BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016C08 248 bp,

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW62479.1|  hypothetical protein EUGRSUZ_H05117                     147   6e-41   Eucalyptus grandis [rose gum]
ref|XP_010270276.1|  PREDICTED: ultraviolet-B receptor UVR8             149   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006464910.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    149   1e-40   Citrus sinensis [Valencia orange]
ref|XP_006464912.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    149   1e-40   Citrus sinensis [Valencia orange]
ref|XP_006432102.1|  hypothetical protein CICLE_v10001136mg             149   2e-40   Citrus clementina
ref|XP_006432103.1|  hypothetical protein CICLE_v10001136mg             149   2e-40   Citrus clementina
ref|XP_004288153.1|  PREDICTED: ultraviolet-B receptor UVR8             148   2e-40   Fragaria vesca subsp. vesca
ref|XP_010269039.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    148   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010269040.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    147   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010547681.1|  PREDICTED: ultraviolet-B receptor UVR8             147   3e-40   Tarenaya hassleriana [spider flower]
gb|KDO57526.1|  hypothetical protein CISIN_1g013084mg                   147   3e-40   Citrus sinensis [Valencia orange]
gb|KDO57527.1|  hypothetical protein CISIN_1g013084mg                   147   4e-40   Citrus sinensis [Valencia orange]
gb|KDO57529.1|  hypothetical protein CISIN_1g013084mg                   147   4e-40   Citrus sinensis [Valencia orange]
gb|KDO57528.1|  hypothetical protein CISIN_1g013084mg                   147   4e-40   Citrus sinensis [Valencia orange]
gb|KDO57530.1|  hypothetical protein CISIN_1g013084mg                   147   4e-40   Citrus sinensis [Valencia orange]
gb|KCW62482.1|  hypothetical protein EUGRSUZ_H05117                     146   5e-40   Eucalyptus grandis [rose gum]
gb|KDO57531.1|  hypothetical protein CISIN_1g013084mg                   147   5e-40   Citrus sinensis [Valencia orange]
ref|XP_010025746.1|  PREDICTED: ultraviolet-B receptor UVR8             146   8e-40   Eucalyptus grandis [rose gum]
ref|XP_004168089.1|  PREDICTED: probable E3 ubiquitin-protein lig...    144   9e-40   
gb|EYU20594.1|  hypothetical protein MIMGU_mgv1a006243mg                146   2e-39   Erythranthe guttata [common monkey flower]
gb|EYU20595.1|  hypothetical protein MIMGU_mgv1a006243mg                146   2e-39   Erythranthe guttata [common monkey flower]
ref|NP_001267915.1|  probable E3 ubiquitin-protein ligase HERC1-like    145   2e-39   Vitis vinifera
emb|CAN67581.1|  hypothetical protein VITISV_010346                     145   2e-39   Vitis vinifera
emb|CBI21608.3|  unnamed protein product                                145   2e-39   Vitis vinifera
ref|XP_010652779.1|  PREDICTED: probable E3 ubiquitin-protein lig...    145   2e-39   Vitis vinifera
ref|XP_010527204.1|  PREDICTED: ultraviolet-B receptor UVR8             145   2e-39   Tarenaya hassleriana [spider flower]
emb|CDP04605.1|  unnamed protein product                                145   2e-39   Coffea canephora [robusta coffee]
ref|XP_009626009.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    144   3e-39   Nicotiana tomentosiformis
ref|XP_009626007.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    145   4e-39   Nicotiana tomentosiformis
gb|KJB71356.1|  hypothetical protein B456_011G118200                    141   5e-39   Gossypium raimondii
ref|XP_009769438.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    143   6e-39   Nicotiana sylvestris
ref|XP_009626008.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    144   6e-39   Nicotiana tomentosiformis
ref|XP_009769436.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    144   6e-39   Nicotiana sylvestris
ref|XP_010093099.1|  hypothetical protein L484_007908                   144   7e-39   Morus notabilis
ref|XP_004146396.1|  PREDICTED: probable E3 ubiquitin-protein lig...    144   8e-39   
gb|KJB71360.1|  hypothetical protein B456_011G118200                    141   8e-39   Gossypium raimondii
gb|KGN54782.1|  hypothetical protein Csa_4G496230                       144   8e-39   Cucumis sativus [cucumbers]
gb|AHY02156.1|  ultraviolet-B receptor UVR8                             143   1e-38   Betula platyphylla [Asian white birch]
ref|XP_011099677.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    143   2e-38   Sesamum indicum [beniseed]
gb|EMS61853.1|  hypothetical protein TRIUR3_31019                       140   2e-38   Triticum urartu
ref|XP_011099678.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    143   2e-38   Sesamum indicum [beniseed]
ref|XP_002309939.2|  hypothetical protein POPTR_0007s04700g             142   2e-38   Populus trichocarpa [western balsam poplar]
gb|KJB71357.1|  hypothetical protein B456_011G118200                    141   3e-38   Gossypium raimondii
ref|XP_008442146.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    142   4e-38   Cucumis melo [Oriental melon]
ref|XP_007211634.1|  hypothetical protein PRUPE_ppa005822mg             142   4e-38   Prunus persica
ref|XP_008227523.1|  PREDICTED: ultraviolet-B receptor UVR8             142   4e-38   Prunus mume [ume]
ref|XP_008442148.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    141   5e-38   Cucumis melo [Oriental melon]
gb|KDP29458.1|  hypothetical protein JCGZ_19287                         142   5e-38   Jatropha curcas
ref|XP_008442147.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    141   6e-38   
ref|XP_010321071.1|  PREDICTED: ultraviolet-B receptor UVR8             141   8e-38   Solanum lycopersicum
ref|XP_010930682.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    141   8e-38   Elaeis guineensis
gb|KJB71359.1|  hypothetical protein B456_011G118200                    141   8e-38   Gossypium raimondii
gb|KJB71355.1|  hypothetical protein B456_011G118200                    141   9e-38   Gossypium raimondii
ref|XP_010930683.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    141   9e-38   Elaeis guineensis
ref|XP_010930684.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    141   9e-38   Elaeis guineensis
gb|KJB71363.1|  hypothetical protein B456_011G118200                    140   1e-37   Gossypium raimondii
gb|KJB71358.1|  hypothetical protein B456_011G118200                    140   1e-37   Gossypium raimondii
gb|KHG12285.1|  Herc4                                                   141   1e-37   Gossypium arboreum [tree cotton]
ref|XP_011022871.1|  PREDICTED: ultraviolet-B receptor UVR8             140   1e-37   Populus euphratica
ref|XP_003575134.1|  PREDICTED: ultraviolet-B receptor UVR8-like        140   1e-37   Brachypodium distachyon [annual false brome]
gb|KHG12284.1|  Herc4                                                   141   1e-37   Gossypium arboreum [tree cotton]
gb|EEC73389.1|  hypothetical protein OsI_07634                          140   1e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001047115.1|  Os02g0554100                                       140   1e-37   
ref|XP_006647367.1|  PREDICTED: ultraviolet-B receptor UVR8-like        140   1e-37   Oryza brachyantha
dbj|BAJ95741.1|  predicted protein                                      139   2e-37   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008394185.1|  PREDICTED: ultraviolet-B receptor UVR8             140   2e-37   
gb|EMT03905.1|  Putative E3 ubiquitin-protein ligase HERC4              140   2e-37   Aegilops tauschii
dbj|BAJ88198.1|  predicted protein                                      140   3e-37   Hordeum vulgare subsp. vulgare [barley]
pdb|4DNW|A  Chain A, Crystal Structure Of Uvb-resistance Protein ...    138   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866579.1|  UVB-resistance 8                                   139   5e-37   Arabidopsis lyrata subsp. lyrata
pdb|4D9S|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Uv...    138   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112108.1|  PREDICTED: ultraviolet-B receptor UVR8-like        139   6e-37   Brassica rapa
ref|NP_201191.1|  ultraviolet-B receptor UVR8                           139   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010695065.1|  PREDICTED: ultraviolet-B receptor UVR8             139   6e-37   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAD43920.1|AF130441_1  UVB-resistance protein UVR8                   139   7e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81201.1|  BnaC09g06120D                                          139   7e-37   Brassica napus [oilseed rape]
emb|CDY60046.1|  BnaA09g52370D                                          139   7e-37   Brassica napus [oilseed rape]
ref|XP_006338171.1|  PREDICTED: ultraviolet-B receptor UVR8-like        139   7e-37   Solanum tuberosum [potatoes]
ref|XP_006280478.1|  hypothetical protein CARUB_v10026414mg             139   7e-37   Capsella rubella
ref|XP_009350705.1|  PREDICTED: ultraviolet-B receptor UVR8-like        138   8e-37   Pyrus x bretschneideri [bai li]
ref|XP_009350706.1|  PREDICTED: ultraviolet-B receptor UVR8-like        138   8e-37   Pyrus x bretschneideri [bai li]
dbj|BAJ91594.1|  predicted protein                                      138   1e-36   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ92030.1|  predicted protein                                      138   1e-36   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010444307.1|  PREDICTED: ultraviolet-B receptor UVR8-like        138   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010484148.1|  PREDICTED: ultraviolet-B receptor UVR8-like        138   1e-36   Camelina sativa [gold-of-pleasure]
emb|CDY43762.1|  BnaA06g22980D                                          137   1e-36   Brassica napus [oilseed rape]
ref|XP_002522929.1|  uvb-resistance protein uvr8, putative              137   1e-36   Ricinus communis
ref|NP_001052849.1|  Os04g0435700                                       138   2e-36   
gb|KFK28078.1|  hypothetical protein AALP_AA8G469400                    137   2e-36   Arabis alpina [alpine rockcress]
gb|ACN35037.1|  unknown                                                 133   2e-36   Zea mays [maize]
emb|CDX84451.1|  BnaC03g50490D                                          137   2e-36   Brassica napus [oilseed rape]
ref|XP_009355901.1|  PREDICTED: ultraviolet-B receptor UVR8-like        138   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_009150449.1|  PREDICTED: ultraviolet-B receptor UVR8             137   2e-36   Brassica rapa
ref|XP_010461084.1|  PREDICTED: ultraviolet-B receptor UVR8             137   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006652309.1|  PREDICTED: ultraviolet-B receptor UVR8-like        137   2e-36   
ref|XP_002446509.1|  hypothetical protein SORBIDRAFT_06g017130          137   2e-36   Sorghum bicolor [broomcorn]
ref|XP_004975663.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    137   3e-36   
ref|XP_004975662.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    137   3e-36   Setaria italica
ref|XP_009130277.1|  PREDICTED: ultraviolet-B receptor UVR8             136   4e-36   Brassica rapa
dbj|BAJ33982.1|  unnamed protein product                                136   5e-36   Eutrema halophilum
ref|XP_006847198.1|  hypothetical protein AMTR_s00017p00251580          136   5e-36   Amborella trichopoda
ref|XP_006394235.1|  hypothetical protein EUTSA_v10004234mg             136   6e-36   Eutrema salsugineum
pdb|4DNV|A  Chain A, Crystal Structure Of The W285f Mutant Of Uvb...    135   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404858.1|  PREDICTED: ultraviolet-B receptor UVR8-like        135   8e-36   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY31347.1|  BnaA02g33940D                                          135   1e-35   Brassica napus [oilseed rape]
ref|XP_009393818.1|  PREDICTED: ultraviolet-B receptor UVR8-like        135   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS71760.1|  hypothetical protein M569_02995                         135   2e-35   Genlisea aurea
ref|XP_003579788.1|  PREDICTED: ultraviolet-B receptor UVR8-like        135   2e-35   Brachypodium distachyon [annual false brome]
ref|XP_007048504.1|  Regulator of chromosome condensation (RCC1) ...    134   2e-35   Theobroma cacao [chocolate]
ref|XP_007048505.1|  Regulator of chromosome condensation (RCC1) ...    134   2e-35   Theobroma cacao [chocolate]
gb|KHG16477.1|  putative E3 ubiquitin-protein ligase HERC4              134   6e-35   Gossypium arboreum [tree cotton]
ref|XP_003602664.1|  RCC1 and BTB domain-containing protein             133   6e-35   Medicago truncatula
gb|KJB33341.1|  hypothetical protein B456_006G007400                    132   7e-35   Gossypium raimondii
gb|KJB33343.1|  hypothetical protein B456_006G007400                    133   8e-35   Gossypium raimondii
ref|NP_001141147.1|  putative regulator of chromosome condensatio...    133   9e-35   Zea mays [maize]
gb|KJB33342.1|  hypothetical protein B456_006G007400                    132   9e-35   Gossypium raimondii
gb|KJB33340.1|  hypothetical protein B456_006G007400                    132   1e-34   Gossypium raimondii
gb|KJB33344.1|  hypothetical protein B456_006G007400                    132   1e-34   Gossypium raimondii
gb|ACG32833.1|  HECT domain and RCC1-like domain-containing prote...    131   1e-34   Zea mays [maize]
ref|XP_008667511.1|  PREDICTED: putative regulator of chromosome ...    132   1e-34   Zea mays [maize]
ref|XP_008667510.1|  PREDICTED: putative regulator of chromosome ...    132   1e-34   Zea mays [maize]
pdb|4DNU|A  Chain A, Crystal Structure Of The W285a Mutant Of Uvb...    131   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHN31182.1|  Putative E3 ubiquitin-protein ligase HERC4              131   4e-34   Glycine soja [wild soybean]
ref|XP_003523212.2|  PREDICTED: ultraviolet-B receptor UVR8-like        131   4e-34   Glycine max [soybeans]
ref|XP_007137765.1|  hypothetical protein PHAVU_009G153900g             130   6e-34   Phaseolus vulgaris [French bean]
gb|KHN09639.1|  Putative E3 ubiquitin-protein ligase HERC4              130   1e-33   Glycine soja [wild soybean]
gb|ACU19352.1|  unknown                                                 129   1e-33   Glycine max [soybeans]
ref|XP_003526878.2|  PREDICTED: ultraviolet-B receptor UVR8-like        129   2e-33   
gb|KJB71361.1|  hypothetical protein B456_011G118200                    129   2e-33   Gossypium raimondii
ref|XP_004502975.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    128   6e-33   Cicer arietinum [garbanzo]
ref|XP_004502976.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    128   6e-33   Cicer arietinum [garbanzo]
ref|XP_004503906.1|  PREDICTED: ultraviolet-B receptor UVR8-like        127   1e-32   Cicer arietinum [garbanzo]
ref|XP_007159870.1|  hypothetical protein PHAVU_002G274700g             125   1e-32   Phaseolus vulgaris [French bean]
ref|XP_007159868.1|  hypothetical protein PHAVU_002G274700g             126   2e-32   Phaseolus vulgaris [French bean]
gb|KHN17397.1|  Putative E3 ubiquitin-protein ligase HERC4              125   2e-32   Glycine soja [wild soybean]
ref|XP_007159869.1|  hypothetical protein PHAVU_002G274700g             126   2e-32   Phaseolus vulgaris [French bean]
ref|XP_003525133.1|  PREDICTED: ultraviolet-B receptor UVR8-like        125   3e-32   Glycine max [soybeans]
gb|KEH20913.1|  chromosome condensation regulator RCC1 repeat pro...    120   4e-31   Medicago truncatula
gb|AET04806.2|  chromosome condensation regulator RCC1 repeat pro...    121   6e-31   Medicago truncatula
gb|AET04804.2|  chromosome condensation regulator RCC1 repeat pro...    120   2e-30   Medicago truncatula
gb|AET04805.2|  chromosome condensation regulator RCC1 repeat pro...    120   2e-30   Medicago truncatula
gb|AET04807.2|  chromosome condensation regulator RCC1 repeat pro...    120   3e-30   Medicago truncatula
gb|KEH20912.1|  chromosome condensation regulator RCC1 repeat pro...    119   5e-30   Medicago truncatula
ref|XP_001757031.1|  predicted protein                                  119   7e-30   Physcomitrella patens
gb|KJB71362.1|  hypothetical protein B456_011G118200                    117   5e-29   Gossypium raimondii
