTGHRAMCGALPAAGPYLRLSHFRVGGLL  170

Query  206  KQK  198
             +K
Sbjct  171  NRK  173



>emb|CDY43697.1| BnaC08g47040D [Brassica napus]
Length=229

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  210  SLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSPR  374
             LPTLETAQPEVGSSGWKST RRVVSGA PA LENPEDRVP TPGRTHNRIRS R
Sbjct  175  CLPTLETAQPEVGSSGWKSTARRVVSGAFPADLENPEDRVPLTPGRTHNRIRSQR  229



>gb|KJB11774.1| hypothetical protein B456_001G276600 [Gossypium raimondii]
 gb|KJB11775.1| hypothetical protein B456_001G276700 [Gossypium raimondii]
 gb|KJB11776.1| hypothetical protein B456_001G276800 [Gossypium raimondii]
Length=124

 Score = 66.6 bits (161),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAKWIRN GKRIGSEGWARGSQSRT
Sbjct  1    MEQCRQGKSAKWIRNLGKRIGSEGWARGSQSRT  33


 Score = 58.5 bits (140),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  504  ADCSSCYRGESGSPRAGRGTDWERLFRGPSPGVE  605
            A CSSC RGESGSPRAGRGTDWERL RGPSPG E
Sbjct  38   AHCSSCSRGESGSPRAGRGTDWERLPRGPSPGDE  71



>ref|XP_006286106.1| hypothetical protein CARUB_v10007654mg, partial [Capsella rubella]
 gb|EOA19004.1| hypothetical protein CARUB_v10007654mg, partial [Capsella rubella]
Length=76

 Score = 66.2 bits (160),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAKWIRNFGKRIGSEGWARGSQ RT
Sbjct  1    MEQCRQGKSAKWIRNFGKRIGSEGWARGSQFRT  33


 Score = 58.5 bits (140),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  501  SADCSSCYRGESGSPRAGRGTDWERLFRGPSPGVE  605
            SA+CSSC+RGESG  RAGRGTDWER  RG SPGVE
Sbjct  37   SANCSSCFRGESGLLRAGRGTDWERFSRGLSPGVE  71



>ref|XP_002488971.1| hypothetical protein SORBIDRAFT_1020s002020 [Sorghum bicolor]
 gb|EES20084.1| hypothetical protein SORBIDRAFT_1020s002020 [Sorghum bicolor]
Length=49

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            MSTTGRGR+SVLRIFKGRRGRTGH ATCGALP AGPYLRL+RFQG QAV
Sbjct  1    MSTTGRGRYSVLRIFKGRRGRTGHRATCGALPTAGPYLRLNRFQGWQAV  49



>ref|XP_001624693.1| predicted protein [Nematostella vectensis]
 gb|EDO32593.1| predicted protein, partial [Nematostella vectensis]
Length=123

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -1

Query  517  LEQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPG  338
            L QS   P  S L P  P LRANPFPEVTD FCRLPLPTLF+ PEA HLGDL+RL VRP 
Sbjct  46   LGQSGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVRPD  105

Query  337  VDGTRSSGFSRAAGGAPD  284
                    FSRA   APD
Sbjct  106  TKINVFPEFSRAVESAPD  123



>ref|WP_040007287.1| hypothetical protein [Elizabethkingia anophelis]
Length=93

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -1

Query  490  GSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            GS LGPP PALRANPFPEVTDPFCRLPLPTLFH PEAVHLGDLMRL
Sbjct  48   GSELGPPSPALRANPFPEVTDPFCRLPLPTLFHRPEAVHLGDLMRL  93



>gb|EHK21457.1| hypothetical protein TRIVIDRAFT_53758, partial [Trichoderma virens 
Gv29-8]
Length=82

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -3

Query  455  SQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGHHA  276
            SQS SRSYGSILPTSL YIV   RGCSPWRP AVMSTT R  +S  RIFKGRRGRTG   
Sbjct  1    SQSLSRSYGSILPTSLIYIVLSTRGCSPWRPAAVMSTTWRENYSFPRIFKGRRGRTGPSR  60

Query  275  TCGALPAAGP  246
              G      P
Sbjct  61   GAGLFQPLNP  70



>ref|XP_002488965.1| hypothetical protein SORBIDRAFT_1138s002030 [Sorghum bicolor]
 gb|EES20140.1| hypothetical protein SORBIDRAFT_1138s002030 [Sorghum bicolor]
Length=98

 Score = 60.8 bits (146),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAK IRNFGKRIGSEGWARGS+ RT
Sbjct  1    MEQCRQGKSAKRIRNFGKRIGSEGWARGSRPRT  33


 Score = 57.0 bits (136),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  504  ADCSSCYRGESGSPRAGRGTDWERLFRGPSPGVE  605
            ADCSSC RGESG PRAGRGTD ER  RGPSPGVE
Sbjct  38   ADCSSCSRGESGPPRAGRGTDRERFLRGPSPGVE  71



>gb|KDP27127.1| hypothetical protein JCGZ_22036 [Jatropha curcas]
Length=104

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR*LF  186
            MSTTGRGRH VLRIF G RGRT H ATC ALP AGPYLR S FQGG+AVKQKR LF
Sbjct  1    MSTTGRGRHLVLRIFMGCRGRTRHRATCAALPVAGPYLRPSHFQGGRAVKQKRQLF  56



>ref|XP_002449481.1| hypothetical protein SORBIDRAFT_05g016420 [Sorghum bicolor]
 gb|EES08469.1| hypothetical protein SORBIDRAFT_05g016420 [Sorghum bicolor]
Length=50

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVK  204
            MSTT  GR+SVLRIFKGRR RTGH A CGALP AGPYLRL+RFQG QAVK
Sbjct  1    MSTTECGRYSVLRIFKGRRWRTGHRAMCGALPTAGPYLRLNRFQGWQAVK  50



>ref|XP_006279318.1| hypothetical protein CARUB_v10012759mg [Capsella rubella]
 ref|XP_006279319.1| hypothetical protein CARUB_v10012760mg [Capsella rubella]
 gb|EOA12216.1| hypothetical protein CARUB_v10012759mg [Capsella rubella]
 gb|EOA12217.1| hypothetical protein CARUB_v10012760mg [Capsella rubella]
Length=74

 Score = 66.2 bits (160),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAKWIRNFGKRIGSEGWARGSQ RT
Sbjct  1    MEQCRQGKSAKWIRNFGKRIGSEGWARGSQFRT  33


 Score = 48.1 bits (113),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  501  SADCSSCYRGESGSPRAGRGTDWERLFR  584
            SA+CSSC+RGESG  RAGRGTDWER  R
Sbjct  37   SANCSSCFRGESGLLRAGRGTDWERQLR  64



>gb|KGN59815.1| hypothetical protein Csa_3G848246 [Cucumis sativus]
Length=77

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  483  DWDPRAQPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET  364
            DWDPRAQPSEPILFP+LRIHFADFP LHCSI QRLFTLET
Sbjct  38   DWDPRAQPSEPILFPRLRIHFADFPYLHCSIDQRLFTLET  77



>gb|ACG27180.1| hypothetical protein [Zea mays]
 gb|ACG29939.1| hypothetical protein [Zea mays]
Length=98

 Score = 60.8 bits (146),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAK IRNFGKRIGSEGWARGS+ RT
Sbjct  1    MEQCRQGKSAKRIRNFGKRIGSEGWARGSRPRT  33


 Score = 51.6 bits (122),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  504  ADCSSCYRGESGSPRAGRGTDWERLFRGPSPGVE  605
            A+CSSC RGESG PRAGRGTD ER  RGPSPGVE
Sbjct  38   AECSSCSRGESGPPRAGRGTDRERPPRGPSPGVE  71



>ref|XP_005842765.1| hypothetical protein CHLNCDRAFT_28884, partial [Chlorella variabilis]
 ref|XP_005850544.1| hypothetical protein CHLNCDRAFT_20144, partial [Chlorella variabilis]
 gb|EFN50647.1| hypothetical protein CHLNCDRAFT_28884 [Chlorella variabilis]
 gb|EFN58442.1| hypothetical protein CHLNCDRAFT_20144, partial [Chlorella variabilis]
Length=130

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -1

Query  574  RSQSVPRPARGDPLSPR*QLEQSAEQPTGSGLGPPCPALRANPFPEV-TDPFCRLPLPTL  398
            RS S P  +R   + PR +      QP  S   P  PALRANPFPEV TDPFCRLPL TL
Sbjct  23   RSLSTPFRSRHAAVRPRREARVDHRQPRVSECRPLGPALRANPFPEVLTDPFCRLPLSTL  82

Query  397  FHWPEAVHLGDLMRL*VRPGVDGT  326
            F+  EAVHLGDLMRL VRPG  G 
Sbjct  83   FYRLEAVHLGDLMRLWVRPGKIGN  106



>ref|XP_007297914.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD11810.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=288

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  455  SQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTG  285
            SQSFSRSYGSILPTSL YIV   RGCSPWRP AVMSTT    +S  RIFKGRR RTG
Sbjct  11   SQSFSRSYGSILPTSLIYIVLSTRGCSPWRPAAVMSTTWLESYSFPRIFKGRRERTG  67



>gb|KDO39226.1| hypothetical protein CISIN_1g0366582mg, partial [Citrus sinensis]
Length=210

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            MSTTG GRHSVLRIFKGRRG  G+  TCGALPAAGPYL+LSRF GGQA+
Sbjct  1    MSTTGHGRHSVLRIFKGRRGHPGNRTTCGALPAAGPYLQLSRFLGGQAI  49



>ref|XP_003379707.1| hypothetical protein Tsp_03361 [Trichinella spiralis]
 gb|EFV60677.1| hypothetical protein Tsp_03361 [Trichinella spiralis]
Length=114

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -1

Query  517  LEQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPG  338
               S +      L P  PALRANP  EVTDPFCRLPLPTLF+ PEA+HLGDL+R+ VRP 
Sbjct  35   FRDSVQGNMAKNLSPIGPALRANPCSEVTDPFCRLPLPTLFYRPEAIHLGDLLRISVRPS  94

Query  337  VDGTR  323
               TR
Sbjct  95   TRFTR  99



>gb|AAR25996.1| cytochrome P450 monooxygenase [Pyrus communis]
Length=58

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  461  PQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRH  327
            PQSQSFSRSYGSILPTSLAYIVP  RGCSPWRPDAVM   G  +H
Sbjct  8    PQSQSFSRSYGSILPTSLAYIVPSTRGCSPWRPDAVMRQPGELKH  52



>gb|EFX60441.1| hypothetical protein DAPPUDRAFT_124183 [Daphnia pulex]
Length=135

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 5/80 (6%)
 Frame = -1

Query  496  PTGS--GLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTR  323
            PT S   L P    LRANP+PEVTDP CR PLPT  H  EAVHLGDLMR+ VR G +  +
Sbjct  48   PTASLDKLSPTASTLRANPYPEVTDPICRFPLPTFIHRLEAVHLGDLMRISVRAGANVQQ  107