ref|XP_001778783.1|  predicted protein                                  113   1e-27   Physcomitrella patens
ref|XP_002963525.1|  hypothetical protein SELMODRAFT_438355             112   2e-27   Selaginella moellendorffii
ref|XP_002981556.1|  hypothetical protein SELMODRAFT_179009             112   2e-27   Selaginella moellendorffii
gb|EEE57180.1|  hypothetical protein OsJ_07117                          111   7e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008781629.1|  PREDICTED: ultraviolet-B receptor UVR8             107   8e-26   Phoenix dactylifera
ref|XP_008442150.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    107   1e-25   Cucumis melo [Oriental melon]
gb|KJB33345.1|  hypothetical protein B456_006G007400                    105   4e-25   Gossypium raimondii
ref|XP_002959204.1|  hypothetical protein VOLCADRAFT_70529              104   1e-24   Volvox carteri f. nagariensis
emb|CDY39843.1|  BnaC02g42750D                                          103   4e-24   Brassica napus [oilseed rape]
ref|XP_001702277.1|  hypothetical protein CHLREDRAFT_122886           98.6    2e-22   Chlamydomonas reinhardtii
ref|XP_005647780.1|  UVB-resistance 8                                 97.1    9e-22   Coccomyxa subellipsoidea C-169
ref|NP_001288968.1|  ultraviolet-B receptor UVR8                      79.0    2e-18   Brassica rapa
ref|XP_009769437.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  87.4    3e-18   Nicotiana sylvestris
gb|KIY98506.1|  putative E3 ubiquitin-protein ligase HERC1            85.1    2e-17   Monoraphidium neglectum
ref|XP_003706150.1|  PREDICTED: uncharacterized protein LOC100881287  82.4    8e-16   
ref|XP_008208309.1|  PREDICTED: uncharacterized protein LOC100677930  82.0    1e-15   
gb|KEH22986.1|  chromosome condensation regulator RCC1 repeat pro...  79.0    3e-15   Medicago truncatula
ref|XP_005847046.1|  hypothetical protein CHLNCDRAFT_134694           79.3    3e-15   Chlorella variabilis
ref|XP_011067663.1|  PREDICTED: uncharacterized protein LOC105154086  80.1    5e-15   Acromyrmex echinatior
ref|XP_003698590.1|  PREDICTED: uncharacterized protein LOC100869963  80.1    5e-15   Apis florea [dwarf honeybee]
gb|EGI69856.1|  X-linked retinitis pigmentosa GTPase regulator-li...  80.1    5e-15   Acromyrmex echinatior
gb|KEH22985.1|  chromosome condensation regulator RCC1 repeat pro...  78.6    6e-15   Medicago truncatula
ref|XP_003486520.1|  PREDICTED: hypothetical protein LOC100745121     79.7    7e-15   
ref|XP_011170369.1|  PREDICTED: uncharacterized protein LOC105203292  79.0    1e-14   Solenopsis invicta [imported red fire ant]
gb|KFZ48697.1|  RCC1 and BTB domain-containing protein 1              75.5    2e-14   Caprimulgus carolinensis
ref|XP_011397979.1|  putative E3 ubiquitin-protein ligase HERC1       77.0    2e-14   Auxenochlorella protothecoides
dbj|GAM25816.1|  hypothetical protein SAMD00019534_089910             78.2    2e-14   Acytostelium subglobosum LB1
ref|XP_010173413.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.5    2e-14   Caprimulgus carolinensis
ref|XP_006609775.1|  PREDICTED: uncharacterized protein LOC102675157  77.8    3e-14   Apis dorsata [rock honeybee]
gb|KFQ25495.1|  RCC1 and BTB domain-containing protein 1              74.7    3e-14   Merops nubicus
ref|XP_011169147.1|  PREDICTED: RCC1 and BTB domain-containing pr...  76.6    3e-14   Solenopsis invicta [imported red fire ant]
ref|XP_008933926.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.7    4e-14   Merops nubicus
gb|KFP47281.1|  RCC1 and BTB domain-containing protein 1              74.3    4e-14   Cathartes aura
gb|EFZ12117.1|  hypothetical protein SINV_05294                       76.6    4e-14   Solenopsis invicta [imported red fire ant]
gb|KFO04430.1|  RCC1 and BTB domain-containing protein 1              75.1    4e-14   Balearica regulorum gibbericeps
gb|KFV01705.1|  RCC1 and BTB domain-containing protein 1              75.1    4e-14   Tauraco erythrolophus
gb|KFQ55655.1|  RCC1 and BTB domain-containing protein 1              75.1    5e-14   Pelecanus crispus
ref|XP_008865570.1|  hypothetical protein H310_03477                  77.0    5e-14   Aphanomyces invadans
emb|CDW87540.1|  kinesin motor domain containing protein              77.0    5e-14   Stylonychia lemnae
ref|XP_009983470.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.1    5e-14   Tauraco erythrolophus
ref|XP_010298033.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.1    5e-14   Balearica regulorum gibbericeps
gb|EJY75989.1|  Kinesin motor domain containing protein               77.0    5e-14   Oxytricha trifallax
ref|XP_009489754.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.1    6e-14   Pelecanus crispus
emb|CAD41017.1|  OSJNBb0086G13.15                                     73.6    6e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007207458.1|  hypothetical protein PRUPE_ppa005731mg           75.5    6e-14   Prunus persica
ref|XP_004516428.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  75.9    6e-14   Cicer arietinum [garbanzo]
ref|XP_004516429.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  75.9    6e-14   Cicer arietinum [garbanzo]
ref|XP_001600404.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.9    7e-14   Nasonia vitripennis
ref|XP_003288451.1|  hypothetical protein DICPUDRAFT_79261            76.6    8e-14   Dictyostelium purpureum
ref|XP_009567013.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.5    9e-14   Cuculus canorus
gb|KFQ00070.1|  RCC1 and BTB domain-containing protein 1              75.5    9e-14   Leptosomus discolor
gb|EMC87683.1|  RCC1 and BTB domain-containing protein 1              75.5    9e-14   Columba livia [carrier pigeon]
ref|XP_005501892.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.5    9e-14   Columba livia [carrier pigeon]
gb|KFO81948.1|  RCC1 and BTB domain-containing protein 1              75.5    1e-13   Cuculus canorus
ref|XP_009953619.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.5    1e-13   Leptosomus discolor
ref|XP_005789489.1|  hypothetical protein EMIHUDRAFT_362321           73.9    1e-13   Emiliania huxleyi CCMP1516
gb|KFV83244.1|  RCC1 and BTB domain-containing protein 1              75.5    1e-13   Struthio camelus australis
ref|XP_009676892.1|  PREDICTED: RCC1 and BTB domain-containing pr...  75.5    1e-13   Struthio camelus australis
ref|XP_003630329.1|  RCC1 and BTB domain-containing protein           72.8    1e-13   
gb|KFP56585.1|  RCC1 and BTB domain-containing protein 1              74.3    1e-13   Cariama cristata
ref|XP_009693232.1|  PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB...  74.3    1e-13   Cariama cristata
ref|XP_010088595.1|  hypothetical protein L484_016988                 74.7    1e-13   Morus notabilis
ref|XP_646416.1|  regulator of chromosome condensation  domain-co...  75.9    1e-13   Dictyostelium discoideum AX4
gb|KFR17176.1|  RCC1 and BTB domain-containing protein 1              75.1    1e-13   Opisthocomus hoazin [hoatzin]
gb|KGN54275.1|  hypothetical protein Csa_4G296280                     74.3    2e-13   Cucumis sativus [cucumbers]
gb|KFQ24239.1|  RCC1 and BTB domain-containing protein 1              74.7    2e-13   Mesitornis unicolor
ref|XP_009941085.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.7    2e-13   Opisthocomus hoazin [hoatzin]
gb|ABR17254.1|  unknown                                               72.8    2e-13   Picea sitchensis
ref|XP_004938775.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   
ref|WP_042122221.1|  hypothetical protein                             73.6    2e-13   
ref|XP_010186472.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.7    2e-13   Mesitornis unicolor
ref|XP_011010790.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  73.9    2e-13   Populus euphratica
gb|KFV43848.1|  RCC1 and BTB domain-containing protein 1              74.7    2e-13   Tyto alba [Schleiereule]
ref|XP_009973887.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.7    2e-13   Tyto alba [Schleiereule]
ref|XP_003630330.1|  RCC1 and BTB domain-containing protein           72.4    2e-13   
ref|XP_004142058.1|  PREDICTED: probable E3 ubiquitin-protein lig...  74.3    2e-13   Cucumis sativus [cucumbers]
gb|KFQ95445.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Nipponia nippon
ref|XP_004166562.1|  PREDICTED: probable E3 ubiquitin-protein lig...  74.3    2e-13   
ref|XP_008448195.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  74.3    2e-13   
ref|XP_417063.2|  PREDICTED: RCC1 and BTB domain-containing prote...  74.3    2e-13   Gallus gallus [bantam]
gb|KEH16774.1|  chromosome condensation regulator RCC1 repeat pro...  72.4    2e-13   Medicago truncatula
gb|KFV50968.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Gavia stellata
ref|XP_008549781.1|  PREDICTED: uncharacterized protein LOC103572785  75.5    2e-13   Microplitis demolitor
ref|XP_009880674.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Charadrius vociferus
ref|XP_003203406.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Meleagris gallopavo [common turkey]
ref|XP_004938772.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Gallus gallus [bantam]
ref|XP_010015835.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Nestor notabilis
gb|KFW64288.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Pygoscelis adeliae
gb|KFQ77205.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Phaethon lepturus
gb|KFP20928.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Egretta garzetta
gb|KFQ74273.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Phoenicopterus ruber ruber
ref|XP_007565402.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Poecilia formosa
ref|XP_009806771.1|  PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB...  74.3    2e-13   Gavia stellata
ref|XP_009461353.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Nipponia nippon
gb|KGL91146.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Charadrius vociferus
gb|KFM06068.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Aptenodytes forsteri
ref|XP_009508178.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Phalacrocorax carbo [common cormorant]
ref|XP_004359988.1|  regulator of chromosome condensation domain-...  75.1    2e-13   Dictyostelium fasciculatum
ref|XP_009643091.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Egretta garzetta
ref|XP_009318226.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Pygoscelis adeliae
gb|KFQ52338.1|  RCC1 and BTB domain-containing protein 1              74.3    2e-13   Nestor notabilis
ref|XP_008448203.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  74.3    2e-13   Cucumis melo [Oriental melon]
ref|XP_010581667.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Haliaeetus leucocephalus
ref|XP_010727104.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    2e-13   Meleagris gallopavo [common turkey]
ref|XP_009275420.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    3e-13   Aptenodytes forsteri
ref|XP_004938771.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    3e-13   
gb|KFO89136.1|  RCC1 and BTB domain-containing protein 1              74.3    3e-13   Buceros rhinoceros silvestris
gb|KFU90699.1|  RCC1 and BTB domain-containing protein 1              74.3    3e-13   Chaetura pelagica
gb|EFN83345.1|  X-linked retinitis pigmentosa GTPase regulator-li...  75.1    3e-13   Harpegnathos saltator
ref|XP_011010786.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  73.9    3e-13   Populus euphratica
ref|XP_009997375.1|  PREDICTED: RCC1 and BTB domain-containing pr...  74.3    3e-13   Chaetura pelagica
ref|XP_011051878.1|  PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB...  74.3    3e-13   Acromyrmex echinatior
ref|XP_011141282.1|  PREDICTED: uncharacterized protein LOC105184279  75.1    3e-13   Harpegnathos saltator
ref|XP_011010785.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  73.9    3e-13   Populus euphratica
ref|XP_010133481.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.9    3e-13   Buceros rhinoceros silvestris
ref|XP_003630328.1|  RCC1 and BTB domain-containing protein           72.4    3e-13   
ref|XP_010727103.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.9    3e-13   Meleagris gallopavo [common turkey]
ref|XP_011010788.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  73.9    3e-13   Populus euphratica
ref|XP_011010789.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  73.9    3e-13   Populus euphratica
ref|XP_008242443.1|  PREDICTED: ultraviolet-B receptor UVR8           73.6    3e-13   
ref|XP_004938770.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.9    3e-13   
ref|XP_007251432.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.9    3e-13   Astyanax mexicanus [blind cave fish]
ref|XP_003488267.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.9    4e-13   Bombus impatiens
gb|KFP23465.1|  RCC1 and BTB domain-containing protein 1              73.9    4e-13   Colius striatus
gb|KFV62156.1|  RCC1 and BTB domain-containing protein 1              73.9    4e-13   Picoides pubescens
ref|XP_005147713.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.9    4e-13   Melopsittacus undulatus
gb|KFP92207.1|  RCC1 and BTB domain-containing protein 1              73.6    4e-13   Apaloderma vittatum
ref|XP_009905325.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.6    4e-13   Picoides pubescens
ref|XP_010427041.1|  PREDICTED: ultraviolet-B receptor UVR8-like      73.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010196066.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.6    4e-13   Colius striatus
gb|KFV98667.1|  RCC1 and BTB domain-containing protein 1              73.6    4e-13   Eurypyga helias
gb|EFN66274.1|  X-linked retinitis pigmentosa GTPase regulator-li...  74.7    4e-13   Camponotus floridanus
gb|KFP06871.1|  RCC1 and BTB domain-containing protein 1              73.6    4e-13   Calypte anna
ref|XP_010158600.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.6    4e-13   Eurypyga helias
ref|XP_011259422.1|  PREDICTED: uncharacterized protein LOC105253237  74.7    4e-13   
ref|XP_009874616.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.6    4e-13   
ref|XP_008499848.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.6    4e-13   
ref|XP_010504159.1|  PREDICTED: ultraviolet-B receptor UVR8-like      73.2    5e-13   
ref|XP_010209647.1|  PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB...  73.6    5e-13   
gb|KGL74995.1|  RCC1 and BTB domain-containing protein 1              73.6    5e-13   
ref|XP_003630331.1|  RCC1 and BTB domain-containing protein           72.8    5e-13   
ref|XP_005240301.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.6    5e-13   
ref|WP_036628254.1|  hypothetical protein                             73.9    5e-13   
ref|XP_006570410.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.2    5e-13   
ref|XP_002876228.1|  hypothetical protein ARALYDRAFT_485777           73.2    5e-13   
ref|XP_011034671.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  73.2    6e-13   
ref|XP_011034509.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  73.2    6e-13   
ref|XP_010119220.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.2    6e-13   
gb|KFP38143.1|  RCC1 and BTB domain-containing protein 1              73.2    6e-13   
ref|XP_005815977.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.2    6e-13   
gb|KDO48154.1|  hypothetical protein CISIN_1g012245mg                 72.8    6e-13   
ref|XP_006570406.1|  PREDICTED: RCC1 and BTB domain-containing pr...  73.2    7e-13   
ref|XP_002322918.1|  regulator of chromosome condensation family ...  72.8    7e-13   
ref|XP_006621554.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.8    8e-13   
ref|XP_006570409.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.8    8e-13   
ref|XP_010741853.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.8    9e-13   
ref|XP_006621559.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.8    9e-13   
gb|EMT08447.1|  hypothetical protein F775_05909                       69.7    9e-13   
ref|XP_005287185.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.4    9e-13   
ref|XP_005287181.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.8    9e-13   
ref|XP_011337875.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    9e-13   
ref|XP_010515887.1|  PREDICTED: ultraviolet-B receptor UVR8-like      72.4    9e-13   
ref|XP_007072411.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.8    9e-13   
ref|XP_005287180.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.8    1e-12   
ref|XP_003693250.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.4    1e-12   
ref|XP_006493564.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  72.4    1e-12   
ref|XP_006121415.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.4    1e-12   
ref|XP_006121416.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.4    1e-12   
ref|XP_006493565.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  72.0    1e-12   
ref|XP_008425117.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    1e-12   
ref|XP_002129368.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.4    1e-12   
gb|KFK35120.1|  hypothetical protein AALP_AA5G238800                  72.0    1e-12   
ref|XP_005171027.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    1e-12   
ref|XP_008372007.1|  PREDICTED: ultraviolet-B receptor UVR8           72.0    1e-12   
ref|XP_008425100.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    1e-12   
ref|NP_956285.1|  RCC1 and BTB domain-containing protein 1            72.0    1e-12   
ref|XP_011337874.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    2e-12   
ref|XP_006837706.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    2e-12   
ref|XP_005784774.1|  hypothetical protein EMIHUDRAFT_631926           72.0    2e-12   
ref|XP_006837705.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    2e-12   
gb|ETE60641.1|  RCC1 and BTB domain-containing protein 1              72.0    2e-12   
ref|XP_007440486.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_009351386.1|  PREDICTED: ultraviolet-B receptor UVR8-like      71.6    2e-12   
ref|XP_005516408.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_005037959.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_010398710.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_002198142.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
gb|KFK34630.1|  hypothetical protein AALP_AA5G171100                  71.6    2e-12   
ref|XP_005482449.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_010765837.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    2e-12   
ref|XP_009081393.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_008631405.1|  PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB...  71.6    2e-12   
ref|XP_005420836.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_005764826.1|  hypothetical protein EMIHUDRAFT_213630           68.2    2e-12   
ref|XP_008279266.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_010765836.1|  PREDICTED: RCC1 and BTB domain-containing pr...  72.0    2e-12   
dbj|BAE98367.1|  regulator of chromosome condensation-like protein    71.6    2e-12   
gb|KFP89119.1|  RCC1 and BTB domain-containing protein 1              71.6    2e-12   
gb|KFO58722.1|  RCC1 and BTB domain-containing protein 1              71.6    2e-12   
ref|XP_001771424.1|  predicted protein                                71.2    2e-12   
ref|XP_010765838.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_005015306.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_009116260.1|  PREDICTED: ultraviolet-B receptor UVR8           71.2    2e-12   
ref|XP_008927338.1|  PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB...  71.6    2e-12   
ref|XP_004551307.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_001008807.1|  Kinesin motor domain containing protein          72.4    2e-12   
ref|NP_191117.1|  regulator of chromosome condensation repeat-con...  71.2    2e-12   
gb|EAR88562.2|  kinesin motor catalytic domain protein                72.4    2e-12   
ref|XP_005733928.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_005761231.1|  hypothetical protein EMIHUDRAFT_358730           69.3    2e-12   
ref|XP_010083019.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_008279265.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_008279264.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_009358766.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  71.2    2e-12   
ref|XP_005015305.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_010037799.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  71.2    2e-12   
gb|EOB04540.1|  RCC1 and BTB domain-containing protein 1              71.6    2e-12   
ref|XP_005023389.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    2e-12   
ref|XP_010658524.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  69.7    2e-12   
ref|XP_006788285.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    2e-12   
ref|XP_010158601.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    3e-12   
ref|XP_010884620.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
ref|XP_010083018.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
ref|XP_006639234.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
gb|KJB76116.1|  hypothetical protein B456_012G072600                  71.2    3e-12   
ref|XP_005015304.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    3e-12   
ref|XP_004551306.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
ref|XP_010529810.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  70.9    3e-12   
ref|XP_005733927.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
ref|XP_010884618.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    3e-12   
ref|XP_005015301.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.6    3e-12   
ref|XP_004305186.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  71.2    3e-12   
ref|XP_010884619.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
ref|XP_011265927.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
gb|KFN08373.1|  fibronectin type III domain protein                   72.0    3e-12   
emb|CDY40239.1|  BnaA09g35210D                                        71.2    3e-12   
emb|CAB88345.1|  putative protein                                     71.2    3e-12   
ref|NP_190951.2|  Regulator of chromosome condensation (RCC1) fam...  71.2    3e-12   
ref|XP_008605773.1|  hypothetical protein, variant 1                  71.2    3e-12   
emb|CAG05784.1|  unnamed protein product                              71.2    3e-12   
ref|XP_011265928.1|  PREDICTED: RCC1 and BTB domain-containing pr...  71.2    3e-12   
ref|XP_006290887.1|  hypothetical protein CARUB_v10016999mg           71.2    3e-12   
emb|CCI41757.1|  unnamed protein product                              71.2    3e-12   
ref|XP_011466531.1|  PREDICTED: protein RCC2 homolog isoform X1       71.2    3e-12   
ref|XP_001760787.1|  predicted protein                                70.9    3e-12   
gb|EMP32409.1|  RCC1 and BTB domain-containing protein 2              70.9    4e-12   
ref|WP_035218481.1|  hypothetical protein                             71.2    4e-12   
ref|XP_008387815.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  70.9    4e-12   
ref|XP_008387814.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  70.9    4e-12   
ref|XP_010532850.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  70.5    4e-12   
ref|XP_011499761.1|  PREDICTED: uncharacterized protein LOC105363708  71.6    4e-12   
gb|KDO32822.1|  hypothetical protein SPRG_02515                       70.9    4e-12   
ref|XP_008605772.1|  hypothetical protein, variant 2                  70.9    4e-12   
ref|XP_008300131.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    5e-12   
gb|KDO30996.1|  hypothetical protein SPRG_04184                       70.9    5e-12   
ref|XP_001942852.2|  PREDICTED: probable E3 ubiquitin-protein lig...  71.6    5e-12   
ref|XP_008287235.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.9    5e-12   
emb|CDQ90333.1|  unnamed protein product                              70.9    5e-12   
ref|XP_003961798.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    5e-12   
ref|XP_007026937.1|  Regulator of chromosome condensation (RCC1) ...  70.5    5e-12   
ref|XP_006000622.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.1    5e-12   
ref|XP_009384836.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  70.5    5e-12   
ref|XP_010776934.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    5e-12   
ref|XP_007026939.1|  Regulator of chromosome condensation family ...  69.7    5e-12   
gb|KFQ22881.1|  RCC1 and BTB domain-containing protein 2              68.9    5e-12   
ref|XP_009384834.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  70.5    5e-12   
ref|XP_006000619.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    5e-12   
ref|XP_010529807.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  70.5    5e-12   
ref|XP_010532771.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  70.5    5e-12   
dbj|GAM28582.1|  hypothetical protein SAMD00019534_117580             71.2    5e-12   
ref|XP_005475570.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    5e-12   
ref|XP_010878881.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    5e-12   
emb|CDQ90074.1|  unnamed protein product                              70.5    5e-12   
ref|XP_004365432.1|  hypothetical protein CAOG_00561                  71.2    6e-12   
ref|XP_008944619.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.9    6e-12   
ref|XP_011299545.1|  PREDICTED: uncharacterized protein LOC105264401  71.2    6e-12   
ref|XP_010529806.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  70.1    6e-12   
ref|XP_008605771.1|  hypothetical protein SDRG_01992                  70.5    6e-12   
ref|XP_010529804.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  70.1    6e-12   
ref|XP_003215365.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    6e-12   
ref|XP_007910715.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    6e-12   
ref|XP_010529808.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  70.1    6e-12   
ref|XP_010225113.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.5    6e-12   
ref|XP_003451657.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.1    6e-12   
ref|XP_002765966.1|  guanine nucleotide exchange factor p532, put...  67.0    7e-12   
ref|XP_006290997.1|  hypothetical protein CARUB_v10017109mg           70.1    7e-12   
ref|XP_007910714.1|  PREDICTED: RCC1 and BTB domain-containing pr...  70.1    8e-12   
emb|CDY13151.1|  BnaC04g26840D                                        69.7    8e-12   
ref|XP_002282470.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  69.7    8e-12   
ref|XP_009346411.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  69.7    9e-12   
ref|XP_010658522.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  69.7    9e-12   
ref|XP_002311187.2|  hypothetical protein POPTR_0008s06020g           69.7    9e-12   
gb|KGL73571.1|  RCC1 and BTB domain-containing protein 2              69.7    9e-12   
ref|XP_001775744.1|  predicted protein                                69.7    9e-12   
ref|XP_008609568.1|  hypothetical protein SDRG_05620                  70.1    9e-12   
ref|XP_008609567.1|  hypothetical protein, variant                    69.7    9e-12   
emb|CBI31619.3|  unnamed protein product                              69.7    9e-12   
ref|XP_009346415.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  69.7    9e-12   
ref|XP_009346414.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  69.7    9e-12   
ref|XP_009346413.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  69.7    9e-12   
dbj|BAJ86176.1|  predicted protein                                    67.0    9e-12   
ref|XP_008166611.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.9    1e-11   
ref|XP_010744464.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.7    1e-11   
gb|KHG23449.1|  RCC1 domain-containing 1                              69.3    1e-11   
ref|XP_009139286.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  69.3    1e-11   
ref|XP_010691329.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  69.3    1e-11   
ref|XP_006719906.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.6    1e-11   
ref|XP_009139288.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  69.3    1e-11   
emb|CDX76187.1|  BnaA04g04510D                                        69.3    1e-11   
emb|CDQ62976.1|  unnamed protein product                              69.7    1e-11   
ref|XP_006403444.1|  hypothetical protein EUTSA_v10010326mg           69.3    1e-11   
gb|KJB74045.1|  hypothetical protein B456_011G268700                  69.3    1e-11   
ref|XP_003600757.1|  RCC1 and BTB domain-containing protein           67.4    1e-11   
ref|XP_010691312.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  69.3    1e-11   
gb|EAX08800.1|  regulator of chromosome condensation (RCC1) and B...  68.2    1e-11   
ref|XP_006583601.1|  PREDICTED: ultraviolet-B receptor UVR8-like      69.3    1e-11   
ref|XP_005730933.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.3    1e-11   
ref|XP_007666795.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.3    1e-11   
gb|KHN40271.1|  Putative E3 ubiquitin-protein ligase HERC4            69.3    1e-11   
ref|XP_005920136.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.7    1e-11   
ref|XP_005450135.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.7    1e-11   
ref|XP_004573666.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.7    1e-11   
ref|XP_005450136.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.3    1e-11   
ref|XP_007238583.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.7    1e-11   
ref|XP_005711331.1|  unnamed protein product                          69.3    1e-11   
ref|XP_007238581.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.7    1e-11   
ref|XP_009953663.1|  PREDICTED: RCC1 and BTB domain-containing pr...  67.4    1e-11   
ref|XP_001701125.1|  hypothetical protein CHLREDRAFT_194222           68.9    2e-11   
ref|XP_007666793.1|  PREDICTED: RCC1 and BTB domain-containing pr...  69.3    2e-11   
gb|KDP24565.1|  hypothetical protein JCGZ_25129                       68.9    2e-11   
emb|CDY41207.1|  BnaC08g26510D                                        68.9    2e-11   
ref|XP_004503178.1|  PREDICTED: ultraviolet-B receptor UVR8-like      68.9    2e-11   
gb|EMT25141.1|  hypothetical protein F775_15705                       69.3    2e-11   
ref|XP_007507974.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  68.9    2e-11   
ref|XP_006740697.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.9    2e-11   
ref|XP_010554986.1|  PREDICTED: ultraviolet-B receptor UVR8-like      68.9    2e-11   
ref|XP_010427338.1|  PREDICTED: ultraviolet-B receptor UVR8-like      68.9    2e-11   
ref|XP_010504417.1|  PREDICTED: ultraviolet-B receptor UVR8-like      68.9    2e-11   
gb|KDP44887.1|  hypothetical protein JCGZ_01387                       68.6    2e-11   
ref|XP_006740698.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.9    2e-11   
ref|XP_009358763.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  68.6    2e-11   
gb|EZA47730.1|  X-linked retinitis pigmentosa GTPase regulator-li...  69.7    2e-11   
ref|XP_008326397.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.6    2e-11   
ref|XP_011349532.1|  PREDICTED: uncharacterized protein LOC105286...  69.7    2e-11   
ref|XP_011349531.1|  PREDICTED: uncharacterized protein LOC105286...  69.7    2e-11   
ref|XP_011349530.1|  PREDICTED: uncharacterized protein LOC105286...  69.7    2e-11   
ref|XP_011349529.1|  PREDICTED: uncharacterized protein LOC105286...  69.7    2e-11   
ref|XP_011349527.1|  PREDICTED: uncharacterized protein LOC105286...  69.7    2e-11   
ref|XP_009358764.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  68.6    2e-11   
ref|XP_782246.3|  PREDICTED: RCC1 and BTB domain-containing prote...  68.9    2e-11   
ref|XP_004399543.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.9    2e-11   
ref|XP_010516136.1|  PREDICTED: ultraviolet-B receptor UVR8-like      68.6    2e-11   
ref|XP_007889730.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.9    2e-11   
ref|XP_004399542.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.9    2e-11   
ref|XP_007889733.1|  PREDICTED: RCC1 and BTB domain-containing pr...  68.6    2e-11   