Query  322  S---SGFSRAAGGAPDTTRR  272
                +GFSRA+   P T+++
Sbjct  108  RNPPTGFSRASRERPRTSQK  127



>gb|KDR65248.1| hypothetical protein GALMADRAFT_82091, partial [Galerina marginata 
CBS 339.88]
Length=82

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  455  SQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGHH  279
            SQSFSRSYGSILPTSL YIV   RGCSPWRP AVMSTT    +S   IFK  + RTGH+
Sbjct  1    SQSFSRSYGSILPTSLIYIVLSTRGCSPWRPAAVMSTTRCESYSFPWIFKDCQERTGHN  59



>gb|KFM81627.1| hypothetical protein X975_03524, partial [Stegodyphus mimosarum]
Length=88

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -1

Query  475  PPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTR-SSGFSRAA  299
            P  P LRANP PEVTD  CRLPLPTLF+  EAVHLGDL+R+ VR G      S GF+R  
Sbjct  1    PTGPVLRANPCPEVTDRTCRLPLPTLFYRLEAVHLGDLLRIWVRSGTKNHNLSLGFARVD  60

Query  298  GGAPDTTRRVVLFQPLDP  245
               PDT R  VL +   P
Sbjct  61   RSVPDTARAAVLLRTHHP  78



>emb|CDW75723.1| UNKNOWN [Stylonychia lemnae]
Length=1881

 Score = 81.6 bits (200),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 59/105 (56%), Gaps = 13/105 (12%)
 Frame = -1

Query  481  LGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRP-GVDGTR-----S  320
            +GP CP LRA PFPEVT+PFCRLPL TLF                RP  V GT      S
Sbjct  366  IGPDCPILRAIPFPEVTEPFCRLPLSTLFQLARGCQPW-------RPDAVMGTTWCEIIS  418

Query  319  SGFSRAAGGAPDTTRRVVLFQPLDPTSG*AVSRVGRLLNRKDNSS  185
              FS     APDT++  VLFQ  +P+SG +  RV  LL RKDNSS
Sbjct  419  LRFSWTIVNAPDTSKSKVLFQTYNPSSGQSNFRVASLLKRKDNSS  463


 Score = 25.8 bits (55),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (62%), Gaps = 0/21 (0%)
 Frame = -2

Query  69   GLPPTLRID*PMCKCRSHGTF  7
            G PP LRI+ P+  C SHG  
Sbjct  486  GFPPCLRIESPVTNCCSHGNL  506



>gb|EMT15825.1| hypothetical protein F775_00529 [Aegilops tauschii]
Length=131

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 12/80 (15%)
 Frame = -3

Query  398  VPLARGCSPWR-PDAVMST-----------TGRGRHSVLRIFKGRRGRTGHHATCGALPA  255
            + ++R C P + P   MS+           T R R+SVLRIF G RGRTGH   CGALPA
Sbjct  52   IVISRMCRPSQTPHLTMSSARIGPRLFTLETARERYSVLRIFMGHRGRTGHRVMCGALPA  111

Query  254  AGPYLRLSRFQGGQAVKQKR  195
             GPYLRL+RFQ  QA+KQKR
Sbjct  112  TGPYLRLNRFQDWQAIKQKR  131



>ref|XP_008045834.1| hypothetical protein TRAVEDRAFT_137643, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EIW51283.1| hypothetical protein TRAVEDRAFT_137643, partial [Trametes versicolor 
FP-101664 SS1]
Length=62

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  514  EQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            EQS   P  S  GP  P LRANPFPEVTD FCRLPL TLF+  EAVHLGDL+RL
Sbjct  9    EQSQPSPAASSQGPTYPTLRANPFPEVTDLFCRLPLSTLFYQLEAVHLGDLLRL  62



>gb|EMD30280.1| hypothetical protein CERSUDRAFT_146047, partial [Ceriporiopsis 
subvermispora B]
 gb|EMD30358.1| hypothetical protein CERSUDRAFT_146011, partial [Ceriporiopsis 
subvermispora B]
 gb|EMD30387.1| hypothetical protein CERSUDRAFT_145996, partial [Ceriporiopsis 
subvermispora B]
Length=96

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 50/78 (64%), Gaps = 7/78 (9%)
 Frame = -1

Query  586  PRKSRSQSVPRPARGDPLSPR*QLEQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPL  407
            PR S ++S P P+   P       +QS   P  S  GP  P LRANPFPEVTD FCRLPL
Sbjct  26   PRPSTNRSWPSPSEVAP-------KQSQPGPAASSQGPTYPTLRANPFPEVTDLFCRLPL  78

Query  406  PTLFHWPEAVHLGDLMRL  353
             TLF+  EAVHLGDL+RL
Sbjct  79   STLFYQLEAVHLGDLLRL  96



>ref|XP_001785944.1| predicted protein [Physcomitrella patens]
 gb|EDQ49243.1| predicted protein, partial [Physcomitrella patens]
Length=107

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  499  QPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            QPTGS   P  P LRANPFPEVTD FCRLPLPTLF+  EAVHLGDLMRL
Sbjct  59   QPTGSRHRPLGPTLRANPFPEVTDLFCRLPLPTLFYRLEAVHLGDLMRL  107



>ref|XP_003366344.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46194.1| conserved hypothetical protein [Trichinella spiralis]
Length=68

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  481  LGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTR  323
            L P  PALRANP  EVTDPFCRLPLPTLF+ PEA+HLGDL+R+ VRP    TR
Sbjct  1    LSPIGPALRANPCSEVTDPFCRLPLPTLFYRPEAIHLGDLLRISVRPSTRFTR  53



>ref|XP_001621925.1| hypothetical protein NEMVEDRAFT_v1g143181 [Nematostella vectensis]
 gb|EDO29825.1| predicted protein, partial [Nematostella vectensis]
Length=100

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  517  LEQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            L QS   P  S L P  P LRANPFPEVTD FCRLPLPTLF+ PEA HLGDL+RL
Sbjct  46   LGQSGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRL  100



>ref|XP_003367113.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46421.1| conserved hypothetical protein [Trichinella spiralis]
Length=165

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 51/91 (56%), Gaps = 7/91 (8%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALGPP---DFQGPP  298
            AQP EPIL PKLRI FADFP LH SIGQRLFTLET CGY+YD+     G      ++   
Sbjct  35   AQPLEPILVPKLRIRFADFPYLHYSIGQRLFTLETCCGYQYDQVRDLPGVARIFTYRRER  94

Query  297  GAHRTPRDV-WCSSSRWTLPPAEPFPGWAGC  208
              HR    V W   S   L P  P PG A  
Sbjct  95   SEHREKVGVLWIPES---LSPDNPVPGNASL  122



>ref|XP_001626156.1| predicted protein [Nematostella vectensis]
 gb|EDO34056.1| predicted protein, partial [Nematostella vectensis]
Length=54

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  514  EQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
             Q    P  S L P  P LRANPFPEVTD FCRLPLPTLF+ PEA HLGDL+RL
Sbjct  1    RQVRAGPLASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRL  54



>gb|EMT25146.1| hypothetical protein F775_27689 [Aegilops tauschii]
Length=271

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  365  VSKVNSLWPMEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            VSKVNSLWPMEQCRQGKSAK IRNFGKRIGSE WARGS+ RT
Sbjct  158  VSKVNSLWPMEQCRQGKSAKRIRNFGKRIGSEDWARGSRPRT  199



>emb|CDW60529.1| hypothetical protein TTRE_0000891601 [Trichuris trichiura]
Length=304

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  104  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  163

Query  334  DGTRSSGFSRAAGGAPDTT  278
            +     GFSR     P+ T
Sbjct  164  N-LYGLGFSRTVESVPNAT  181



>ref|XP_002484510.1| hypothetical protein TSTA_040370 [Talaromyces stipitatus ATCC 
10500]
 gb|EED14557.1| hypothetical protein TSTA_040370 [Talaromyces stipitatus ATCC 
10500]
Length=305

 Score = 53.9 bits (128),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  392  LARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTG  285
            + +GCSPWRP AVMSTT R  +S  RIFK RRGRTG
Sbjct  112  IPKGCSPWRPAAVMSTTWRENYSFPRIFKDRRGRTG  147


 Score = 48.1 bits (113),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 45/89 (51%), Gaps = 1/89 (1%)
 Frame = -1

Query  265  LFQPLDPTSG*AVSRVGRLLNRKDNSSrgprrrlrnp*rcrqpprPGSGILTRFPFGARA  86
            L QP +P+SG    RV      K    R P           + P PG+GILT FPF  R 
Sbjct  154  LCQPWNPSSGQTDFRVIGCQEEKRTLPRTPADVSAFSYVAVENPHPGAGILTGFPFDGRR  213

Query  85   KRAVCRAS-PDP*DRLTHVQVPFTWNLSP  2
             RA  +   P   DRLTHVQ+ FTWNLSP
Sbjct  214  TRAHFQTELPYVLDRLTHVQLLFTWNLSP  242


 Score = 20.8 bits (42),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -2

Query  471  RAQPSEPILFPK  436
            RA+P EPIL PK
Sbjct  103  RARPLEPILIPK  114



>emb|CDW61027.1| hypothetical protein TTRE_0000944101 [Trichuris trichiura]
Length=344

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  144  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  203

Query  334  DGTRSSGFSRAAGGAPDTT  278
            +     GFSR     P+ T
Sbjct  204  N-LYGLGFSRTVESVPNAT  221



>emb|CDW60818.1| hypothetical protein TTRE_0000921701 [Trichuris trichiura]
Length=333

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  133  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  192

Query  334  DGTRSSGFSRAAGGAPDTT  278
            +     GFSR     P+ T
Sbjct  193  N-LYGLGFSRTVESVPNAT  210



>emb|CCD58992.1| hypothetical protein Smp_183040 [Schistosoma mansoni]
Length=214

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -3

Query  461  PQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTGH  282
            P   SFSRSYGS LPTSL YIV   R   PWRP A M T           F+GR+ R+GH
Sbjct  69   PPEPSFSRSYGSNLPTSLTYIVHCQR-LFPWRPAADMGTACHENILPRSDFQGRQERSGH  127

Query  281  HATCGALPAAGPYLRLSRFQGGQA-VKQKR*LF  186
            H   GAL    PYLR SRFQG  A + +KR LF
Sbjct  128  HKKGGALRRLAPYLRTSRFQGVDALLTKKRELF  160



>ref|XP_003367073.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46420.1| conserved hypothetical protein [Trichinella spiralis]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRA  337
            AQP EPIL PKLRI FADFP LH SIGQRLFTLET CGY+YD+ 
Sbjct  31   AQPLEPILVPKLRIRFADFPYLHYSIGQRLFTLETCCGYQYDQV  74