>gb|KCW62479.1| hypothetical protein EUGRSUZ_H05117 [Eucalyptus grandis]
 gb|KCW62480.1| hypothetical protein EUGRSUZ_H05117 [Eucalyptus grandis]
 gb|KCW62481.1| hypothetical protein EUGRSUZ_H05117 [Eucalyptus grandis]
Length=302

 Score =   147 bits (370),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS+SG+LYT+GWSKYGQLGHG+FE HLVP KLE LHG+F+S IS GWRHTMALT DG+L
Sbjct  104  SVSASGALYTFGWSKYGQLGHGNFEDHLVPHKLEALHGNFVSQISGGWRHTMALTHDGKL  163

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+NVDHC+P
Sbjct  164  YGWGWNKFGQVGVGNNVDHCAP  185


 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLH--GDFISPISSGWRHTMALTTDG  175
            +V+ +G LY +GW +YG LG GD    LVP K+  +H  G+ +  ++ GWRH+++++  G
Sbjct  50   AVTEAGELYGWGWGRYGNLGLGDRNDRLVPEKVSPIHLNGEAMVVVACGWRHSISVSASG  109

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
             LY +GW+K+GQ+G G+  DH  P
Sbjct  110  ALYTFGWSKYGQLGHGNFEDHLVP  133


 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  14   SGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWG  193
             G + ++G ++ GQLG G  E  L+P K+    G  +  +++G  HT A+T  G+LYGWG
Sbjct  2    EGEVQSWGRNQNGQLGLGTTEDSLLPQKIRAFQGIPVKMVAAGAEHTAAVTEAGELYGWG  61

Query  194  WNKFGQVGVGDNVDHCSP  247
            W ++G +G+GD  D   P
Sbjct  62   WGRYGNLGLGDRNDRLVP  79



>ref|XP_010270276.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
Length=450

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG+LYTYGWSKYGQLGHGDFE HLVP +LE L  D IS IS GWRHTMALT+DG+L
Sbjct  239  SVSSSGALYTYGWSKYGQLGHGDFEDHLVPHQLEALRNDLISQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  299  YGWGWNKFGQVGVGDNVDHCSP  320


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD +  LVP +  ++ G+ +  ++ GWRHT+++++ G L
Sbjct  187  AITEDGKLYGWGWGRYGNLGLGDRKDRLVPAQASSVDGERMVLVACGWRHTISVSSSGAL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLVP  268


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  135  AVTMDGEVQSWGRNQNGQLGLGHTEDSLVPQKIQAFQGLSVKMVAAGAEHTAAITEDGKL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRKDRLVP  216


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  W
Sbjct  86   SQSQVYSWGWGDFGRLGHGNSSDLFTPQSIKALHGVRIKQIACGDSHCLAVTMDGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGHTEDSLVP  164


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGW  196
            ++ ++G  + GQLGHGD E  L P ++  L G  ++ ++ G  HT+A + +  Q+Y WGW
Sbjct  36   AVCSWGRGEDGQLGHGDAEDRLSPTQMSALDGHDVASVTCGADHTIAYSESQSQVYSWGW  95

Query  197  NKFGQVGVGDNVDHCSP  247
              FG++G G++ D  +P
Sbjct  96   GDFGRLGHGNSSDLFTP  112



>ref|XP_006464910.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Citrus 
sinensis]
Length=449

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMALT+DG+L
Sbjct  244  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMALTSDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  304  YGWGWNKFGQVGVGDNVDHCSP  325


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDG  175
            +V+  G LY +GW +YG LG GD    L+P K+ T  L  + +  ++ GWRHT+++++ G
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDLQREKMVMVACGWRHTISVSSSG  249

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            +LY +GW+K+GQ+G GD  DH  P
Sbjct  250  RLYSYGWSKYGQLGHGDFKDHLVP  273


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>ref|XP_006464912.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Citrus 
sinensis]
Length=447

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMALT+DG+L
Sbjct  242  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMALTSDGKL  301

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  302  YGWGWNKFGQVGVGDNVDHCSP  323


 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ T+  + +  ++ GWRHT+++++ G+L
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDREKMVMVACGWRHTISVSSSGRL  249

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  250  YSYGWSKYGQLGHGDFKDHLVP  271


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>ref|XP_006432102.1| hypothetical protein CICLE_v10001136mg [Citrus clementina]
 ref|XP_006464913.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X4 [Citrus 
sinensis]
 gb|ESR45342.1| hypothetical protein CICLE_v10001136mg [Citrus clementina]
Length=446

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMALT+DG+L
Sbjct  242  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMALTSDGKL  301

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  302  YGWGWNKFGQVGVGDNVDHCSP  323


 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ T+  + +  ++ GWRHT+++++ G+L
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDREKMVMVACGWRHTISVSSSGRL  249

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  250  YSYGWSKYGQLGHGDFKDHLVP  271


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>ref|XP_006432103.1| hypothetical protein CICLE_v10001136mg [Citrus clementina]
 ref|XP_006464911.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Citrus 
sinensis]
 gb|ESR45343.1| hypothetical protein CICLE_v10001136mg [Citrus clementina]
Length=448

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMALT+DG+L
Sbjct  244  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMALTSDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  304  YGWGWNKFGQVGVGDNVDHCSP  325


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDG  175
            +V+  G LY +GW +YG LG GD    L+P K+ T  L  + +  ++ GWRHT+++++ G
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDLQREKMVMVACGWRHTISVSSSG  249

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            +LY +GW+K+GQ+G GD  DH  P
Sbjct  250  RLYSYGWSKYGQLGHGDFKDHLVP  273


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>ref|XP_004288153.1| PREDICTED: ultraviolet-B receptor UVR8 [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HLVP KLE L   FIS ++ GWRHTMALT+DGQL
Sbjct  234  SVSSSGQLYTYGWSKYGQLGHGDFEDHLVPHKLEALSDKFISEVAGGWRHTMALTSDGQL  293

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  294  YGWGWNKFGQVGVGDNVDHCSP  315


 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G+LY +GW +YG LG GD    LVP K+   +G+ +  ++ GWRHT+++++ GQL
Sbjct  182  AVTEDGTLYGWGWGRYGNLGLGDRNDRLVPEKVSLDNGEKMVMVACGWRHTISVSSSGQL  241

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  242  YTYGWSKYGQLGHGDFEDHLVP  263


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G+FI  +++G  HT A+T DG L
Sbjct  130  AVTMEGQVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGEFIKMVAAGAEHTAAVTEDGTL  189

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  190  YGWGWGRYGNLGLGDRNDRLVP  211


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +GQ+  WG N
Sbjct  84   EVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLKIRQIACGDSHCLAVTMEGQVQSWGRN  143

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  144  QNGQLGLGTTEDSLVP  159


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGH D E  + P  L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  34   SWGRGEDGQLGHADAEDRISPTHLSALDGHQIVSLTCGADHTTAYSDSRLEVYSWGWGDF  93

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  94   GRLGHGNSSDLFTP  107



>ref|XP_010269039.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Nelumbo 
nucifera]
Length=448

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG++YTYGWSKYGQLGHGDFE HL+P +LE+L  DFIS IS GWRHTMALT+DG+L
Sbjct  237  SVSSSGTIYTYGWSKYGQLGHGDFEDHLIPHQLESLRDDFISQISGGWRHTMALTSDGRL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQVGVGDNVDHCSP
Sbjct  297  FGWGWNKFGQVGVGDNVDHCSP  318


 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD +  LVP ++ ++ G+ +  ++ GWRHT+++++ G +
Sbjct  185  AITKDGKLYGWGWGRYGNLGLGDRKDRLVPAQVTSVDGENMVLVACGWRHTISVSSSGTI  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDFEDHLIP  266


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  133  AVTMDGEVQSWGRNQNGQLGLGHIEDSLVPQKIQEFQGLSVKMVAAGAEHTAAITKDGKL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRKDRLVP  214


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  
Sbjct  83   ESQSQVYSWGWGDFGRLGHGNSSDLFTPQSIKALHGIRIKQIACGDSHCLAVTMDGEVQS  142

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  143  WGRNQNGQLGLGHIEDSLVP  162


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P ++  L G  I  +  G  HT+A + +  Q+Y WGW  F
Sbjct  37   SWGRGEDGQLGHGDAEDRLSPTQMSALDGHDIVSVICGADHTIAYSESQSQVYSWGWGDF  96

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  97   GRLGHGNSSDLFTP  110



>ref|XP_010269040.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Nelumbo 
nucifera]
Length=431

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG++YTYGWSKYGQLGHGDFE HL+P +LE+L  DFIS IS GWRHTMALT+DG+L
Sbjct  237  SVSSSGTIYTYGWSKYGQLGHGDFEDHLIPHQLESLRDDFISQISGGWRHTMALTSDGRL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQVGVGDNVDHCSP
Sbjct  297  FGWGWNKFGQVGVGDNVDHCSP  318


 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD +  LVP ++ ++ G+ +  ++ GWRHT+++++ G +
Sbjct  185  AITKDGKLYGWGWGRYGNLGLGDRKDRLVPAQVTSVDGENMVLVACGWRHTISVSSSGTI  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDFEDHLIP  266


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  133  AVTMDGEVQSWGRNQNGQLGLGHIEDSLVPQKIQEFQGLSVKMVAAGAEHTAAITKDGKL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRKDRLVP  214


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  
Sbjct  83   ESQSQVYSWGWGDFGRLGHGNSSDLFTPQSIKALHGIRIKQIACGDSHCLAVTMDGEVQS  142

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  143  WGRNQNGQLGLGHIEDSLVP  162


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P ++  L G  I  +  G  HT+A + +  Q+Y WGW  F
Sbjct  37   SWGRGEDGQLGHGDAEDRLSPTQMSALDGHDIVSVICGADHTIAYSESQSQVYSWGWGDF  96

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  97   GRLGHGNSSDLFTP  110



>ref|XP_010547681.1| PREDICTED: ultraviolet-B receptor UVR8 [Tarenaya hassleriana]
Length=435

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGDFE HLVPCKLE L   FIS IS GWRHTMALT+DG+L
Sbjct  233  SVSFSGALYTYGWSKYGQLGHGDFEDHLVPCKLEALSNCFISQISGGWRHTMALTSDGKL  292

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGV DNVDHCSP
Sbjct  293  YGWGWNKFGQVGVSDNVDHCSP  314


 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD     VP K+ +  G+ ++ ++ GWRHT++++  G L
Sbjct  181  AVTEDGDLYGWGWGRYGNLGLGDRNDRWVPEKVTSAGGERMAMVACGWRHTISVSFSGAL  240

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  241  YTYGWSKYGQLGHGDFEDHLVP  262


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  129  AVTMEGEVQSWGRNQNGQLGLGGTEDSLVPQKIQAFEGVRIKMVAAGAEHTAAVTEDGDL  188

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  189  YGWGWGRYGNLGLGDRNDRWVP  210


 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G  D   H  P ++   +   +  +S GWRHT+A T    +
Sbjct  285  ALTSDGKLYGWGWNKFGQVGVSDNVDHCSPVQVRFPNDQRVVQVSCGWRHTLAATERNNV  344

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G++VD   P
Sbjct  345  FSWGRGTNGQLGHGESVDRNFP  366


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+    H +A+T +G++  W
Sbjct  80   SQKEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGIRIKQIACEDSHCLAVTMEGEVQSW  139

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  140  GRNQNGQLGLGGTEDSLVP  158


 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E    P +L  L    +  ++ G  HT+A + +  ++Y WGW 
Sbjct  31   VCSWGRGEDGQLGHGDAEDRPSPTQLSALDEHQVVSVTCGADHTIAYSESQKEVYSWGWG  90

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  91   DFGRLGHGNSSDLFTP  106



>gb|KDO57526.1| hypothetical protein CISIN_1g013084mg [Citrus sinensis]
Length=449

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMA+T+DG+L
Sbjct  244  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMAVTSDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  304  YGWGWNKFGQVGVGDNVDHCSP  325


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDG  175
            +V+  G LY +GW +YG LG GD    L+P K+ T  L  + +  ++ GWRHT+++++ G
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDLQREKMVMVACGWRHTISVSSSG  249

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            +LY +GW+K+GQ+G GD  DH  P
Sbjct  250  RLYSYGWSKYGQLGHGDFKDHLVP  273


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>gb|KDO57527.1| hypothetical protein CISIN_1g013084mg [Citrus sinensis]
Length=448

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMA+T+DG+L
Sbjct  244  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMAVTSDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  304  YGWGWNKFGQVGVGDNVDHCSP  325


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDG  175
            +V+  G LY +GW +YG LG GD    L+P K+ T  L  + +  ++ GWRHT+++++ G
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDLQREKMVMVACGWRHTISVSSSG  249

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            +LY +GW+K+GQ+G GD  DH  P
Sbjct  250  RLYSYGWSKYGQLGHGDFKDHLVP  273


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>gb|KDO57529.1| hypothetical protein CISIN_1g013084mg [Citrus sinensis]
Length=446

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMA+T+DG+L
Sbjct  242  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMAVTSDGKL  301

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  302  YGWGWNKFGQVGVGDNVDHCSP  323


 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ T+  + +  ++ GWRHT+++++ G+L
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDREKMVMVACGWRHTISVSSSGRL  249

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  250  YSYGWSKYGQLGHGDFKDHLVP  271


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>gb|KDO57528.1| hypothetical protein CISIN_1g013084mg [Citrus sinensis]
Length=444

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMA+T+DG+L
Sbjct  244  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMAVTSDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  304  YGWGWNKFGQVGVGDNVDHCSP  325