>emb|CDW61211.1| hypothetical protein TTRE_0000965201 [Trichuris trichiura]
Length=342

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  142  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  201

Query  334  DGTRSSGFSRAAGGAPDTT  278
            +     GFSR     P+ T
Sbjct  202  N-LYGLGFSRTVESVPNAT  219



>emb|CDW61033.1| hypothetical protein TTRE_0000944801 [Trichuris trichiura]
Length=375

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  175  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  234

Query  334  DGTRSSGFSRAAGGAPDTT  278
            +     GFSR     P+ T
Sbjct  235  N-LYGLGFSRTVESVPNAT  252



>ref|XP_001624699.1| predicted protein [Nematostella vectensis]
 gb|EDO32599.1| predicted protein, partial [Nematostella vectensis]
Length=100

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  517  LEQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            L QS   P  S L P  P LRANPFPEV D FCRLPLPTLF+ PEA HLGDL+RL
Sbjct  46   LGQSGPGPLASSLSPTDPTLRANPFPEVRDLFCRLPLPTLFYQPEAAHLGDLLRL  100



>gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax]
Length=1367

 Score = 60.8 bits (146),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 46/87 (53%), Gaps = 13/87 (15%)
 Frame = -1

Query  478  GPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRP-GVDGTR-----SS  317
            GP CP LRA PFPEVT+ FCRLPL TLF                RP  V GT      S 
Sbjct  441  GPDCPILRAIPFPEVTELFCRLPLSTLFQLARGCQ-------PWRPDAVMGTTWCEIISL  493

Query  316  GFSRAAGGAPDTTRRVVLFQPLDPTSG  236
             FS     APDT++  VLFQ  +P+SG
Sbjct  494  RFSWTIVNAPDTSKSKVLFQTYNPSSG  520


 Score = 41.2 bits (95),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -2

Query  141  NRHVPVQEF*PDSLSAHAQNALSVGLPPTLRID*PMCKCRSHGTF  7
            N H+ ++E+ P SLS  +Q     G PP LRI+ P+  C SHG  
Sbjct  540  NTHIQLEEYQPHSLSTTSQRLTQQGFPPCLRIESPVTNCCSHGNL  584



>gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax]
Length=1367

 Score = 60.8 bits (146),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 46/87 (53%), Gaps = 13/87 (15%)
 Frame = -1

Query  478  GPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRP-GVDGTR-----SS  317
            GP CP LRA PFPEVT+ FCRLPL TLF                RP  V GT      S 
Sbjct  441  GPDCPILRAIPFPEVTELFCRLPLSTLFQLARGCQ-------PWRPDAVMGTTWCEIISL  493

Query  316  GFSRAAGGAPDTTRRVVLFQPLDPTSG  236
             FS     APDT++  VLFQ  +P+SG
Sbjct  494  RFSWTIVNAPDTSKSKVLFQTYNPSSG  520


 Score = 41.2 bits (95),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -2

Query  141  NRHVPVQEF*PDSLSAHAQNALSVGLPPTLRID*PMCKCRSHGTF  7
            N H+ ++E+ P SLS  +Q     G PP LRI+ P+  C SHG  
Sbjct  540  NTHIQLEEYQPHSLSTTSQRLTQQGFPPCLRIESPVTNCCSHGNL  584



>ref|XP_003370555.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV47204.1| conserved hypothetical protein [Trichinella spiralis]
Length=222

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 51/90 (57%), Gaps = 7/90 (8%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALGPP---DFQGPP  298
            AQP EPIL PKLRI FADFP LH SIGQRLFTLET CGY+YD+     G      ++   
Sbjct  14   AQPLEPILVPKLRIRFADFPYLHYSIGQRLFTLETCCGYQYDQVRDLPGVARIFTYRRER  73

Query  297  GAHRTPRDV-WCSSSRWTLPPAEPFPGWAG  211
              HR    V W   S   L P  P PG A 
Sbjct  74   SEHREKVGVLWIPES---LSPDNPVPGNAS  100



>emb|CDW61046.1| hypothetical protein TTRE_0000946501 [Trichuris trichiura]
Length=378

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  178  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  237

Query  334  DGTRSSGFSRAAGGAPDTT  278
            +     GFSR     P+ T
Sbjct  238  N-LYGLGFSRTVESVPNAT  255



>emb|CDW60983.1| hypothetical protein TTRE_0000939101 [Trichuris trichiura]
Length=500

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  144  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  203

Query  334  DGTRSSGFSRAAGGAPDTT  278
            +     GFSR     P+ T
Sbjct  204  N-LYGLGFSRTVESVPNAT  221



>ref|XP_003366891.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46213.1| conserved hypothetical protein [Trichinella spiralis]
Length=48

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            PALRANP  EVTDPFCRLPLPTLF+ PEA+HLGDL+R+ VRP  
Sbjct  4    PALRANPCSEVTDPFCRLPLPTLFYRPEAIHLGDLLRISVRPST  47



>emb|CDW61241.1| hypothetical protein TTRE_0000968701 [Trichuris trichiura]
Length=196

 Score = 73.6 bits (179),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ VR   
Sbjct  94   QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWVRAST  153

Query  334  D  332
            +
Sbjct  154  N  154


 Score = 27.3 bits (59),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 0/41 (0%)
 Frame = -3

Query  329  HSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAV  207
            + V R+F  RR R+  H   G L     YLR +RFQ  +A+
Sbjct  156  YGVARLFTDRRERSERHGRRGVLRRHRRYLRTTRFQRLRAL  196



>gb|KDQ32286.1| hypothetical protein PLEOSDRAFT_22346, partial [Pleurotus ostreatus 
PC15]
Length=90

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  496  PTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            P  S  GP  P LRANPFPEVTD FCRLPL TLF+  EAVHLGDL+RL
Sbjct  43   PKASNQGPTHPTLRANPFPEVTDLFCRLPLSTLFYQLEAVHLGDLLRL  90



>ref|XP_003370331.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368341.1| conserved hypothetical protein, partial [Trichinella spiralis]
 gb|EFV46214.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46223.1| conserved hypothetical protein [Trichinella spiralis]
Length=45

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRP  341
            PALRANP  EVTDPFCRLPLPTLF+ PEA+HLGDL+R+ VRP
Sbjct  4    PALRANPCSEVTDPFCRLPLPTLFYRPEAIHLGDLLRISVRP  45



>ref|NP_671477.1| rRNA promoter binding protein [Rattus norvegicus]
 gb|AAK21974.1| rRNA promoter binding protein [Rattus norvegicus]
Length=295

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 64/136 (47%), Gaps = 18/136 (13%)
 Frame = -2

Query  465  QPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALG------PPDFQG  304
            QP EPIL PKLRI  ADFP LHCS       L      +  R W   G      PPDFQG
Sbjct  154  QPLEPILIPKLRIRLADFPYLHCSNMPEAVHLG-----DLLRIWVRPGARFTPSPPDFQG  208

Query  303  PPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAPADVSGIPNV----AVNR  136
            P  AHRTP +         L   EP PG      EK TLP APA  SGI  V    A  R
Sbjct  209  PARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPAGFSGIGRVTALDASRR  268

Query  135  HVP---VQEF*PDSLS  97
              P   ++   PDSLS
Sbjct  269  PSPPLRIRRSEPDSLS  284



>ref|XP_003366704.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46206.1| conserved hypothetical protein [Trichinella spiralis]
Length=60

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  457  RANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTR  323
            RANP  EVTDPFCRLPLPTLF+ PEA+HLGDL+R+ VRP    TR
Sbjct  1    RANPCSEVTDPFCRLPLPTLFYRPEAIHLGDLLRISVRPSTRFTR  45



>gb|EXD08168.1| hypothetical protein J457_4177, partial [Acinetobacter baumannii 
136706]
Length=222

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 54/115 (47%), Gaps = 11/115 (10%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALG------PPDFQ  307
             QP EPIL PKLRI  ADFP LHCS       L      +  R W   G      PPDFQ
Sbjct  29   TQPLEPILIPKLRIRLADFPYLHCSNMPEAVHLG-----DLLRIWVRPGARFTPSPPDFQ  83

Query  306  GPPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAPADVSGIPNVAV  142
            GP  AHRTP +         L   EP PG      EK TLP APA  SGI  V  
Sbjct  84   GPARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPAGFSGIGRVTA  138



>gb|ESA03491.1| hypothetical protein GLOINDRAFT_67222, partial [Rhizophagus irregularis 
DAOM 181602]
Length=88

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  487  SGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            S  GP  P LRANPFP+VTD FCRLPLPTLF+  EAVHLGDL+RL
Sbjct  44   SNQGPISPILRANPFPKVTDLFCRLPLPTLFYQLEAVHLGDLLRL  88



>ref|XP_001891759.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi]
 ref|XP_001892385.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi]
 ref|XP_001893700.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi]
 ref|XP_001894198.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi]
Length=61

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  487  SGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPG  338
            S   P  P LRANP+PEVTD  CRLPLPTLF+  EAVHLGDL+R+ VR G
Sbjct  8    SHYSPTGPVLRANPYPEVTDLICRLPLPTLFYRLEAVHLGDLLRIWVRSG  57



>emb|CDW60997.1| hypothetical protein TTRE_0000940701 [Trichuris trichiura]
Length=311

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 47/79 (59%), Gaps = 11/79 (14%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+ +    
Sbjct  120  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWL----  175

Query  334  DGTRSSGFSRAAGGAPDTT  278
                  GFSR     P+ T
Sbjct  176  ------GFSRTVESVPNAT  188



>ref|XP_008768405.1| PREDICTED: collagen alpha-1(I) chain-like [Rattus norvegicus]
Length=531

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 64/136 (47%), Gaps = 18/136 (13%)
 Frame = -2

Query  465  QPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALG------PPDFQG  304
            QP EPIL PKLRI  ADFP LHCS       L      +  R W   G      PPDFQG
Sbjct  399  QPLEPILIPKLRIRLADFPYLHCSNMPEAVHL-----GDLLRIWVRPGARFTPSPPDFQG  453

Query  303  PPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAPADVSGIPNV----AVNR  136
            P  AHRTP +         L   EP PG      EK TLP APA  SGI  V    A  R
Sbjct  454  PARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPAGFSGIGRVTALDASRR  513

Query  135  HVP---VQEF*PDSLS  97
              P   ++   PDSLS
Sbjct  514  PSPPLRIRGSEPDSLS  529



>ref|XP_005646644.1| hypothetical protein COCSUDRAFT_83496, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22100.1| hypothetical protein COCSUDRAFT_83496, partial [Coccomyxa subellipsoidea 
C-169]
Length=69

 Score = 68.6 bits (166),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  461  PQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRH  327
            PQSQ FSRSY  ILPTSL YIV   RGCSPWRPDAVMSTT + R 
Sbjct  1    PQSQFFSRSYEPILPTSLIYIVLSTRGCSPWRPDAVMSTTWQDRK  45


 Score = 29.3 bits (64),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = -1

Query  334  DGTRSSGFSRAAGGAPDTTR  275
            D  RS GFSRA GGAPD+ +
Sbjct  43   DRKRSPGFSRAVGGAPDSAK  62



>ref|XP_004482538.1| PREDICTED: uncharacterized protein LOC101444772, partial [Dasypus 
novemcinctus]
Length=235

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 53/110 (48%), Gaps = 11/110 (10%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALG------PPDFQ  307
             QP EPIL PKLRI  ADFP LHCS       L      +  R W   G      PPDFQ
Sbjct  39   TQPLEPILIPKLRIRLADFPYLHCSNMPEAVHLG-----DLLRIWVRPGARFTPSPPDFQ  93

Query  306  GPPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAPADVSGI  157
            GP  AHRTP +         L   EP PG      EK TLP APA  SGI
Sbjct  94   GPARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPAGFSGI  143



>ref|XP_001893546.1| unspecific monooxygenase  [Brugia malayi]
Length=65

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  487  SGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPG  338
            S   P  P LRANP+PEVTD  CRLPLPTLF+  EAVHLGDL+R+ VR G
Sbjct  12   SHYSPTGPVLRANPYPEVTDLICRLPLPTLFYRLEAVHLGDLLRIWVRSG  61



>ref|XP_003460741.1| PREDICTED: collagen alpha-1(I) chain-like [Cavia porcellus]
Length=536

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 64/136 (47%), Gaps = 18/136 (13%)
 Frame = -2

Query  465  QPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALG------PPDFQG  304
            QP EPIL PKLRI  ADFP LHCS       L      +  R W   G      PPDFQG
Sbjct  404  QPLEPILIPKLRIRLADFPYLHCSNMPEAVHL-----GDLLRIWVRPGARFTPSPPDFQG  458

Query  303  PPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAPADVSGIPNV----AVNR  136
            P  AHRTP +         L   EP PG      EK TLP APA  SGI  V    A  R
Sbjct  459  PARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPAGFSGIGRVTALDASRR  518

Query  135  HVP---VQEF*PDSLS  97
              P   ++   PDSLS
Sbjct  519  PSPPLRIRGSEPDSLS  534



>ref|XP_003367080.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46196.1| conserved hypothetical protein [Trichinella spiralis]
Length=40

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  460  LRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRP  341
            LRANP  EVTDPFCRLPLPTLF+ PEA+HLGDL+R+ VRP
Sbjct  1    LRANPCSEVTDPFCRLPLPTLFYRPEAIHLGDLLRISVRP  40



>ref|XP_003370393.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46220.1| conserved hypothetical protein [Trichinella spiralis]
Length=59

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  454  ANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTR  323
            ANP  EVTDPFCRLPLPTLF+ PEA+HLGDL+R+ VRP    TR
Sbjct  1    ANPCSEVTDPFCRLPLPTLFYRPEAIHLGDLLRISVRPSTRFTR  44



>ref|XP_001897189.1| rRNA promoter binding protein [Brugia malayi]
Length=118

 Score = 63.2 bits (152),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  487  SGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            S   P  P LRANP+PEVTD  CRLPLPTLF+  EAVHLGDL+R+
Sbjct  12   SHYSPTGPVLRANPYPEVTDIICRLPLPTLFYRLEAVHLGDLLRI  56


 Score = 33.5 bits (75),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 22/41 (54%), Gaps = 3/41 (7%)
 Frame = -2

Query  342  RAWTALGPPDFQGPPGAHRTPRDVWCSSSRWTLPPAEPFPG  220
            R W    P DF G   AH TP++ W  +   +L PAEP PG
Sbjct  55   RIWL---PSDFHGSNKAHETPQEPWRFTETTSLSPAEPIPG  92



>ref|XP_001891902.1| rRNA promoter binding protein [Brugia malayi]
 ref|XP_001891963.1| rRNA promoter binding protein [Brugia malayi]
Length=114

 Score = 63.2 bits (152),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  487  SGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            S   P  P LRANP+PEVTD  CRLPLPTLF+  EAVHLGDL+R+
Sbjct  8    SHYSPTGPVLRANPYPEVTDLICRLPLPTLFYRLEAVHLGDLLRI  52


 Score = 33.5 bits (75),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = -2

Query  321  PPDFQGPPGAHRTPRDVWCSSSRWTLPPAEPFPG  220
            P DF G   AH TP++ W  +   +L PAEP PG
Sbjct  55   PSDFHGSNKAHETPQEPWRFTETTSLSPAEPIPG  88



>ref|XP_001892138.1| rRNA promoter binding protein [Brugia malayi]
Length=114

 Score = 62.8 bits (151),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  487  SGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            S   P  P LRANP+PEVTD  CRLPLPTLF+  EAVHLGDL+R+
Sbjct  8    SHYSPTGPVLRANPYPEVTDLICRLPLPTLFYRLEAVHLGDLLRI  52


 Score = 33.5 bits (75),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 22/41 (54%), Gaps = 3/41 (7%)
 Frame = -2

Query  342  RAWTALGPPDFQGPPGAHRTPRDVWCSSSRWTLPPAEPFPG  220
            R W    P DF G   AH TP++ W  +   +L PAEP PG
Sbjct  51   RIWL---PSDFHGSNKAHETPQEPWRFTETXSLSPAEPIPG  88



>ref|XP_001619057.1| hypothetical protein NEMVEDRAFT_v1g152505 [Nematostella vectensis]
 gb|EDO26957.1| predicted protein, partial [Nematostella vectensis]
Length=101

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 45/79 (57%), Gaps = 5/79 (6%)
 Frame = +1

Query  97   RKGIGLKFLNRDVAVD-----GNVRDSGDVGGGLGKSYLFCLTACPPWKRLSRR*GPAAG  261
            RKGIGL F NRD  +      GN  +  D GGG GKS LF LT+  P   L    G   G
Sbjct  20   RKGIGLIFPNRDADIAVRGKCGNANEPEDAGGGPGKSSLFFLTSFHPEISLPGDRGLMLG  79

Query  262  RAPHVAWCPVRPRRPLKIR  318
            +APH  WCPVR RRPL IR
Sbjct  80   KAPHFLWCPVRSRRPLXIR  98



>emb|CDY66173.1| BnaAnng21760D [Brassica napus]
Length=548

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  210  SLPTLETAQPEVGSSGWKSTTRRVVSGAPPAALENPEDRVPSTPG  344
             LPTLETA+PEVGSSGWKST R +VSGA P ALENPED+VP TPG
Sbjct  341  CLPTLETAEPEVGSSGWKSTARCLVSGAFPVALENPEDQVPLTPG  385



>ref|XP_008251357.1| PREDICTED: basic proline-rich protein-like [Oryctolagus cuniculus]
Length=342

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 53/114 (46%), Gaps = 11/114 (10%)
 Frame = -2

Query  465  QPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALG------PPDFQG  304
            QP EPIL PKLRI  ADFP LHCS       L      +  R W   G      PPDFQG
Sbjct  210  QPLEPILIPKLRIRLADFPYLHCSNMPEAVHL-----GDLLRIWVRPGTRFTPSPPDFQG  264

Query  303  PPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAPADVSGIPNVAV  142
            P  AHRTP +         L   EP PG      EK TLP AP   SGI  V  
Sbjct  265  PARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPTGFSGIGRVTA  318



>ref|XP_001891797.1| rRNA promoter binding protein [Brugia malayi]
Length=81

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  475  PPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVD  332
            P  P LRANP+PEVTD  CRLPLPTLF+  EAVHLGDL+R+ VR G  
Sbjct  32   PTGPVLRANPYPEVTDLICRLPLPTLFYRLEAVHLGDLLRIWVRSGTK  79



>gb|KFM67743.1| hypothetical protein X975_21862, partial [Stegodyphus mimosarum]
Length=111

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  467  PSPQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIF  309
            PSPQSQS SRSYGS LPTSL YIV   RGCSPWRP A M T     H++  I 
Sbjct  54   PSPQSQSLSRSYGSNLPTSLTYIVLSTRGCSPWRPAADMGTVWHENHNLFLII  106



>gb|EUB55374.1| rRNA promoter binding protein [Echinococcus granulosus]
Length=742

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 53/109 (49%), Gaps = 11/109 (10%)
 Frame = -2

Query  465  QPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRAWTALG------PPDFQG  304
            QP EPIL PKLRI  ADFP LHCS       L      +  R W   G      PPDFQG
Sbjct  426  QPLEPILIPKLRIRLADFPYLHCSNMPEAVHLG-----DLLRIWVRPGARFTPSPPDFQG  480

Query  303  PPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAPADVSGI  157
            P  AHRTP +         L   EP PG      EK TLP APA  SGI
Sbjct  481  PARAHRTPPEPRRFPRHGPLSRGEPIPGRPALHKEKRTLPGAPAGFSGI  529



>ref|XP_004933958.1| PREDICTED: uncharacterized protein LOC101742759 [Bombyx mori]
Length=181

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRSS  317
            P LRANP+ EVTDP CRLPLPTLF+  EA+HLGDL+R+ VR G    R+S
Sbjct  130  PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTS  179



>gb|KIK74323.1| hypothetical protein PAXRUDRAFT_176054, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=50

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -1

Query  496  PTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            P  S  GP    LRANPFPEVTD FCRLPL TLF+  EAVHLGDL+RL
Sbjct  3    PEPSTKGPTHLTLRANPFPEVTDLFCRLPLSTLFYQLEAVHLGDLLRL  50



>emb|CDW61222.1| hypothetical protein TTRE_0000966501, partial [Trichuris trichiura]
Length=441

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -1

Query  511  QSAEQP-TGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGV  335
            QSA  P T   + P   ALRANP  E TDPFCRLPL  LF+WPEAVHLGDL+R+   P  
Sbjct  237  QSATAPNTLRSISPTGSALRANPCSEGTDPFCRLPLSALFNWPEAVHLGDLLRIWSVPNA  296

Query  334  DG  329
             G
Sbjct  297  TG  298



>gb|EMD30503.1| hypothetical protein CERSUDRAFT_163809, partial [Ceriporiopsis 
subvermispora B]
Length=92

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 5/63 (8%)
 Frame = -1

Query  532  SPR*QLEQSAEQPTGSGL---GPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDL  362
            SPR  + Q   QP+   L    P  P LRANP+PEVTD FCRLPL TLF+  EAV+LGDL
Sbjct  32   SPR--IRQEVLQPSVPRLQNRSPIYPTLRANPYPEVTDLFCRLPLSTLFYQLEAVNLGDL  89