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDG  175
            +V+  G LY +GW +YG LG GD    L+P K+ T  L  + +  ++ GWRHT+++++ G
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDLQREKMVMVACGWRHTISVSSSG  249

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            +LY +GW+K+GQ+G GD  DH  P
Sbjct  250  RLYSYGWSKYGQLGHGDFKDHLVP  273


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>gb|KDO57530.1| hypothetical protein CISIN_1g013084mg [Citrus sinensis]
Length=442

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMA+T+DG+L
Sbjct  242  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMAVTSDGKL  301

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  302  YGWGWNKFGQVGVGDNVDHCSP  323


 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ T+  + +  ++ GWRHT+++++ G+L
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDREKMVMVACGWRHTISVSSSGRL  249

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  250  YSYGWSKYGQLGHGDFKDHLVP  271


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>gb|KCW62482.1| hypothetical protein EUGRSUZ_H05117 [Eucalyptus grandis]
Length=403

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS+SG+LYT+GWSKYGQLGHG+FE HLVP KLE LHG+F+S IS GWRHTMALT DG+L
Sbjct  243  SVSASGALYTFGWSKYGQLGHGNFEDHLVPHKLEALHGNFVSQISGGWRHTMALTHDGKL  302

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+NVDHC+P
Sbjct  303  YGWGWNKFGQVGVGNNVDHCAP  324


 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLH--GDFISPISSGWRHTMALTTDG  175
            +V+ +G LY +GW +YG LG GD    LVP K+  +H  G+ +  ++ GWRH+++++  G
Sbjct  189  AVTEAGELYGWGWGRYGNLGLGDRNDRLVPEKVSPIHLNGEAMVVVACGWRHSISVSASG  248

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
             LY +GW+K+GQ+G G+  DH  P
Sbjct  249  ALYTFGWSKYGQLGHGNFEDHLVP  272


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  L+P K+    G  +  +++G  HT A+T  G+L
Sbjct  137  AVTMEGEVQSWGRNQNGQLGLGTTEDSLLPQKIRAFQGIPVKMVAAGAEHTAAVTEAGEL  196

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  197  YGWGWGRYGNLGLGDRNDRLVP  218


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T +G++  
Sbjct  87   ESRREVYSWGWGDFGRLGHGNHYDVFTPQPIKVLQGLRIKQIACGDSHCLAVTMEGEVQS  146

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  147  WGRNQNGQLGLGTTEDSLLP  166


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQ  178
            +V S   + ++G  + GQLGHGD E   +P  L  L G  +  +  G  HT A + +  +
Sbjct  32   AVLSGNVVCSWGRGEDGQLGHGDAEDRSLPTHLSALDGQEVVSVICGADHTNAYSESRRE  91

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G G++ D  +P
Sbjct  92   VYSWGWGDFGRLGHGNHYDVFTP  114



>gb|KDO57531.1| hypothetical protein CISIN_1g013084mg [Citrus sinensis]
Length=425

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LY+YGWSKYGQLGHGDF+ HLVPC+LE L   FIS IS GWRHTMA+T+DG+L
Sbjct  244  SVSSSGRLYSYGWSKYGQLGHGDFKDHLVPCQLEALRESFISQISGGWRHTMAVTSDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  304  YGWGWNKFGQVGVGDNVDHCSP  325


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDG  175
            +V+  G LY +GW +YG LG GD    L+P K+ T  L  + +  ++ GWRHT+++++ G
Sbjct  190  AVAEDGELYGWGWGRYGNLGLGDRNDRLIPEKVATVDLQREKMVMVACGWRHTISVSSSG  249

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            +LY +GW+K+GQ+G GD  DH  P
Sbjct  250  RLYSYGWSKYGQLGHGDFKDHLVP  273


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP KL+   G  I  +++G  H++A+  DG+L
Sbjct  138  AVTVEGEVQSWGRNQNGQLGLGTTEDSLVPQKLQAFEGVSIKMVAAGAEHSVAVAEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLIP  219


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   +  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHSLRVKQIACGDSHCLAVTVEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    Q+Y WGW  F
Sbjct  42   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSESCMQVYSWGWGDF  101

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  102  GRLGHGNSSDLFTP  115



>ref|XP_010025746.1| PREDICTED: ultraviolet-B receptor UVR8 [Eucalyptus grandis]
 gb|KCW62478.1| hypothetical protein EUGRSUZ_H05117 [Eucalyptus grandis]
Length=441

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS+SG+LYT+GWSKYGQLGHG+FE HLVP KLE LHG+F+S IS GWRHTMALT DG+L
Sbjct  243  SVSASGALYTFGWSKYGQLGHGNFEDHLVPHKLEALHGNFVSQISGGWRHTMALTHDGKL  302

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+NVDHC+P
Sbjct  303  YGWGWNKFGQVGVGNNVDHCAP  324


 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLH--GDFISPISSGWRHTMALTTDG  175
            +V+ +G LY +GW +YG LG GD    LVP K+  +H  G+ +  ++ GWRH+++++  G
Sbjct  189  AVTEAGELYGWGWGRYGNLGLGDRNDRLVPEKVSPIHLNGEAMVVVACGWRHSISVSASG  248

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
             LY +GW+K+GQ+G G+  DH  P
Sbjct  249  ALYTFGWSKYGQLGHGNFEDHLVP  272


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  L+P K+    G  +  +++G  HT A+T  G+L
Sbjct  137  AVTMEGEVQSWGRNQNGQLGLGTTEDSLLPQKIRAFQGIPVKMVAAGAEHTAAVTEAGEL  196

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  197  YGWGWGRYGNLGLGDRNDRLVP  218


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T +G++  
Sbjct  87   ESRREVYSWGWGDFGRLGHGNHYDVFTPQPIKVLQGLRIKQIACGDSHCLAVTMEGEVQS  146

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  147  WGRNQNGQLGLGTTEDSLLP  166


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQ  178
            +V S   + ++G  + GQLGHGD E   +P  L  L G  +  +  G  HT A + +  +
Sbjct  32   AVLSGNVVCSWGRGEDGQLGHGDAEDRSLPTHLSALDGQEVVSVICGADHTNAYSESRRE  91

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G G++ D  +P
Sbjct  92   VYSWGWGDFGRLGHGNHYDVFTP  114



>ref|XP_004168089.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC3-like, partial 
[Cucumis sativus]
Length=302

 Score =   144 bits (362),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE  LVP +LE L GD IS IS GWRHTMALTTDG+L
Sbjct  95   SVSSLGGLYTYGWSKYGQLGHGDFEDRLVPHRLEALRGDNISQISGGWRHTMALTTDGKL  154

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHCSP
Sbjct  155  YGWGWNKFGQVGAGDNIDHCSP  176


 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    LVP K+ ++ GD +  ++ GWRHT+++++ G L
Sbjct  43   AVTEDGELFGWGWGRYGNLGLGDRNDRLVPQKVSSVDGDKMVMVACGWRHTISVSSLGGL  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  D   P
Sbjct  103  YTYGWSKYGQLGHGDFEDRLVP  124


 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +2

Query  32   YGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKFGQ  211
            +G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L+GWGW ++G 
Sbjct  1    WGRNQNGQLGLGTTEDSLVPQKIQAFEGISIKMVAAGAEHTAAVTEDGELFGWGWGRYGN  60

Query  212  VGVGDNVDHCSP  247
            +G+GD  D   P
Sbjct  61   LGLGDRNDRLVP  72



>gb|EYU20594.1| hypothetical protein MIMGU_mgv1a006243mg [Erythranthe guttata]
Length=451

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSGSLYTYGWSKYGQLGHGDFE HL+P KLE+L    IS IS GWRHTMALTTDG+L
Sbjct  248  SVSSSGSLYTYGWSKYGQLGHGDFEDHLIPHKLESLRDSQISQISGGWRHTMALTTDGEL  307

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGD++DHCSP
Sbjct  308  YGWGWNKFGQVGVGDSIDHCSP  329


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ T+ G+ +  ++ GWRHT+++++ G L
Sbjct  196  AVTEDGELYGWGWGRYGNLGLGDRFDRLLPGKVSTVEGEKMVLVACGWRHTISVSSSGSL  255

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  256  YTYGWSKYGQLGHGDFEDHLIP  277


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP  +E   G  +  +++G  HT A+T DG+L
Sbjct  144  AVTMEGEVKSWGRNQNGQLGLGTTEDSLVPRNIEAFQGIPVKMVAAGAEHTAAVTEDGEL  203

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  204  YGWGWGRYGNLGLGDRFDRLLP  225


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T +G++  W
Sbjct  95   SQMQVYSWGWGDFGRLGHGNSSDLFSPQPIKALQGLRIKQIACGDSHCLAVTMEGEVKSW  154

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  155  GRNQNGQLGLGTTEDSLVP  173


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++SG  HT A + +  Q+Y WGW  F
Sbjct  48   SWGRGEDGQLGHGDAEDRFSPTQLSALDDLDIVSVTSGADHTTAYSKSQMQVYSWGWGDF  107

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  SP
Sbjct  108  GRLGHGNSSDLFSP  121



>gb|EYU20595.1| hypothetical protein MIMGU_mgv1a006243mg [Erythranthe guttata]
Length=450

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSGSLYTYGWSKYGQLGHGDFE HL+P KLE+L    IS IS GWRHTMALTTDG+L
Sbjct  248  SVSSSGSLYTYGWSKYGQLGHGDFEDHLIPHKLESLRDSQISQISGGWRHTMALTTDGEL  307

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGD++DHCSP
Sbjct  308  YGWGWNKFGQVGVGDSIDHCSP  329


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ T+ G+ +  ++ GWRHT+++++ G L
Sbjct  196  AVTEDGELYGWGWGRYGNLGLGDRFDRLLPGKVSTVEGEKMVLVACGWRHTISVSSSGSL  255

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  256  YTYGWSKYGQLGHGDFEDHLIP  277


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP  +E   G  +  +++G  HT A+T DG+L
Sbjct  144  AVTMEGEVKSWGRNQNGQLGLGTTEDSLVPRNIEAFQGIPVKMVAAGAEHTAAVTEDGEL  203

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  204  YGWGWGRYGNLGLGDRFDRLLP  225


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T +G++  W
Sbjct  95   SQMQVYSWGWGDFGRLGHGNSSDLFSPQPIKALQGLRIKQIACGDSHCLAVTMEGEVKSW  154

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  155  GRNQNGQLGLGTTEDSLVP  173


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++SG  HT A + +  Q+Y WGW  F
Sbjct  48   SWGRGEDGQLGHGDAEDRFSPTQLSALDDLDIVSVTSGADHTTAYSKSQMQVYSWGWGDF  107

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  SP
Sbjct  108  GRLGHGNSSDLFSP  121



>ref|NP_001267915.1| probable E3 ubiquitin-protein ligase HERC1-like [Vitis vinifera]
 gb|AGG82479.1| UV-B receptor 1 [Vitis vinifera]
Length=445

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HL P KLE L  + IS IS GWRHTMALT+DG+L
Sbjct  239  SVSSSGGLYTYGWSKYGQLGHGDFEDHLTPHKLEALQENLISEISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  299  YGWGWNKFGQVGVGDNVDHCSP  320


 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+ T+ G  +  ++ GWRHT+++++ G L
Sbjct  187  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSTVEGVKMVKVACGWRHTISVSSSGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH +P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLTP  268


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  135  AVTMDGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVSVKMVAAGAEHTAAVTEDGEL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  90   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMDGEVQSWGRNQ  149

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  150  NGQLGLGTTEDSLVP  164


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P  L  L+G  +  ++ G  HT A +    Q+Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRLSPTYLSALNGHEVVSVTCGADHTTAYSESFTQVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>emb|CAN67581.1| hypothetical protein VITISV_010346 [Vitis vinifera]
Length=423

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HL P KLE L  + IS IS GWRHTMALT+DG+L
Sbjct  227  SVSSSGGLYTYGWSKYGQLGHGDFEDHLTPHKLEALQENLISEISGGWRHTMALTSDGKL  286

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  287  YGWGWNKFGQVGVGDNVDHCSP  308


 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+ T+ G  +  ++ GWRHT+++++ G L
Sbjct  175  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSTVEGVKMVKVACGWRHTISVSSSGGL  234

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH +P
Sbjct  235  YTYGWSKYGQLGHGDFEDHLTP  256


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  123  AVTMDGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVSVKMVAAGAEHTAAVTEDGEL  182

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  183  YGWGWGRYGNLGLGDRNDRLVP  204



>emb|CBI21608.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HL P KLE L  + IS IS GWRHTMALT+DG+L
Sbjct  239  SVSSSGGLYTYGWSKYGQLGHGDFEDHLTPHKLEALQENLISEISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  299  YGWGWNKFGQVGVGDNVDHCSP  320


 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+ T+ G  +  ++ GWRHT+++++ G L
Sbjct  187  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSTVEGVKMVKVACGWRHTISVSSSGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH +P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLTP  268


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  135  AVTMDGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVSVKMVAAGAEHTAAVTEDGEL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  90   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMDGEVQSWGRNQ  149

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  150  NGQLGLGTTEDSLVP  164


 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P  L  L G  +  ++ G  HT A +    Q+Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRLSPTYLSALDGHEVVSVTCGADHTTAYSESFTQVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>ref|XP_010652779.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Vitis vinifera]
Length=447

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HL P KLE L  + IS IS GWRHTMALT+DG+L
Sbjct  241  SVSSSGGLYTYGWSKYGQLGHGDFEDHLTPHKLEALQENLISEISGGWRHTMALTSDGKL  300

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  301  YGWGWNKFGQVGVGDNVDHCSP  322


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETL--HGDFISPISSGWRHTMALTTDG  175
            +V+  G LY +GW +YG LG GD    LVP K+ T+   G  +  ++ GWRHT+++++ G
Sbjct  187  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSTVEVQGVKMVKVACGWRHTISVSSSG  246

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
             LY +GW+K+GQ+G GD  DH +P
Sbjct  247  GLYTYGWSKYGQLGHGDFEDHLTP  270


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  135  AVTMDGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVSVKMVAAGAEHTAAVTEDGEL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  90   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMDGEVQSWGRNQ  149

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  150  NGQLGLGTTEDSLVP  164


 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P  L  L G  +  ++ G  HT A +    Q+Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRLSPTYLSALDGHEVVSVTCGADHTTAYSESFTQVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>ref|XP_010527204.1| PREDICTED: ultraviolet-B receptor UVR8 [Tarenaya hassleriana]
Length=434