Query  361  MRL  353
            +RL
Sbjct  90   LRL  92



>ref|XP_011402156.1| hypothetical protein F751_0061, partial [Auxenochlorella protothecoides]
 gb|KFM22552.1| hypothetical protein F751_0061, partial [Auxenochlorella protothecoides]
Length=67

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  317  RIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR*LF  186
            RIFKGRR R GH  +CGA+PA+ PYLR++RFQG +AVK+KR LF
Sbjct  4    RIFKGRRWRAGHRESCGAVPASEPYLRMTRFQGLRAVKKKRELF  47



>ref|XP_007154095.1| hypothetical protein PHAVU_003G090100g [Phaseolus vulgaris]
 gb|ESW26089.1| hypothetical protein PHAVU_003G090100g [Phaseolus vulgaris]
Length=103

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  399  NVGKGSRQNGSVTSGKGLALRAGHGGPSPEPVGC  500
            NVGKGSRQNGSVTSGKGLALR+GHGGPSPEPVGC
Sbjct  8    NVGKGSRQNGSVTSGKGLALRSGHGGPSPEPVGC  41



>gb|EFX59851.1| hypothetical protein DAPPUDRAFT_73479 [Daphnia pulex]
 gb|EFX60544.1| hypothetical protein DAPPUDRAFT_71453 [Daphnia pulex]
 gb|EFX60552.1| hypothetical protein DAPPUDRAFT_71429 [Daphnia pulex]
 gb|EFX60675.1| hypothetical protein DAPPUDRAFT_71030 [Daphnia pulex]
 gb|EFX61417.1| hypothetical protein DAPPUDRAFT_69619 [Daphnia pulex]
Length=68

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -1

Query  442  PEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRS---SGFSRAAGGAPDTTRR  272
            PEVTDP CR PLPT  H  EAVHLGDLMR+ VR G +  +    +GFSRA+   P T+++
Sbjct  1    PEVTDPICRFPLPTFIHRLEAVHLGDLMRISVRAGANVQQRNPPTGFSRASRERPRTSQK  60



>gb|EJW71374.1| hypothetical protein WUBG_17720, partial [Wuchereria bancrofti]
Length=53

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  487  SGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            S   P  P LRANP+PEVTD  CRLPLPTLF+  EAVHLGDL+R+
Sbjct  8    SHYSPTGPVLRANPYPEVTDLICRLPLPTLFYRLEAVHLGDLLRI  52



>gb|EGZ74207.1| hypothetical protein NEUTE2DRAFT_76231, partial [Neurospora tetrasperma 
FGSC 2509]
Length=50

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  478  GPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
             P  P LRANP+PEVTD FCRLPL TLF+  EAV+LGDL+RL
Sbjct  9    SPIYPTLRANPYPEVTDLFCRLPLSTLFYQLEAVNLGDLLRL  50



>ref|XP_001640372.1| predicted protein [Nematostella vectensis]
 gb|EDO48309.1| predicted protein, partial [Nematostella vectensis]
Length=99

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            P LRANP PEVTD FCRLPLPTLF+ PEA HLGDL+RL
Sbjct  62   PTLRANPLPEVTDLFCRLPLPTLFYQPEAAHLGDLLRL  99



>ref|XP_004210189.1| PREDICTED: uncharacterized protein LOC101240867, partial [Hydra 
vulgaris]
Length=45

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLM  359
            P LRANPFPEVTD FCRLPLPTLF+ P+A HLGDL+
Sbjct  10   PILRANPFPEVTDLFCRLPLPTLFYGPKAAHLGDLL  45



>gb|EFX59870.1| hypothetical protein DAPPUDRAFT_73464 [Daphnia pulex]
 gb|EFX60252.1| hypothetical protein DAPPUDRAFT_72293 [Daphnia pulex]
Length=68

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = -1

Query  442  PEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRS---SGFSRAAGGAPDTTRR  272
            PEVTDP CR PLPT  H  EAVHLGDLMR+ VR G +  +    +GFSRA+   P T ++
Sbjct  1    PEVTDPICRFPLPTFIHRLEAVHLGDLMRISVRAGANVQQRNPPTGFSRASRKRPRTPQK  60



>ref|XP_011065976.1| PREDICTED: uncharacterized protein LOC105153053, partial [Acromyrmex 
echinatior]
Length=178

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 53/95 (56%), Gaps = 1/95 (1%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRSSGFS-RAAGGA  290
            P LRANP+ EVTDP CRLPLPTL +  EA++LGDL+R+ VR G    R      +   G 
Sbjct  51   PLLRANPYSEVTDPICRLPLPTLVYRLEALYLGDLLRIWVRAGATPPRGPLLDFQGPRGR  110

Query  289  PDTTRRVVLFQPLDPTSG*AVSRVGRLLNRKDNSS  185
                R     +  +P S   VSR    L RK+NSS
Sbjct  111  SGHRRNCGALRVPNPISLLEVSRELERLYRKENSS  145



>gb|EFN65035.1| hypothetical protein EAG_01178 [Camponotus floridanus]
Length=298

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 54/95 (57%), Gaps = 1/95 (1%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRSSGFS-RAAGGA  290
            P LRANP+ EVTDP CRLPLPTLF+  EA++LGDL+R+ VR G    R      +   G 
Sbjct  64   PLLRANPYSEVTDPICRLPLPTLFYRLEALYLGDLLRIWVRTGATPPRGPLLDFQGPRGR  123

Query  289  PDTTRRVVLFQPLDPTSG*AVSRVGRLLNRKDNSS  185
                R     +  +P S   VSR    L RK+NSS
Sbjct  124  SGHRRNCGALRVPNPISLLEVSRELERLYRKENSS  158



>gb|EFN71375.1| hypothetical protein EAG_03557 [Camponotus floridanus]
Length=306

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -1

Query  469  CPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRSSGFS-RAAGG  293
             P LRANP+ EVTDP CRLPLPTLF+  EA++LGDL+R+ VR G    R      +   G
Sbjct  63   APLLRANPYSEVTDPICRLPLPTLFYRLEALYLGDLLRIWVRTGATPPRGPLLDFQGPRG  122

Query  292  APDTTRRVVLFQPLDPTSG*AVSRVGRLLNRKDNSS  185
                 R     +  +P S   VSR    L RK+NSS
Sbjct  123  RSGHRRNCGALRVPNPISLLEVSRELERLYRKENSS  158



>ref|XP_003367168.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46197.1| conserved hypothetical protein [Trichinella spiralis]
Length=117

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 13/90 (14%)
 Frame = -3

Query  434  YGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFKGRRG--RTGHHATCGAL  261
            YGS+LPTSL YI+  ARG SPWRP A +STT         I++   G  RT   A     
Sbjct  1    YGSVLPTSLTYIILSARGYSPWRPAADISTTK------YEIYQASLGFSRTDESAPNTVK  54

Query  260  PAA-----GPYLRLSRFQGGQAVKQKR*LF  186
             +A      PYLR +RFQG + +K+K+ LF
Sbjct  55   KSAFYGYQNPYLRTTRFQGMRPLKEKKTLF  84



>gb|KFK40657.1| hypothetical protein AALP_AA2G024900 [Arabis alpina]
Length=120

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAKWIRNFGKRIGSE W RGSQ RT
Sbjct  1    MEQCRQGKSAKWIRNFGKRIGSEDWVRGSQFRT  33



>emb|CCD58974.1| hypothetical protein Smp_177580 [Schistosoma mansoni]
Length=138

 Score = 45.8 bits (107),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQ  385
             +P EPIL PKLRI FADFP LHCSI +
Sbjct  67   TRPPEPILLPKLRIQFADFPYLHCSIAR  94


 Score = 33.5 bits (75),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  328  TRSSGFSRAAGGAPDTTRRVVLF  260
            T S GFSRA    PDTTRRVVL+
Sbjct  114  TASLGFSRADKSVPDTTRRVVLY  136


 Score = 29.3 bits (64),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -3

Query  392  LARGCSPWRPDAVMSTTGRGRHS  324
            +ARGCSPWRP A M T     ++
Sbjct  92   IARGCSPWRPAADMGTACHENYT  114



>gb|ABR25643.1| unknown [Oryza sativa Indica Group]
 gb|ABR25910.1| unknown [Oryza sativa Indica Group]
 gb|ABR26142.1| unknown [Oryza sativa Indica Group]
Length=39

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAK IRNFGKRIGSEGWARGS+ RT
Sbjct  1    MEQCRQGKSAKRIRNFGKRIGSEGWARGSRPRT  33



>ref|XP_002488927.1| hypothetical protein SORBIDRAFT_1610s002010 [Sorghum bicolor]
 gb|EES20326.1| hypothetical protein SORBIDRAFT_1610s002010 [Sorghum bicolor]
Length=86

 Score = 62.0 bits (149),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            MEQCRQGKSAK IRNFGKRIGSEGWARGS+ RT
Sbjct  1    MEQCRQGKSAKRIRNFGKRIGSEGWARGSRPRT  33


 Score = 26.9 bits (58),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 12/12 (100%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = +1

Query  571  NGSFGGLPRASN  606
            NGSFGGLPRASN
Sbjct  61   NGSFGGLPRASN  72



>emb|CCD58990.1| hypothetical protein Smp_184280 [Schistosoma mansoni]
Length=124

 Score = 43.5 bits (101),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
 Frame = -2

Query  315  DFQGPPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC--*TEKITLPEAPADVSGI  157
            DFQGP  A RTP++ WC +    L P +P PG  GC    EK TLP   ADVS +
Sbjct  45   DFQGPTRAFRTPQEGWCFTEASPLSPDKPIPG-GGCTPNKEKRTLPRTLADVSEV  98


 Score = 33.1 bits (74),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  446  FSRSYGSILPTSLAYIVPL  390
            FSRSYGS LPTSL YIV L
Sbjct  1    FSRSYGSNLPTSLTYIVQL  19


 Score = 32.0 bits (71),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = -1

Query  409  LPTLFHWPEAVHLGDLMRL*VRPGVD  332
            L  +   PEAVHLGDL+R+ VRP   
Sbjct  13   LTYIVQLPEAVHLGDLLRIWVRPATK  38



>ref|XP_009056830.1| hypothetical protein LOTGIDRAFT_145533 [Lottia gigantea]
 ref|XP_009056833.1| hypothetical protein LOTGIDRAFT_145536 [Lottia gigantea]
 ref|XP_009057393.1| hypothetical protein LOTGIDRAFT_145690 [Lottia gigantea]
 ref|XP_009064700.1| hypothetical protein LOTGIDRAFT_148309 [Lottia gigantea]
 gb|ESO84612.1| hypothetical protein LOTGIDRAFT_148309 [Lottia gigantea]
 gb|ESO91919.1| hypothetical protein LOTGIDRAFT_145690 [Lottia gigantea]
 gb|ESO92479.1| hypothetical protein LOTGIDRAFT_145533 [Lottia gigantea]
 gb|ESO92482.1| hypothetical protein LOTGIDRAFT_145536 [Lottia gigantea]
Length=49