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGDFE HLVP KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  235  SVSYSGALYTYGWSKYGQLGHGDFEDHLVPHKLEALSNGFISQISGGWRHTMALTSDGKL  294

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  295  YGWGWNKFGQVGVGDNVDHCSP  316


 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD     VP ++ ++ G+ ++ ++ GWRHT++++  G L
Sbjct  183  AVTEDGDLYGWGWGRYGNLGLGDRNDRWVPERVASVGGERMTMVACGWRHTISVSYSGAL  242

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  243  YTYGWSKYGQLGHGDFEDHLVP  264


 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  131  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  190

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  191  YGWGWGRYGNLGLGDRNDRWVP  212


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P +++  +   I  +S GWRHT+A++    +
Sbjct  287  ALTSDGKLYGWGWNKFGQVGVGDNVDHCSPVQVKFPNDQKIVQVSCGWRHTLAVSEQNNV  346

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G++VD   P
Sbjct  347  FSWGRGTNGQLGHGESVDRNFP  368


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T +G++  WG N+
Sbjct  86   VYSWGWGDFGRLGHGNSSDLFTPQPIKALLGIRIKQIACGDSHCLAVTMEGEVQSWGRNQ  145

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+GD  D   P
Sbjct  146  NGQLGLGDTEDSLVP  160


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+  + +  ++Y WGW  F
Sbjct  35   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHGIVSVTCGADHTITYSESHKEVYSWGWGDF  94

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  95   GRLGHGNSSDLFTP  108



>emb|CDP04605.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HLVP KL  L   FIS IS GWRHTMALT DG+L
Sbjct  260  SVSSSGDLYTYGWSKYGQLGHGDFEDHLVPHKLNALSKSFISQISGGWRHTMALTADGKL  319

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+DHCSP
Sbjct  320  YGWGWNKFGQVGVGDNIDHCSP  341


 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW  YG LG GD    L+P K+  + GD +  ++ GWRHT+++++ G L
Sbjct  208  AVTEDGELYGWGWGCYGNLGLGDRNDRLIPAKVSAVEGDKMILVACGWRHTISVSSSGDL  267

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  268  YTYGWSKYGQLGHGDFEDHLVP  289


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+    G  +  +++G  HT A+T DG+L
Sbjct  156  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIGAFQGVPVRMVAAGAEHTAAVTEDGEL  215

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW  +G +G+GD  D   P
Sbjct  216  YGWGWGCYGNLGLGDRNDRLIP  237


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N+
Sbjct  111  VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLKIKQIACGDSHCLAVTMEGEVQSWGRNQ  170

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  171  NGQLGLGTTEDSLVP  185


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTT-DGQLYGWGWN  199
            + ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT A +    ++Y WGW 
Sbjct  58   ICSWGRGEDGQLGHGDAEDRFSPTQLSALDGLEIVSVNCGADHTTAYSELRMEVYSWGWG  117

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  118  DFGRLGHGNSSDLFTP  133



>ref|XP_009626009.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X3 [Nicotiana 
tomentosiformis]
Length=375

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSGSLYTYGWSKYGQLGHGDFE HL P K++ LH  F S IS GWRHTMALT DG+LY
Sbjct  171  VSSSGSLYTYGWSKYGQLGHGDFEDHLFPHKVQALHDSFTSQISGGWRHTMALTADGELY  230

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVGVGDNVDHCSP
Sbjct  231  GWGWNKFGQVGVGDNVDHCSP  251


 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  118  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPVKVSATVGEKMFMVACGWRHTICVSSSGSL  177

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  178  YTYGWSKYGQLGHGDFEDHLFP  199


 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  66   AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  125

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  126  YGWGWGRYGNLGLGDRNDRLVP  147


 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSL-YTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + S+G +  ++G   +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++
Sbjct  14   IKSAGVVSISFGRGDFGRLGHGNSSDLFTPQPIKALHGICIKQIACGDSHCLAVTMEGEV  73

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
              WG N+ GQ+G+G   D   P
Sbjct  74   QSWGRNQNGQLGLGTTEDSLVP  95



>ref|XP_009626007.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Nicotiana 
tomentosiformis]
Length=441

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSGSLYTYGWSKYGQLGHGDFE HL P K++ LH  F S IS GWRHTMALT DG+LY
Sbjct  237  VSSSGSLYTYGWSKYGQLGHGDFEDHLFPHKVQALHDSFTSQISGGWRHTMALTADGELY  296

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVGVGDNVDHCSP
Sbjct  297  GWGWNKFGQVGVGDNVDHCSP  317


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  184  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPVKVSATVGEKMFMVACGWRHTICVSSSGSL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLFP  265


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  132  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLVP  213


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGICIKQIACGDSHCLAVTMEGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLVP  161



>gb|KJB71356.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=265

 Score =   141 bits (355),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  63   SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  122

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  123  YGWGWNKFGQVGVGDNADHCSP  144


 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  11   AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  70

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  71   YTYGWSKYGQLGHGDFEDHLVP  92



>ref|XP_009769438.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X3 [Nicotiana 
sylvestris]
Length=375

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG+LYTYGWSKYGQLGHGDFE HL P K++ LH  F S IS GWRHTMALT DG+LY
Sbjct  171  VSSSGALYTYGWSKYGQLGHGDFEDHLFPHKVQALHDSFTSQISGGWRHTMALTADGELY  230

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVGVGDNVDHCSP
Sbjct  231  GWGWNKFGQVGVGDNVDHCSP  251


 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  118  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPVKVSATVGEKMFMVACGWRHTICVSSSGAL  177

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  178  YTYGWSKYGQLGHGDFEDHLFP  199


 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  66   AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  125

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  126  YGWGWGRYGNLGLGDRNDRLVP  147


 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSL-YTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + S+G +  ++G   +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++
Sbjct  14   IKSAGVVSISFGRGDFGRLGHGNSSDLFTPQPIKALHGICIKQIACGDSHCLAVTMEGEV  73

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
              WG N+ GQ+G+G   D   P
Sbjct  74   QSWGRNQNGQLGLGTTEDSLVP  95



>ref|XP_009626008.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Nicotiana 
tomentosiformis]
Length=428

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSGSLYTYGWSKYGQLGHGDFE HL P K++ LH  F S IS GWRHTMALT DG+LY
Sbjct  224  VSSSGSLYTYGWSKYGQLGHGDFEDHLFPHKVQALHDSFTSQISGGWRHTMALTADGELY  283

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVGVGDNVDHCSP
Sbjct  284  GWGWNKFGQVGVGDNVDHCSP  304


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  171  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPVKVSATVGEKMFMVACGWRHTICVSSSGSL  230

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  231  YTYGWSKYGQLGHGDFEDHLFP  252


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  119  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  178

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  179  YGWGWGRYGNLGLGDRNDRLVP  200


 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N+
Sbjct  74   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGICIKQIACGDSHCLAVTMEGEVQSWGRNQ  133

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  134  NGQLGLGTTEDSLVP  148



>ref|XP_009769436.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Nicotiana 
sylvestris]
Length=441

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG+LYTYGWSKYGQLGHGDFE HL P K++ LH  F S IS GWRHTMALT DG+LY
Sbjct  237  VSSSGALYTYGWSKYGQLGHGDFEDHLFPHKVQALHDSFTSQISGGWRHTMALTADGELY  296

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVGVGDNVDHCSP
Sbjct  297  GWGWNKFGQVGVGDNVDHCSP  317


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  184  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPVKVSATVGEKMFMVACGWRHTICVSSSGAL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLFP  265


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  132  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLVP  213


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGICIKQIACGDSHCLAVTMEGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLVP  161



>ref|XP_010093099.1| hypothetical protein L484_007908 [Morus notabilis]
 gb|EXB53537.1| hypothetical protein L484_007908 [Morus notabilis]
Length=478

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG+LYTYGWSKYGQLGHGDFE HL P KLE L G  +S IS GWRHTMALT+DG+L
Sbjct  237  SVSSSGALYTYGWSKYGQLGHGDFEDHLSPHKLEALSGSVVSQISGGWRHTMALTSDGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+DHC+P
Sbjct  297  YGWGWNKFGQVGVGDNIDHCAP  318


 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G+LY +GW +YG LG GD    LVP K+ T+  + +  ++ GWRHT+++++ G L
Sbjct  185  AITEDGALYGWGWGQYGNLGLGDRNDRLVPEKVSTVDAEKMVMVACGWRHTISVSSSGAL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH SP
Sbjct  245  YTYGWSKYGQLGHGDFEDHLSP  266


 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  133  AVTMEGEVQSWGRNQNGQLGLGTSEDSLVPQKIQAFEGISIKMVAAGAEHTAAITEDGAL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGQYGNLGLGDRNDRLVP  214


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            +   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  84   TQAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGVRIKQIACGDSHCLAVTMEGEVQSW  143

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G + D   P
Sbjct  144  GRNQNGQLGLGTSEDSLVP  162


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A + T  ++Y WGW 
Sbjct  35   VCSWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSETQAEVYSWGWG  94

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  95   DFGRLGHGNSSDLFTP  110



>ref|XP_004146396.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Cucumis 
sativus]
Length=438

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE  LVP +LE L GD IS IS GWRHTMALTTDG+L
Sbjct  231  SVSSLGGLYTYGWSKYGQLGHGDFEDRLVPHRLEALRGDNISQISGGWRHTMALTTDGKL  290

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHCSP
Sbjct  291  YGWGWNKFGQVGAGDNIDHCSP  312


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    LVP K+ ++ GD +  ++ GWRHT+++++ G L
Sbjct  179  AVTEDGELFGWGWGRYGNLGLGDRNDRLVPQKVSSVDGDKMVMVACGWRHTISVSSLGGL  238

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  D   P
Sbjct  239  YTYGWSKYGQLGHGDFEDRLVP  260


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  127  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFEGISIKMVAAGAEHTAAVTEDGEL  186

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGW ++G +G+GD  D   P
Sbjct  187  FGWGWGRYGNLGLGDRNDRLVP  208


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+    L P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  81   EVYSWGWGDFGRLGHGNSSDLLTPKPIKALHGLKIRQIACGDSHCLAVTMEGEVQSWGRN  140

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  141  QNGQLGLGTTEDSLVP  156


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  31   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSVARTEVYSWGWGDF  90

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  91   GRLGHGNSSDLLTP  104



>gb|KJB71360.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=304

 Score =   141 bits (356),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  102  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  161

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  162  YGWGWNKFGQVGVGDNADHCSP  183


 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  50   AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  109

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  110  YTYGWSKYGQLGHGDFEDHLVP  131


 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  14   SGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWG  193
             G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G LYGWG
Sbjct  2    EGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGALYGWG  61

Query  194  WNKFGQVGVGDNVDHCSP  247
            W ++G +G+GD  D   P
Sbjct  62   WGRYGNLGLGDRNDRLVP  79



>gb|KGN54782.1| hypothetical protein Csa_4G496230 [Cucumis sativus]
Length=438

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE  LVP +LE L GD IS IS GWRHTMALTTDG+L
Sbjct  231  SVSSLGGLYTYGWSKYGQLGHGDFEDRLVPHRLEALRGDNISQISGGWRHTMALTTDGKL  290

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHCSP
Sbjct  291  YGWGWNKFGQVGAGDNIDHCSP  312


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    LVP K+ ++ GD +  ++ GWRHT+++++ G L
Sbjct  179  AVTEDGELFGWGWGRYGNLGLGDRNDRLVPQKVSSVDGDKMVMVACGWRHTISVSSLGGL  238

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  D   P
Sbjct  239  YTYGWSKYGQLGHGDFEDRLVP  260


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  127  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFEGISIKMVAAGAEHTAAVTEDGEL  186

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGW ++G +G+GD  D   P
Sbjct  187  FGWGWGRYGNLGLGDRNDRLVP  208


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  81   EVYSWGWGDFGRLGHGNSSDLFTPKPIKALHGLKIRQIACGDSHCLAVTMEGEVQSWGRN  140

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  141  QNGQLGLGTTEDSLVP  156


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  31   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIVSVTCGADHTTAYSVARTEVYSWGWGDF  90

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  91   GRLGHGNSSDLFTP  104



>gb|AHY02156.1| ultraviolet-B receptor UVR8 [Betula platyphylla]
Length=441

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HLVP KLE L  + IS IS GWRHTMAL +DG+L
Sbjct  237  SVSSSGGLYTYGWSKYGQLGHGDFEDHLVPHKLEALCDNNISQISGGWRHTMALASDGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  297  YGWGWNKFGQVGVGDNVDHCSP  318


 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+  ++G+ +  ++ GWRHT+++++ G L
Sbjct  185  AVAEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSAVNGEKMVMVACGWRHTISVSSSGGL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDFEDHLVP  266


 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+  DG+L
Sbjct  133  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVSIKMVAAGAEHTAAVAEDGEL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRNDRLVP  214


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ L+G  I  I+ G  H +A+T +G++  WG N
Sbjct  87   EVYSWGWGDFGRLGHGNSSDLFTPQPIKALNGLRIKQIACGDSHCLAVTMEGEVQSWGRN  146

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  147  QNGQLGLGTTEDSLVP  162


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L    I  ++SG  HT A +    ++Y WGW  F
Sbjct  37   SWGRGEDGQLGHGDAEDRLSPIQLSALDDHEIVSVTSGADHTTAYSQSRLEVYSWGWGDF  96

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  97   GRLGHGNSSDLFTP  110



>ref|XP_011099677.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Sesamum indicum]
Length=447

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSGS+YTYGWSKYGQLGHGDFE HL+P KLE L    IS IS GWRHTMA+T DG+L
Sbjct  246  SVSSSGSIYTYGWSKYGQLGHGDFEDHLIPQKLEALREHRISQISGGWRHTMAVTADGKL  305

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+NVDHCSP
Sbjct  306  YGWGWNKFGQVGVGNNVDHCSP  327


 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD +  LVP K+ T+ G+ +  ++ GWRHT+++++ G +
Sbjct  194  AVTEDGELYGWGWGRYGNLGLGDRDDRLVPGKVSTIQGEKMVLVACGWRHTISVSSSGSI  253

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  254  YTYGWSKYGQLGHGDFEDHLIP  275


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  142  AVTMEGEVQSWGRNQNGQLGLGNTEDSLVPRKIEAFQGISVKMVAAGAEHTAAVTEDGEL  201

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  202  YGWGWGRYGNLGLGDRDDRLVP  223


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T +G++  WG N+
Sbjct  97   VYSWGWGDFGRLGHGNSSDLFTPQPIKALQGLRIKQIACGDSHCLAVTMEGEVQSWGRNQ  156