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  461  PQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDA  357
            PQSQSFSRSYGSILPTSL YIV   RGC PWRP A
Sbjct  14   PQSQSFSRSYGSILPTSLTYIVLSTRGCEPWRPAA  48



>ref|XP_007157256.1| hypothetical protein PHAVU_002G055400g [Phaseolus vulgaris]
 gb|ESW29250.1| hypothetical protein PHAVU_002G055400g [Phaseolus vulgaris]
Length=95

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  402  VGKGSRQNGSVTSGKGLALRAGHGGPSPEPVGC  500
            +GKGSRQNGSVTSGKGLALRAGHGGPSPE VGC
Sbjct  1    MGKGSRQNGSVTSGKGLALRAGHGGPSPETVGC  33



>gb|EFX62988.1| hypothetical protein DAPPUDRAFT_67487 [Daphnia pulex]
Length=139

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  461  PQSQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGR  336
            PQSQS SRSYGS LPTSL YI+   RGCSPWRP A M T+ R
Sbjct  1    PQSQSLSRSYGSNLPTSLTYIILSTRGCSPWRPAADMGTSWR  42



>emb|CDS30780.1| expressed protein [Hymenolepis microstoma]
Length=190

 Score = 45.1 bits (105),  Expect(3) = 8e-09, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCS  394
            AQPSEPILFP+LRI +ADFP LH S
Sbjct  29   AQPSEPILFPRLRIKYADFPYLHYS  53


 Score = 30.8 bits (68),  Expect(3) = 8e-09, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -3

Query  389  ARGCSPWRPDAVMSTTGRGRHSV  321
            ARG SPWRPDA M T     H+ 
Sbjct  55   ARGSSPWRPDADMGTACHENHNA  77


 Score = 30.4 bits (67),  Expect(3) = 8e-09, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = -1

Query  322  SSGFSRAAGGAPDTTRRVVLFQPLDPTSG*AVSRVG  215
            S GFSRA    PDTTR VVL+    P SG   SR G
Sbjct  78   SLGFSRADKSVPDTTRGVVLYGGETPISGQPDSRGG  113



>emb|CCD58314.1| unnamed protein product [Schistosoma mansoni]
Length=138

 Score = 42.4 bits (98),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQ  385
             +P +PIL  KLRI FADFP LHCSI +
Sbjct  67   TRPPQPILLAKLRIQFADFPYLHCSIAR  94


 Score = 33.9 bits (76),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = -1

Query  328  TRSSGFSRAAGGAPDTTRRVVLFQ  257
            T S GFSRA    PDTTRRVVL++
Sbjct  114  TASLGFSRADKSVPDTTRRVVLYR  137


 Score = 29.3 bits (64),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  392  LARGCSPWRPDAVMST  345
            +ARGCSPWRP A M T
Sbjct  92   IARGCSPWRPAADMGT  107



>gb|KDO43533.1| hypothetical protein CISIN_1g045002mg [Citrus sinensis]
Length=164

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARG  475
            MEQCRQGKSAKWIRNFGKRIGSEGWA+G
Sbjct  1    MEQCRQGKSAKWIRNFGKRIGSEGWAQG  28



>ref|XP_003850790.1| hypothetical protein MYCGRDRAFT_30868, partial [Zymoseptoria 
tritici IPO323]
 ref|XP_003850794.1| hypothetical protein MYCGRDRAFT_30869, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP85766.1| hypothetical protein MYCGRDRAFT_30868 [Zymoseptoria tritici IPO323]
 gb|EGP85770.1| hypothetical protein MYCGRDRAFT_30869 [Zymoseptoria tritici IPO323]
Length=51

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 39/65 (60%), Gaps = 14/65 (22%)
 Frame = +3

Query  285  SGAPPAALENPEDRVPSTPGRTHNRIRSPR*TASGQWNNVGKGSRQNGSVTSGKGLALRA  464
            SGA P  LENP + +  TPGRTHNR RSP              SRQN SVTSGKGLALR 
Sbjct  1    SGALPTILENPPEGMIFTPGRTHNRSRSP--------------SRQNRSVTSGKGLALRV  46

Query  465  GHGGP  479
            G  GP
Sbjct  47   GRVGP  51



>ref|XP_002959387.1| hypothetical protein VOLCADRAFT_84876 [Volvox carteri f. nagariensis]
 ref|XP_002959431.1| hypothetical protein VOLCADRAFT_78370 [Volvox carteri f. nagariensis]
 ref|XP_002959572.1| hypothetical protein VOLCADRAFT_84959 [Volvox carteri f. nagariensis]
 ref|XP_002959731.1| hypothetical protein VOLCADRAFT_85005 [Volvox carteri f. nagariensis]
 ref|XP_002959809.1| hypothetical protein VOLCADRAFT_78464 [Volvox carteri f. nagariensis]
 ref|XP_002959843.1| hypothetical protein VOLCADRAFT_78496 [Volvox carteri f. nagariensis]
 ref|XP_002959867.1| hypothetical protein VOLCADRAFT_78524 [Volvox carteri f. nagariensis]
 ref|XP_002959942.1| hypothetical protein VOLCADRAFT_78548 [Volvox carteri f. nagariensis]
 ref|XP_002959959.1| hypothetical protein VOLCADRAFT_78555 [Volvox carteri f. nagariensis]
 ref|XP_002959974.1| hypothetical protein VOLCADRAFT_78574 [Volvox carteri f. nagariensis]
 gb|EFJ38961.1| hypothetical protein VOLCADRAFT_78574 [Volvox carteri f. nagariensis]
 gb|EFJ38976.1| hypothetical protein VOLCADRAFT_78555 [Volvox carteri f. nagariensis]
 gb|EFJ38993.1| hypothetical protein VOLCADRAFT_78548 [Volvox carteri f. nagariensis]
 gb|EFJ39069.1| hypothetical protein VOLCADRAFT_78524 [Volvox carteri f. nagariensis]
 gb|EFJ39092.1| hypothetical protein VOLCADRAFT_78496 [Volvox carteri f. nagariensis]
 gb|EFJ39126.1| hypothetical protein VOLCADRAFT_78464 [Volvox carteri f. nagariensis]
 gb|EFJ39204.1| hypothetical protein VOLCADRAFT_85005 [Volvox carteri f. nagariensis]
 gb|EFJ39363.1| hypothetical protein VOLCADRAFT_84959 [Volvox carteri f. nagariensis]
 gb|EFJ39505.1| hypothetical protein VOLCADRAFT_78370 [Volvox carteri f. nagariensis]
 gb|EFJ39551.1| hypothetical protein VOLCADRAFT_84876 [Volvox carteri f. nagariensis]
Length=67

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  317  RIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR*LF  186
            RIFK R+ R GH   CGALP + PYLR+ RFQG + VK+KR LF
Sbjct  4    RIFKDRQRRAGHREKCGALPTSEPYLRMIRFQGLRVVKKKRELF  47



>ref|XP_002954151.1| hypothetical protein VOLCADRAFT_64350 [Volvox carteri f. nagariensis]
 ref|XP_002959386.1| hypothetical protein VOLCADRAFT_70866, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959552.1| hypothetical protein VOLCADRAFT_71333, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959672.1| hypothetical protein VOLCADRAFT_71544, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959973.1| hypothetical protein VOLCADRAFT_72128, partial [Volvox carteri 
f. nagariensis]
 gb|EFJ38963.1| hypothetical protein VOLCADRAFT_72128 [Volvox carteri f. nagariensis]
 gb|EFJ39263.1| hypothetical protein VOLCADRAFT_71544 [Volvox carteri f. nagariensis]
 gb|EFJ39384.1| hypothetical protein VOLCADRAFT_71333 [Volvox carteri f. nagariensis]
 gb|EFJ39550.1| hypothetical protein VOLCADRAFT_70866 [Volvox carteri f. nagariensis]
 gb|EFJ44868.1| hypothetical protein VOLCADRAFT_64350 [Volvox carteri f. nagariensis]
Length=78

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  317  RIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR*LF  186
            RIFK R+ R GH   CGALP + PYLR+ RFQG + VK+KR LF
Sbjct  15   RIFKDRQRRAGHREKCGALPTSEPYLRMIRFQGLRVVKKKRELF  58



>dbj|GAA96382.1| hypothetical protein E5Q_03049 [Mixia osmundae IAM 14324]
Length=352

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -1

Query  472  PCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRSS-GFSRAAG  296
            P   L  NPFPEVTD  CRLPL TLF+  EA HLGDLMRL VR       +S GFSR   
Sbjct  152  PREQLEPNPFPEVTDLICRLPLSTLFYGLEADHLGDLMRLWVRASAKQIFTSLGFSRTVE  211

Query  295  GAPDTTRR  272
                 +R+
Sbjct  212  RKTRPSRK  219



>ref|XP_004213354.1| PREDICTED: uncharacterized protein LOC101237314, partial [Hydra 
vulgaris]
Length=46

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  496  PTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHL  371
            P  S L P  P L+ANPFPEVTD F +LPLPTLF+ PEA HL
Sbjct  2    PLASSLSPTDPILKANPFPEVTDLFSQLPLPTLFYGPEAAHL  43



>gb|KEI36131.1| hypothetical protein L969DRAFT_613963, partial [Mixia osmundae 
IAM 14324]
Length=352

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -1

Query  472  PCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL*VRPGVDGTRSS-GFSRAAG  296
            P   L  NPFPEVTD  CRLPL TLF+  EA HLGDLMRL VR       +S GFSR   
Sbjct  152  PREQLEPNPFPEVTDLICRLPLSTLFYGLEADHLGDLMRLWVRASAKQIFTSLGFSRTVE  211

Query  295  GAPDTTRR  272
                 +R+
Sbjct  212  RKTRPSRK  219



>ref|XP_006678622.1| hypothetical protein BATDEDRAFT_88304 [Batrachochytrium dendrobatidis 
JAM81]
 ref|XP_006680450.1| hypothetical protein BATDEDRAFT_90244 [Batrachochytrium dendrobatidis 
JAM81]
 ref|XP_006682252.1| hypothetical protein BATDEDRAFT_91878 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77043.1| hypothetical protein BATDEDRAFT_91878 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78783.1| hypothetical protein BATDEDRAFT_90244 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80574.1| hypothetical protein BATDEDRAFT_88304 [Batrachochytrium dendrobatidis 
JAM81]
Length=110

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  454  ANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
            ANPFP+VTD FCRLPL TLF+  EAVHLGDL+RL
Sbjct  77   ANPFPKVTDLFCRLPLSTLFYQLEAVHLGDLLRL  110



>ref|XP_002068663.1| GK12697 [Drosophila willistoni]
 gb|EDW79649.1| GK12697 [Drosophila willistoni]
Length=182

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 5/76 (7%)
 Frame = -1

Query  577  SRSQSVPRPARGDPLSPR*QLEQSAE-QPTGSGLGPPCPALRANPFPEVTDPFCRLPLPT  401
            +R ++ P P RG   +PR   E++A+ + T  G+    P  RANP+PEVTD  CRLPLPT
Sbjct  85   ARVEANPGP-RGPAAAPR---ERTADGECTREGIARVIPVFRANPYPEVTDLICRLPLPT  140

Query  400  LFHWPEAVHLGDLMRL  353
            L +  E ++LGDL+R+
Sbjct  141  LIYRLETLNLGDLLRI  156



>ref|XP_002449486.1| hypothetical protein SORBIDRAFT_05g016472 [Sorghum bicolor]
 gb|EES08474.1| hypothetical protein SORBIDRAFT_05g016472 [Sorghum bicolor]
Length=45

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  398  QCRQGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            QCRQGKSA WIRNF KRIGS+GWARGSQ RT
Sbjct  1    QCRQGKSAIWIRNFEKRIGSDGWARGSQPRT  31



>gb|EMF07896.1| hypothetical protein SEPMUDRAFT_11882, partial [Sphaerulina musiva 
SO2202]
Length=51

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 14/65 (22%)
 Frame = +3

Query  285  SGAPPAALENPEDRVPSTPGRTHNRIRSPR*TASGQWNNVGKGSRQNGSVTSGKGLALRA  464
            SGA    LENP + +  TPGRTHNR RSP              SRQN SVTSGKGLALR 
Sbjct  1    SGALLTTLENPPEGMIFTPGRTHNRSRSP--------------SRQNRSVTSGKGLALRV  46

Query  465  GHGGP  479
            G  GP
Sbjct  47   GRVGP  51



>ref|XP_002488908.1| hypothetical protein SORBIDRAFT_2026s002010 [Sorghum bicolor]
 gb|EES20398.1| hypothetical protein SORBIDRAFT_2026s002010 [Sorghum bicolor]
Length=52

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +2

Query  392  MEQCRQGKSAKWIRNFGKRIGSEGWARG  475
            MEQCRQGKSAK IRNFGKRIGSEGWARG
Sbjct  1    MEQCRQGKSAKRIRNFGKRIGSEGWARG  28



>ref|XP_007682034.1| hypothetical protein BAUCODRAFT_127550 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC90809.1| hypothetical protein BAUCODRAFT_127550 [Baudoinia compniacensis 
UAMH 10762]
Length=196

 Score = 56.2 bits (134),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  386  RGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTG  285
            +GCSPWRP AVMSTT R  HS  RIFKGRR RTG
Sbjct  63   KGCSPWRPAAVMSTTWRENHSFQRIFKGRRERTG  96


 Score = 25.4 bits (54),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = -2

Query  471  RAQPSEPILFPK  436
            RAQP EPILFPK
Sbjct  52   RAQPLEPILFPK  63



>ref|XP_006301481.1| hypothetical protein CARUB_v10021904mg, partial [Capsella rubella]
 gb|EOA34379.1| hypothetical protein CARUB_v10021904mg, partial [Capsella rubella]
Length=72

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +2

Query  407  QGKSAKWIRNFGKRIGSEGWARGSQSRT  490
            QGKSAKWIRNFGKRIGSEGWARGSQ RT
Sbjct  1    QGKSAKWIRNFGKRIGSEGWARGSQFRT  28



>emb|CDI96790.1| rRNA promoter binding protein, partial [Echinococcus multilocularis]
Length=279

 Score = 43.5 bits (101),  Expect(3) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCS  394
             QPSEPILFP+LRI +ADFP LH S
Sbjct  92   TQPSEPILFPRLRIKYADFPYLHYS  116


 Score = 28.1 bits (61),  Expect(3) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -3

Query  389  ARGCSPWRPDAVMST  345
            ARG SPWRPDA M T
Sbjct  118  ARGSSPWRPDADMGT  132


 Score = 28.1 bits (61),  Expect(3) = 4e-07, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -1

Query  334  DGTRSSGFSRAAGGAPDTTRRVVLF  260
            + T S GFSRA    PDTT  VVL+
Sbjct  137  NNTASLGFSRAYKSLPDTTGEVVLY  161



>ref|XP_002169999.2| PREDICTED: uncharacterized protein LOC100210481 [Hydra vulgaris]
Length=119

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 49/110 (45%), Gaps = 21/110 (19%)
 Frame = +3

Query  267  TTRRVVSGAPPAALENPEDRVPSTPGRTHNRIRSPR*TASGQWNNVGKGSRQNGSVTSGK  446
            TT  VVSGA   ALENP +R+     RTHNR RSP                  GSVTSGK
Sbjct  4    TTLLVVSGALLTALENPRERLIFASVRTHNRSRSP------------------GSVTSGK  45

Query  447  GLALRAGHGGPSPEPVGCSADCSSCYRGESGSPRAGRGTDWERLFRGPSP  596
            GLALR G  G   E  G      +     S     G G +WE   RG + 
Sbjct  46   GLALRIGSVGLRLEASGTDLGWLA---ASSAHVAGGCGLEWEGTSRGLAQ  92



>ref|XP_010835501.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 726-like, 
partial [Bison bison bison]
Length=399

 Score = 57.0 bits (136),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -2

Query  468  AQPSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYEYDRA  337
             QP EPIL PKLRI  ADFP       QRLFTLET CGY Y RA
Sbjct  54   TQPLEPILIPKLRIRLADFPTYIVPTCQRLFTLETCCGYGYGRA  97


 Score = 22.7 bits (47),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 0/26 (0%)
 Frame = -3

Query  317  RIFKGRRGRTGHHATCGALPAAGPYL  240
            RIFKG+R  TG      A    GP L
Sbjct  105  RIFKGQRELTGRRRNRDAFQGTGPSL  130



>gb|EHK22827.1| hypothetical protein TRIVIDRAFT_29449, partial [Trichoderma virens 
Gv29-8]
Length=106

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  QSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRGRHSVLRIFK  306
            QSF +SYGSILPTSL YI    RGCSPWRP AV +      H +   F 
Sbjct  1    QSFPQSYGSILPTSLIYIALSTRGCSPWRPAAVAALILSALHPIFPPFN  49



>emb|CDI99531.1| rRNA promoter binding protein [Echinococcus multilocularis]
 emb|CDS36813.1| rRNA promoter binding protein [Echinococcus multilocularis]
Length=311

 Score = 42.4 bits (98),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  465  QPSEPILFPKLRIHFADFPCLHCS  394
            +PSEPILFP+LRI +ADFP LH S
Sbjct  113  RPSEPILFPRLRIKYADFPYLHYS  136


 Score = 28.1 bits (61),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -3

Query  389  ARGCSPWRPDAVMST  345
            ARG SPWRPDA M T
Sbjct  138  ARGSSPWRPDADMGT  152


 Score = 27.7 bits (60),  Expect(3) = 2e-06, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -1

Query  334  DGTRSSGFSRAAGGAPDTTRRVVLF  260
            + T S GFSRA    PDTT  VVL+
Sbjct  157  NNTASLGFSRAYKSLPDTTGEVVLY  181



>gb|KFD59988.1| LOW QUALITY PROTEIN: hypothetical protein M514_27836 [Trichuris 
suis]
Length=791

 Score = 50.8 bits (120),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  434  YGSILPTSLAYIVPLARGCSPWRPDAVMSTTGRG  333
            YGS+LPTSL  IV LARGCSPWRP A M T+  G
Sbjct  25   YGSVLPTSLICIVQLARGCSPWRPAADMGTSEHG  58


 Score = 27.7 bits (60),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 22/46 (48%), Gaps = 0/46 (0%)
 Frame = -2

Query  312  FQGPPGAHRTPRDVWCSSSRWTLPPAEPFPGWAGC*TEKITLPEAP  175
            F GP  A RTPR+    ++  +L P  P P  A    ++   PE P
Sbjct  66   FHGPSRAFRTPRETRRFAATSSLSPDNPVPATACLMKKRKLFPELP  111



>ref|XP_005706714.1| rRNA promoter binding protein [Galdieria sulphuraria]
 gb|EME30194.1| rRNA promoter binding protein [Galdieria sulphuraria]
Length=97

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  466  PALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDLMRL  353
              LRANP P+VTDP CR+PL ++F+  EA HLG LMR 
Sbjct  35   ATLRANPCPKVTDPICRIPLSSIFYQLEATHLGVLMRF  72



>ref|XP_007417427.1| hypothetical protein MELLADRAFT_94724 [Melampsora larici-populina 
98AG31]
 ref|XP_007417442.1| hypothetical protein MELLADRAFT_94741 [Melampsora larici-populina 
98AG31]
 gb|EGF99312.1| hypothetical protein MELLADRAFT_94741 [Melampsora larici-populina 
98AG31]
 gb|EGF99325.1| hypothetical protein MELLADRAFT_94724 [Melampsora larici-populina 
98AG31]
Length=76

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  467  PSPQSQSFSRSYGSILPTSLAYIVPLARGCSP  372
            P P SQSFS SYGSILPTSL YI+ L RGCSP
Sbjct  45   PCPMSQSFSLSYGSILPTSLIYIILLTRGCSP  76



>ref|XP_004213260.1| PREDICTED: uncharacterized protein LOC100200968 [Hydra vulgaris]
Length=112

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 47/106 (44%), Gaps = 21/106 (20%)
 Frame = +3

Query  279  VVSGAPPAALENPEDRVPSTPGRTHNRIRSPR*TASGQWNNVGKGSRQNGSVTSGKGLAL  458
            +VSGA   ALENP +R+     RTHNR RSPR                  SVTSGKGLAL
Sbjct  1    MVSGALLTALENPRERLIFASVRTHNRSRSPR------------------SVTSGKGLAL  42

Query  459  RAGHGGPSPEPVGCSADCSSCYRGESGSPRAGRGTDWERLFRGPSP  596
            R G  G   E  G      +     S     G G +WE   RG + 
Sbjct  43   RIGSVGLRLEASGTDLGWLA---ASSAHVAGGCGLEWEGTARGLAQ  85



>gb|EYC33859.1| hypothetical protein Y032_0001g130 [Ancylostoma ceylanicum]
Length=70

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 7/51 (14%)
 Frame = -1

Query  514  EQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGDL  362
            + S  +PT S  G       ANP PEVTD  CRLPLP+LF   E VHLGDL
Sbjct  22   QASVNRPTDSVTG-------ANPLPEVTDLICRLPLPSLFCRLEVVHLGDL  65



>gb|ELR45475.1| hypothetical protein M91_21675 [Bos mutus]
Length=439

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 56/118 (47%), Gaps = 22/118 (19%)
 Frame = -3