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  157  NGQLGLGNTEDSLVP  171


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +2

Query  14   SGSLY-TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            SGS+  ++G  + GQLGHGD E    P +L  L G  I  ++SG  HT A + +  Q+Y 
Sbjct  40   SGSVVCSWGRGEDGQLGHGDAEDRFSPTQLSALDGHEIVSVTSGADHTTAYSESQLQVYS  99

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  100  WGWGDFGRLGHGNSSDLFTP  119



>gb|EMS61853.1| hypothetical protein TRIUR3_31019 [Triticum urartu]
Length=308

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGSLYTYGWSKYGQLGHGDFE HLVP K+E L     S IS GWRHTMALT+DG+L
Sbjct  102  TVSSSGSLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSSTSQISGGWRHTMALTSDGKL  161

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN DHCSP
Sbjct  162  YGWGWNKFGQVGAGDNADHCSP  183


 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G +Y +GW +YG LG GD    LVP K+ ++ G+ +  ++ GWRHT+ +++ G L
Sbjct  50   AVTEDGEIYGWGWGRYGNLGLGDRNDRLVPEKVSSVEGEKMVLVACGWRHTITVSSSGSL  109

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  110  YTYGWSKYGQLGHGDFEDHLVP  131


 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +2

Query  14   SGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWG  193
            +G + ++G ++ GQLG G  E  L+P  ++   G  +  I++G  HT A+T DG++YGWG
Sbjct  2    AGEVLSWGRNQNGQLGLGTTEDSLLPQTIQAFEGISVKMIAAGAEHTAAVTEDGEIYGWG  61

Query  194  WNKFGQVGVGDNVDHCSP  247
            W ++G +G+GD  D   P
Sbjct  62   WGRYGNLGLGDRNDRLVP  79


 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P ++       ++ ++ GWRHT+A T    +
Sbjct  154  ALTSDGKLYGWGWNKFGQVGAGDNADHCSPAQVNFPEEQKVAQVACGWRHTLAFTEKKNV  213

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  214  FAWGRGTSGQLGHGEIVDRNTP  235



>ref|XP_011099678.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Sesamum indicum]
Length=446

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSGS+YTYGWSKYGQLGHGDFE HL+P KLE L    IS IS GWRHTMA+T DG+L
Sbjct  246  SVSSSGSIYTYGWSKYGQLGHGDFEDHLIPQKLEALREHRISQISGGWRHTMAVTADGKL  305

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+NVDHCSP
Sbjct  306  YGWGWNKFGQVGVGNNVDHCSP  327


 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD +  LVP K+ T+ G+ +  ++ GWRHT+++++ G +
Sbjct  194  AVTEDGELYGWGWGRYGNLGLGDRDDRLVPGKVSTIQGEKMVLVACGWRHTISVSSSGSI  253

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  254  YTYGWSKYGQLGHGDFEDHLIP  275


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  142  AVTMEGEVQSWGRNQNGQLGLGNTEDSLVPRKIEAFQGISVKMVAAGAEHTAAVTEDGEL  201

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  202  YGWGWGRYGNLGLGDRDDRLVP  223


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T +G++  WG N+
Sbjct  97   VYSWGWGDFGRLGHGNSSDLFTPQPIKALQGLRIKQIACGDSHCLAVTMEGEVQSWGRNQ  156

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  157  NGQLGLGNTEDSLVP  171


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +2

Query  14   SGSLY-TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            SGS+  ++G  + GQLGHGD E    P +L  L G  I  ++SG  HT A + +  Q+Y 
Sbjct  40   SGSVVCSWGRGEDGQLGHGDAEDRFSPTQLSALDGHEIVSVTSGADHTTAYSESQLQVYS  99

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  100  WGWGDFGRLGHGNSSDLFTP  119



>ref|XP_002309939.2| hypothetical protein POPTR_0007s04700g [Populus trichocarpa]
 gb|EEE90389.2| hypothetical protein POPTR_0007s04700g [Populus trichocarpa]
Length=448

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HL P K+E L   +IS IS GWRHTMALT+DG L
Sbjct  245  SVSSSGGLYTYGWSKYGQLGHGDFEDHLTPHKVEALRDSYISMISGGWRHTMALTSDGNL  304

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+DHCSP
Sbjct  305  YGWGWNKFGQVGVGDNIDHCSP  326


 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+  ++GD +  ++ GWRHT+++++ G L
Sbjct  193  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSLVNGDKMIMVACGWRHTISVSSSGGL  252

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH +P
Sbjct  253  YTYGWSKYGQLGHGDFEDHLTP  274


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  141  AVTMDGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVSIKMVAAGAEHTAAVTEDGEL  200

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  201  YGWGWGRYGNLGLGDRNDRLVP  222


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LH   I  I+ G  H +A+T DG++  WG N+
Sbjct  96   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHSLKIRQIACGDSHCLAVTMDGEVQSWGRNQ  155

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  156  NGQLGLGTTEDSLVP  170


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L TL G  I  I+ G  HT + + +  ++Y WGW  F
Sbjct  45   SWGRGEDGQLGHGDAEDRPTPTQLSTLDGLDIISITCGADHTTSYSESRMEVYSWGWGDF  104

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  105  GRLGHGNSSDLFTP  118



>gb|KJB71357.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=355

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  153  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  212

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  213  YGWGWNKFGQVGVGDNADHCSP  234


 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  101  AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  160

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  161  YTYGWSKYGQLGHGDFEDHLVP  182


 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G L
Sbjct  49   AVTMEGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGAL  108

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  109  YGWGWGRYGNLGLGDRNDRLVP  130


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  47   YGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKFGQVGVGD  226
            +G+LGHG+F     P  ++ LHG  I  I+ G  H +A+T +G++  WG N+ GQ+G+G 
Sbjct  12   FGRLGHGNFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGS  71

Query  227  NVDHCSP  247
              D   P
Sbjct  72   TEDSLVP  78



>ref|XP_008442146.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
Length=434

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE  LVP +LE L GD IS IS GWRHTMALTTDG+L
Sbjct  231  SVSSLGGLYTYGWSKYGQLGHGDFEDRLVPHRLEALCGDNISQISGGWRHTMALTTDGKL  290

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHCSP
Sbjct  291  YGWGWNKFGQVGAGDNIDHCSP  312


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    LVP K+ ++ GD +  ++ GWRHT+++++ G L
Sbjct  179  AVTEDGELFGWGWGRYGNLGLGDRNDRLVPQKVSSVDGDKMVMVACGWRHTISVSSLGGL  238

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  D   P
Sbjct  239  YTYGWSKYGQLGHGDFEDRLVP  260


 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  127  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFEGIPIKMVAAGAEHTAAVTEDGEL  186

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGW ++G +G+GD  D   P
Sbjct  187  FGWGWGRYGNLGLGDRNDRLVP  208


 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  81   EVYSWGWGDFGRLGHGNSSDLFTPKPIKALHGLKIRQIACGDSHCLAVTMEGEVQSWGRN  140

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  141  QNGQLGLGTTEDSLVP  156


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT A +    ++Y WGW 
Sbjct  29   VCSWGRGEDGQLGHGDAEDRFSPTQLSALDGHEIVSVTCGADHTTAYSEARTEVYSWGWG  88

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  89   DFGRLGHGNSSDLFTP  104



>ref|XP_007211634.1| hypothetical protein PRUPE_ppa005822mg [Prunus persica]
 gb|EMJ12833.1| hypothetical protein PRUPE_ppa005822mg [Prunus persica]
Length=442

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE HLVP KLE L  +FI   + GWRHTMALT+DG+L
Sbjct  238  SVSSLGRLYTYGWSKYGQLGHGDFEDHLVPHKLEALSNNFICETAGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+DHCSP
Sbjct  298  YGWGWNKFGQVGVGDNIDHCSP  319


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  GSLY +GW +YG LG GD    LVP K+  ++ + +  ++ GWRHT+++++ G+L
Sbjct  186  AVTEDGSLYGWGWGRYGNLGLGDRNDRLVPEKVSMVNSEKMVMVACGWRHTISVSSLGRL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDFEDHLVP  267


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGISVKMVAAGAEHTAAVTEDGSL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P +++  H   +  I+ GWRHT+A+T    +
Sbjct  290  ALTSDGKLYGWGWNKFGQVGVGDNIDHCSPVQVKFPHDQKVVQITCGWRHTLAVTERQNV  349

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+++D   P
Sbjct  350  FSWGRGTNGQLGHGESIDRNVP  371


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S    Y++GW  +G+LGHG+      P  ++ L+G  I  I+ G  H +A+T +G++  W
Sbjct  85   SRTQAYSWGWGDFGRLGHGNSSDLFTPQPIKALYGLRIRQIACGDSHCLAVTMEGEVQSW  144

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  145  GRNQNGQLGLGTTEDSLVP  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P  L  L G  I  ++ G  HT+A + +  Q Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRLSPTHLSALDGHEIVSVTCGADHTIAYSDSRTQAYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>ref|XP_008227523.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume]
Length=442

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE HLVP KLE L  +FI   + GWRHTMALT+DG+L
Sbjct  238  SVSSLGRLYTYGWSKYGQLGHGDFEDHLVPHKLEALSNNFICETAGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+DHCSP
Sbjct  298  YGWGWNKFGQVGVGDNIDHCSP  319


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  GSLY +GW +YG LG GD    LVP K+  ++ + +  ++ GWRHT+++++ G+L
Sbjct  186  AVTEDGSLYGWGWGRYGNLGLGDRNDRLVPEKVSMVNSEKMVMVACGWRHTISVSSLGRL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDFEDHLVP  267


 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGISVKMVAAGAEHTAAVTEDGSL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P +++  H   +  I+ GWRHT+A+T    +
Sbjct  290  ALTSDGKLYGWGWNKFGQVGVGDNIDHCSPVQVKFPHDQKVVQITCGWRHTLAVTERQNV  349

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+++D   P
Sbjct  350  FSWGRGTNGQLGHGESIDRNVP  371


 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  26   YTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKF  205
            Y++GW  +G+LGHG+      P  ++ L+G  I  I+ G  H +A+T +G++  WG N+ 
Sbjct  90   YSWGWGDFGRLGHGNSSDLFTPQPIKALYGLRIRQIACGDSHCLAVTMEGEVQSWGRNQN  149

Query  206  GQVGVGDNVDHCSP  247
            GQ+G+G   D   P
Sbjct  150  GQLGLGTTEDSLVP  163


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYG  187
            S     ++G  + GQLGHGD E  L P  L  L G  I  ++ G  HT+A +    Q Y 
Sbjct  32   SENVFCSWGRGEDGQLGHGDAEDRLSPTHLSALDGHEIVSVTCGADHTIAYSDSCTQAYS  91

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  92   WGWGDFGRLGHGNSSDLFTP  111



>ref|XP_008442148.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X3 [Cucumis melo]
 ref|XP_008442149.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X3 [Cucumis melo]
Length=425

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE  LVP +LE L GD IS IS GWRHTMALTTDG+L
Sbjct  222  SVSSLGGLYTYGWSKYGQLGHGDFEDRLVPHRLEALCGDNISQISGGWRHTMALTTDGKL  281

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHCSP
Sbjct  282  YGWGWNKFGQVGAGDNIDHCSP  303


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    LVP K+ ++ GD +  ++ GWRHT+++++ G L
Sbjct  170  AVTEDGELFGWGWGRYGNLGLGDRNDRLVPQKVSSVDGDKMVMVACGWRHTISVSSLGGL  229

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  D   P
Sbjct  230  YTYGWSKYGQLGHGDFEDRLVP  251


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  118  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFEGIPIKMVAAGAEHTAAVTEDGEL  177

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGW ++G +G+GD  D   P
Sbjct  178  FGWGWGRYGNLGLGDRNDRLVP  199


 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  72   EVYSWGWGDFGRLGHGNSSDLFTPKPIKALHGLKIRQIACGDSHCLAVTMEGEVQSWGRN  131

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  132  QNGQLGLGTTEDSLVP  147


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  22   SWGRGEDGQLGHGDAEDRFSPTQLSALDGHEIVSVTCGADHTTAYSEARTEVYSWGWGDF  81

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  82   GRLGHGNSSDLFTP  95



>gb|KDP29458.1| hypothetical protein JCGZ_19287 [Jatropha curcas]
Length=437

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDF  HL+P +LE L   FIS +S GWRHTMA+T+DG+L
Sbjct  237  SVSSSGGLYTYGWSKYGQLGHGDFADHLIPHQLEALRDSFISQVSGGWRHTMAVTSDGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQ+GVGDNVDHCSP
Sbjct  297  YGWGWNKFGQIGVGDNVDHCSP  318


 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+   HG+ +  ++ GWRHT+++++ G L
Sbjct  185  AVTEDGELYGWGWGRYGNLGLGDRMDRLVPEKVSLTHGEKMVMVACGWRHTISVSSSGGL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDFADHLIP  266


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP ++  L G  I  +++G  HT A+T DG+L
Sbjct  133  AVTVEGQVQSWGRNQNGQLGLGTTEDSLVPQRIGALQGIPIKMVAAGAEHTAAVTEDGEL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD +D   P
Sbjct  193  YGWGWGRYGNLGLGDRMDRLVP  214


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +GQ+  WG N+
Sbjct  88   VYSWGWGDFGRLGHGNCSDLFTPQPIKALHGLKIKQIACGDSHCLAVTVEGQVQSWGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  148  NGQLGLGTTEDSLVP  162


 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD +  L P +L TL    I  ++ G  HT+A +     +Y WGW  F
Sbjct  37   SWGRGEDGQLGHGDADDRLSPTQLSTLDDHEIVSVTCGADHTIAYSEALMDVYSWGWGDF  96

Query  206  GQVGVGDNVDHCSP  247
            G++G G+  D  +P
Sbjct  97   GRLGHGNCSDLFTP  110



>ref|XP_008442147.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Cucumis melo]
Length=432

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHGDFE  LVP +LE L GD IS IS GWRHTMALTTDG+L
Sbjct  231  SVSSLGGLYTYGWSKYGQLGHGDFEDRLVPHRLEALCGDNISQISGGWRHTMALTTDGKL  290

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHCSP
Sbjct  291  YGWGWNKFGQVGAGDNIDHCSP  312


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    LVP K+ ++ GD +  ++ GWRHT+++++ G L
Sbjct  179  AVTEDGELFGWGWGRYGNLGLGDRNDRLVPQKVSSVDGDKMVMVACGWRHTISVSSLGGL  238

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  D   P
Sbjct  239  YTYGWSKYGQLGHGDFEDRLVP  260