Query  491  GFGTGTP--------VPSPQ---SQSFSRSYGSILPTSLAYIVPLARGCSPWRPDAVMST  345
            G GTG P        +P PQ   SQS SRSYGS LPTSL YIVP  +     R   + + 
Sbjct  266  GEGTGHPDARTRTHILPRPQLCASQSLSRSYGSGLPTSLTYIVPTCQ-----RLFTLETC  320

Query  344  TG------RGRHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLSRFQGGQAVKQKR*L  189
             G      R  H + RIFKG+R  TG      A    GP L  + FQG     +KR L
Sbjct  321  CGYGYGPARDLHPLPRIFKGQRELTGRRRNRDAFQGTGPSLGANPFQGALPFTKKREL  378



>ref|XP_007335730.1| hypothetical protein AGABI1DRAFT_49526, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM73632.1| hypothetical protein AGABI1DRAFT_49526, partial [Agaricus bisporus 
var. burnettii JB137-S8]
Length=50

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 34/59 (58%), Gaps = 14/59 (24%)
 Frame = +3

Query  336  TPGRTHNRIRSPR*TASGQWNNVGKGSRQNGSVTSGKGLALRAGHGGPSPEPVGCSADC  512
            TPGRTHNR RSP              SRQN SVTSGKGLALR G  GP  E  G S DC
Sbjct  1    TPGRTHNRSRSP--------------SRQNRSVTSGKGLALRVGCVGPWLEASGPSWDC  45



>emb|CDS21134.1| rRNA promoter binding protein [Echinococcus granulosus]
Length=288

 Score = 40.0 bits (92),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  464  SPQSQSFSRSYGSILPTSLAYIV  396
            SPQSQSFSR YGS +PTSL YI+
Sbjct  180  SPQSQSFSRGYGSSMPTSLTYII  202


 Score = 35.4 bits (80),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = -2

Query  327  LGPPDFQGPPGAHRTPRDVWCSSSRWTLPPAEPFPG  220
            L P DFQGP  A RTP++ WC +    L P  P PG
Sbjct  226  LPPSDFQGPTRAFRTPQERWCFTEVIPLSPDNPIPG  261



>ref|XP_001618573.1| hypothetical protein NEMVEDRAFT_v1g77308 [Nematostella vectensis]
 ref|XP_001619438.1| hypothetical protein NEMVEDRAFT_v1g77170 [Nematostella vectensis]
 ref|XP_001619684.1| hypothetical protein NEMVEDRAFT_v1g150581, partial [Nematostella 
vectensis]
 ref|XP_001622473.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO26473.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO27338.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO27584.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO30373.1| predicted protein, partial [Nematostella vectensis]
Length=55

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 35/73 (48%), Gaps = 18/73 (25%)
 Frame = +3

Query  279  VVSGAPPAALENPEDRVPSTPGRTHNRIRSPR*TASGQWNNVGKGSRQNGSVTSGKGLAL  458
            VVSGA   ALEN    +    GRTHNR RSPR                  SVTSGKGLAL
Sbjct  1    VVSGALSTALENSGKTLIFVSGRTHNRSRSPR------------------SVTSGKGLAL  42

Query  459  RAGHGGPSPEPVG  497
            R G  G   E  G
Sbjct  43   RVGSVGLRLEASG  55



>gb|EJS85218.1| hypothetical protein AAUPMB_20797, partial [Pasteurella multocida 
subsp. multocida str. Anand1_buffalo]
Length=77

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  420  QNGSVTSGKGLALRAGHGGPSPEPVGC  500
            QNGSVTSGKGLALR G GGP PEPVGC
Sbjct  1    QNGSVTSGKGLALRVGLGGPGPEPVGC  27



>ref|XP_001869359.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS29077.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=244

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -1

Query  517  LEQSAEQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHWPEAVHLGD  365
            L QS  + T + +    PA RANP+PEVTD  CRLPLPTL +  E ++LGD
Sbjct  65   LRQSTREGTRARV---IPAFRANPYPEVTDLICRLPLPTLIYRLETLNLGD  112



>gb|EJS83295.1| hypothetical protein AAUPMC_21151, partial [Pasteurella multocida 
subsp. multocida str. Anand1_cattle]
Length=80

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +3

Query  474  GPSPEPVGCSADCSSCYRGESGSPRAGRGTDWERLFR  584
            GP P P   +ADCSSC RGESG PRAGRGTD ER  R
Sbjct  8    GPGPNP-SAAADCSSCSRGESGPPRAGRGTDRERFLR  43



>ref|XP_002167660.2| PREDICTED: uncharacterized protein LOC100208907, partial [Hydra 
vulgaris]
Length=110

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 45/104 (43%), Gaps = 21/104 (20%)
 Frame = +3

Query  285  SGAPPAALENPEDRVPSTPGRTHNRIRSPR*TASGQWNNVGKGSRQNGSVTSGKGLALRA  464
            SGA   ALENP +R+     RTHNR RSPR                  SVTSGKGLALR 
Sbjct  1    SGALLTALENPRERLIFASVRTHNRSRSPR------------------SVTSGKGLALRI  42

Query  465  GHGGPSPEPVGCSADCSSCYRGESGSPRAGRGTDWERLFRGPSP  596
            G  G   E  G      +     S     G G +WE   RG + 
Sbjct  43   GSVGLRLEASGTDLGWLA---ASSAHVAGGCGLEWEGTARGLAQ  83



>ref|XP_002948757.1| hypothetical protein VOLCADRAFT_58557 [Volvox carteri f. nagariensis]
 ref|XP_002959508.1| hypothetical protein VOLCADRAFT_84934 [Volvox carteri f. nagariensis]
 ref|XP_002959732.1| hypothetical protein VOLCADRAFT_71702 [Volvox carteri f. nagariensis]
 ref|XP_002959756.1| hypothetical protein VOLCADRAFT_71750 [Volvox carteri f. nagariensis]
 ref|XP_002959938.1| hypothetical protein VOLCADRAFT_78546 [Volvox carteri f. nagariensis]
 ref|XP_002959952.1| hypothetical protein VOLCADRAFT_72080 [Volvox carteri f. nagariensis]
 gb|EFJ38983.1| hypothetical protein VOLCADRAFT_72080 [Volvox carteri f. nagariensis]
 gb|EFJ38997.1| hypothetical protein VOLCADRAFT_78546 [Volvox carteri f. nagariensis]
 gb|EFJ39179.1| hypothetical protein VOLCADRAFT_71750 [Volvox carteri f. nagariensis]
 gb|EFJ39203.1| hypothetical protein VOLCADRAFT_71702 [Volvox carteri f. nagariensis]
 gb|EFJ39427.1| hypothetical protein VOLCADRAFT_84934 [Volvox carteri f. nagariensis]
 gb|EFJ50137.1| hypothetical protein VOLCADRAFT_58557 [Volvox carteri f. nagariensis]
Length=63

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +1

Query  73   RQRVLRVRRKGIGLKFLNRDVAVDGNVRDSGDVGGGLGKSYLFCLTACPPWKRLSRR  243
            +  +    RKG GL+F   D A  GN  + GD+G G GKS LF LT   PW R+ RR
Sbjct  7    KSAICASHRKGKGLRFPYLDKAAGGNASEPGDIGIGPGKSSLFFLTTRRPWNRIIRR  63



>ref|XP_007371707.1| hypothetical protein DICSQDRAFT_150876 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF55552.1| hypothetical protein DICSQDRAFT_150876 [Dichomitus squalens LYAD-421 
SS1]
Length=200

 Score = 47.0 bits (110),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  386  RGCSPWRPDAVMSTTGRGRHSVLRIFKGRRGRTG  285
            +GCSPWRP AVMSTT R  +S   IFKG R RTG
Sbjct  74   KGCSPWRPAAVMSTTRRENYSFPWIFKGCRERTG  107


 Score = 25.0 bits (53),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -1

Query  277  RRVVLFQPLDPTSG*AVSRVGRLLN  203
            R V L+QPL+P+SG    RV RL +
Sbjct  110  RGVELYQPLNPSSGQTDFRVDRLTH  134



>ref|XP_003190886.1| hypothetical protein AOR_1_208044 [Aspergillus oryzae RIB40]
Length=81

 Score = 35.4 bits (80),  Expect(3) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = -3

Query  353  MSTTGRGRHSVLRIFKGRRGRTGHHATC  270
            MSTT R  +S  RIFKGRRGRTG    C
Sbjct  1    MSTTWRENYSFPRIFKGRRGRTGPRKGC  28


 Score = 30.8 bits (68),  Expect(3) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = -2

Query  213  GC*TEKITLPEAPADVSGIPNVAV  142
            GC  EK TLP  PADVS    VAV
Sbjct  27   GCQEEKRTLPRTPADVSAFSYVAV  50


 Score = 24.6 bits (52),  Expect(3) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -1

Query  127  GSGILTRFPFGARAKRA  77
            G+G+LT FPFG R  RA
Sbjct  56   GAGMLTGFPFGTRRTRA  72



>ref|XP_009354582.1| PREDICTED: uncharacterized protein LOC103945712 [Pyrus x bretschneideri]
Length=257

 Score = 36.2 bits (82),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  494  DGFGTGTPVPSPQSQSFSR  438
            DGF  GTPVP PQSQSFSR
Sbjct  112  DGFQAGTPVPIPQSQSFSR  130


 Score = 35.0 bits (79),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  606  VRRPGKAPERAVPSPSPGRHAAT  538
            VR PGK P R VP  SPGRHAAT
Sbjct  75   VRCPGKVPGRTVPGLSPGRHAAT  97



>ref|WP_035397696.1| hypothetical protein [Chlamydia psittaci]
Length=136

 Score = 43.9 bits (102),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 42/88 (48%), Gaps = 7/88 (8%)
 Frame = +1

Query  97   RKGIGLKFLNRD-------VAVDGNVRDSGDVGGGLGKSYLFCLTACPPWKRLSRR*GPA  255
            RKG+G +  N +        A  GN  D G+ GG  G+S LF +    PW   + R GPA
Sbjct  27   RKGVGFRSPNPERRRRAPRGAQCGNASDPGEAGGSPGESSLFFVKGRAPWNGFAPREGPA  86

Query  256  AGRAPHVAWCPVRPRRPLKIRRTECRPR  339
              +A      PV  R P+KIR   C+ R
Sbjct  87   PWKASRFRRRPVSSRWPVKIRGRGCKSR  114


 Score = 26.9 bits (58),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = +2

Query  347  YS*PHQVSKVNSLW  388
            Y  P QVSKVNSLW
Sbjct  118  YPYPQQVSKVNSLW  131



>ref|XP_007419020.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 
98AG31]
 gb|EGF97697.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 
98AG31]
Length=347

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  462  PSEPILFPKLRIHFADFPCLHCSIGQRLFTLET*CGYE  349
            P EPILFPKLRI+FADFP LH SI QRL  L    G+ 
Sbjct  107  PYEPILFPKLRIYFADFPYLHYSINQRLARLFKSLGFS  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800