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  127  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFEGIPIKMVAAGAEHTAAVTEDGEL  186

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGW ++G +G+GD  D   P
Sbjct  187  FGWGWGRYGNLGLGDRNDRLVP  208


 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  81   EVYSWGWGDFGRLGHGNSSDLFTPKPIKALHGLKIRQIACGDSHCLAVTMEGEVQSWGRN  140

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  141  QNGQLGLGTTEDSLVP  156


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  31   SWGRGEDGQLGHGDAEDRFSPTQLSALDGHEIVSVTCGADHTTAYSEARTEVYSWGWGDF  90

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  91   GRLGHGNSSDLFTP  104



>ref|XP_010321071.1| PREDICTED: ultraviolet-B receptor UVR8 [Solanum lycopersicum]
Length=447

 Score =   141 bits (356),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG+LYTYGWSKYGQLGHGDFE HL P K++ LHG F S IS GWRHTMALT+DG+LY
Sbjct  243  VSSSGALYTYGWSKYGQLGHGDFEDHLSPHKVQALHGSFTSQISGGWRHTMALTSDGKLY  302

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVGV DN DHCSP
Sbjct  303  GWGWNKFGQVGVDDNCDHCSP  323


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  190  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSADVGEKMFIVACGWRHTICVSSSGAL  249

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH SP
Sbjct  250  YTYGWSKYGQLGHGDFEDHLSP  271


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  138  AVTMGGEVQSWGRNQNGQLGLGTTEDSLVPRKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLVP  219


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G  D   H  P +++  H   +  IS GWRHT+A T    +
Sbjct  294  ALTSDGKLYGWGWNKFGQVGVDDNCDHCSPVQVKFPHDQKVILISCGWRHTLAATERQNV  353

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G++VD   P
Sbjct  354  FSWGRGTNGQLGHGESVDRSVP  375


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T  G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGIRIKQIACGDSHCLAVTMGGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYG  187
            S   + ++G  + GQLG GD E    P ++  L G  I  ++ G  HT A +    Q+Y 
Sbjct  36   SGNVVCSWGRGEDGQLGLGDAEDRFSPTQVSALDGQEIVSLTCGADHTTAYSEALKQVYS  95

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  96   WGWGDFGRLGHGNSSDLFTP  115



>ref|XP_010930682.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Elaeis guineensis]
Length=448

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + S+SGSLYT+GWSKYGQLGHGDFE HL+P +LE L    IS IS GWRHTMALT+DG+L
Sbjct  245  AASASGSLYTFGWSKYGQLGHGDFEDHLIPHQLEALKDSCISQISGGWRHTMALTSDGRL  304

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  305  YGWGWNKFGQVGVGDNVDHCSP  326


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+  +    +  ++ GWRHT+A +  G L
Sbjct  193  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSAIEEQKMVLVACGWRHTIAASASGSL  252

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  253  YTFGWSKYGQLGHGDFEDHLIP  274


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP +++   G  +  +++G  HT A+T DG+L
Sbjct  141  AVTVDGQVQSWGRNQNGQLGLGTTEDSLVPQRIQAFQGIAVKMVAAGAEHTAAVTEDGEL  200

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  201  YGWGWGRYGNLGLGDRNDRLVP  222


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T DGQ+  WG N+
Sbjct  96   VYSWGWGDFGRLGHGNSSDVFTPQSIKALQGLKIKQIACGDSHCLAVTVDGQVQSWGRNQ  155

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  156  NGQLGLGTTEDSLVP  170


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTT-DGQLYG  187
            S  ++ ++G  + GQLGHGD E   +P  L  L+   I  ++ G  HT A +  + Q+Y 
Sbjct  39   SDNAVCSWGRGEDGQLGHGDAEDRHLPTLLSALNSRGIVSVTCGADHTTAYSEPELQVYS  98

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  99   WGWGDFGRLGHGNSSDVFTP  118



>gb|KJB71359.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=443

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  240  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  300  YGWGWNKFGQVGVGDNADHCSP  321


 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  188  AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+F     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SCTEVYSWGWGDFGRLGHGNFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSTEDSLVP  165


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSCTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G+  D  +P
Sbjct  100  GRLGHGNFSDLFTP  113



>gb|KJB71355.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=442

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  240  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  300  YGWGWNKFGQVGVGDNADHCSP  321


 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  188  AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+F     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SCTEVYSWGWGDFGRLGHGNFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSTEDSLVP  165


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSCTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G+  D  +P
Sbjct  100  GRLGHGNFSDLFTP  113



>ref|XP_010930683.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Elaeis guineensis]
Length=446

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + S+SGSLYT+GWSKYGQLGHGDFE HL+P +LE L    IS IS GWRHTMALT+DG+L
Sbjct  243  AASASGSLYTFGWSKYGQLGHGDFEDHLIPHQLEALKDSCISQISGGWRHTMALTSDGRL  302

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  303  YGWGWNKFGQVGVGDNVDHCSP  324


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+  +    +  ++ GWRHT+A +  G L
Sbjct  193  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSAIEKMVL--VACGWRHTIAASASGSL  250

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  251  YTFGWSKYGQLGHGDFEDHLIP  272


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP +++   G  +  +++G  HT A+T DG+L
Sbjct  141  AVTVDGQVQSWGRNQNGQLGLGTTEDSLVPQRIQAFQGIAVKMVAAGAEHTAAVTEDGEL  200

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  201  YGWGWGRYGNLGLGDRNDRLVP  222


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T DGQ+  WG N+
Sbjct  96   VYSWGWGDFGRLGHGNSSDVFTPQSIKALQGLKIKQIACGDSHCLAVTVDGQVQSWGRNQ  155

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  156  NGQLGLGTTEDSLVP  170


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTT-DGQLYG  187
            S  ++ ++G  + GQLGHGD E   +P  L  L+   I  ++ G  HT A +  + Q+Y 
Sbjct  39   SDNAVCSWGRGEDGQLGHGDAEDRHLPTLLSALNSRGIVSVTCGADHTTAYSEPELQVYS  98

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  99   WGWGDFGRLGHGNSSDVFTP  118



>ref|XP_010930684.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X3 [Elaeis guineensis]
 ref|XP_010930686.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X3 [Elaeis guineensis]
Length=439

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + S+SGSLYT+GWSKYGQLGHGDFE HL+P +LE L    IS IS GWRHTMALT+DG+L
Sbjct  236  AASASGSLYTFGWSKYGQLGHGDFEDHLIPHQLEALKDSCISQISGGWRHTMALTSDGRL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVDHCSP
Sbjct  296  YGWGWNKFGQVGVGDNVDHCSP  317


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+  +    +  ++ GWRHT+A +  G L
Sbjct  184  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSAIEEQKMVLVACGWRHTIAASASGSL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTFGWSKYGQLGHGDFEDHLIP  265


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP +++   G  +  +++G  HT A+T DG+L
Sbjct  132  AVTVDGQVQSWGRNQNGQLGLGTTEDSLVPQRIQAFQGIAVKMVAAGAEHTAAVTEDGEL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLVP  213


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T DGQ+  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDVFTPQSIKALQGLKIKQIACGDSHCLAVTVDGQVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLVP  161


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTT-DGQLYG  187
            S  ++ ++G  + GQLGHGD E   +P  L  L+   I  ++ G  HT A +  + Q+Y 
Sbjct  30   SDNAVCSWGRGEDGQLGHGDAEDRHLPTLLSALNSRGIVSVTCGADHTTAYSEPELQVYS  89

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  90   WGWGDFGRLGHGNSSDVFTP  109



>gb|KJB71363.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=427

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  240  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  300  YGWGWNKFGQVGVGDNADHCSP  321


 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  188  AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+F     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SCTEVYSWGWGDFGRLGHGNFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSTEDSLVP  165


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSCTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G+  D  +P
Sbjct  100  GRLGHGNFSDLFTP  113



>gb|KJB71358.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=438

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  240  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  300  YGWGWNKFGQVGVGDNADHCSP  321


 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  188  AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+F     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SCTEVYSWGWGDFGRLGHGNFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSTEDSLVP  165


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSCTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G+  D  +P
Sbjct  100  GRLGHGNFSDLFTP  113



>gb|KHG12285.1| Herc4 [Gossypium arboreum]
Length=462

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  240  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  300  YGWGWNKFGQVGVGDNADHCSP  321


 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  188  AVSEDGALYGWGWGQYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ DG L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSIEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEDGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGQYGNLGLGDRNDRLVP  217


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHGDF     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SRTEVYSWGWGDFGRLGHGDFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSIEDSLVP  165


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 20/102 (20%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFIS------------------  127
            +++S G LY +GW+K+GQ+G GD   H  P  ++  H   +S                  
Sbjct  292  ALTSDGKLYGWGWNKFGQVGVGDNADHCSPVLVKFPHEQALSYYLVKQSLLICMSLTWQK  351

Query  128  --PISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
               +S GWRHT+A+T +  ++ WG    GQ+G G++ D   P
Sbjct  352  VVQVSCGWRHTLAITEEKNVFSWGRGTNGQLGHGESTDRNVP  393


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A + +  ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSRTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G GD  D  +P
Sbjct  100  GRLGHGDFSDLFTP  113



>ref|XP_011022871.1| PREDICTED: ultraviolet-B receptor UVR8 [Populus euphratica]
Length=442

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HL P K+E L   +IS IS GWRHTMALT++G L
Sbjct  241  SVSSSGGLYTYGWSKYGQLGHGDFEDHLTPHKVEALRDSYISLISGGWRHTMALTSNGNL  300

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+DHCSP
Sbjct  301  YGWGWNKFGQVGVGDNIDHCSP  322


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L P K+  ++GD +  ++ GWRHT+++++ G L
Sbjct  189  AVTEDGELYGWGWGRYGNLGLGDRNDRLFPEKVPLVNGDKMIMVACGWRHTISVSSSGGL  248

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH +P
Sbjct  249  YTYGWSKYGQLGHGDFEDHLTP  270


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  137  AVTMDGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVSIKMVAAGAEHTAAVTEDGEL  196

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  197  YGWGWGRYGNLGLGDRNDRLFP  218


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  92   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLKIRQIACGDSHCLAVTMDGEVQSWGRNQ  151

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  152  NGQLGLGTTEDSLVP  166


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L TL G  I  I+ G  HT A + +  ++Y WGW  F
Sbjct  41   SWGRGEDGQLGHGDAEDRPTPTQLSTLDGLDIISITCGADHTTAYSESRMEVYSWGWGDF  100

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  101  GRLGHGNSSDLFTP  114



>ref|XP_003575134.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brachypodium distachyon]
 ref|XP_010235544.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brachypodium distachyon]
Length=448

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSG LYTYGWSKYGQLGHGDFE HLVP KLE L   FIS I+ GWRHTMA+  DG+L
Sbjct  244  TVSSSGDLYTYGWSKYGQLGHGDFEDHLVPHKLEALKDRFISQIAGGWRHTMAVAGDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGV DNVDHCSP
Sbjct  304  YGWGWNKFGQVGVADNVDHCSP  325


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++   G LY +GW +YG LG GD    LVP K+ ++ G+ +  ++ GWRHT+ +++ G L
Sbjct  192  AILEDGDLYGWGWGQYGNLGLGDRNDRLVPEKVSSVEGEKMVLVACGWRHTVTVSSSGDL  251

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  252  YTYGWSKYGQLGHGDFEDHLVP  273


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G ++++G ++ GQLG G+ E  L+P K+    G  +  I++G  HT A+  DG L
Sbjct  140  AVTDAGQVHSWGRNQNGQLGLGNTEDSLLPQKIHAFEGVCVKMIAAGAEHTAAILEDGDL  199

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  200  YGWGWGQYGNLGLGDRNDRLVP  221


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            LY++GW  +G+LGHG+      P  +E L G  I  I+ G  H +A+T  GQ++ WG N+
Sbjct  95   LYSWGWGDFGRLGHGNSSDVFHPQPIEALQGIKIKQIACGDSHCLAVTDAGQVHSWGRNQ  154

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  155  NGQLGLGNTEDSLLP  169


 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFI-SPISSGWRHTMALTTDG-  175
            ++ SS ++ ++G  + GQLGHGD E   VP  L       I S +  G  HT A + +  
Sbjct  34   ALLSSKAVCSWGRGEDGQLGHGDAEDRPVPTLLSGFDVPGIASVVICGADHTTAYSDEQM  93

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            QLY WGW  FG++G G++ D   P
Sbjct  94   QLYSWGWGDFGRLGHGNSSDVFHP  117



>gb|KHG12284.1| Herc4 [Gossypium arboreum]
Length=467

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  245  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  304

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  305  YGWGWNKFGQVGVGDNADHCSP  326


 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLH-----GDFISPISSGWRHTMALT  166
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+     G+ ++ ++ GWRHT++++
Sbjct  188  AVSEDGALYGWGWGQYGNLGLGDRNDRLVPEKVSTLNNFQMQGEKMNMVACGWRHTISVS  247

Query  167  TDGQLYGWGWNKFGQVGVGDNVDHCSP  247
              G+LY +GW+K+GQ+G GD  DH  P
Sbjct  248  DTGRLYTYGWSKYGQLGHGDFEDHLVP  274


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ DG L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSIEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEDGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGQYGNLGLGDRNDRLVP  217


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHGDF     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SRTEVYSWGWGDFGRLGHGDFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSIEDSLVP  165


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 20/102 (20%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFIS------------------  127
            +++S G LY +GW+K+GQ+G GD   H  P  ++  H   +S                  
Sbjct  297  ALTSDGKLYGWGWNKFGQVGVGDNADHCSPVLVKFPHEQALSYYLVKQSLLICMSLTWQK  356

Query  128  --PISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
               +S GWRHT+A+T +  ++ WG    GQ+G G++ D   P
Sbjct  357  VVQVSCGWRHTLAITEEKNVFSWGRGTNGQLGHGESTDRNVP  398


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A + +  ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSRTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G GD  D  +P
Sbjct  100  GRLGHGDFSDLFTP  113



>gb|EEC73389.1| hypothetical protein OsI_07634 [Oryza sativa Indica Group]
Length=448

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGS+YTYGWSKYGQLGHGDFE HLVP KLE L    IS IS GWRHTMAL  DG+L
Sbjct  247  TVSSSGSIYTYGWSKYGQLGHGDFEDHLVPHKLEALKDTTISQISGGWRHTMALAADGKL  306

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  307  YGWGWNKFGQVGVGDNEDHCSP  328


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD +  L+P K+ +++G  +  ++ GWRHT+ +++ G +
Sbjct  195  AVTEDGDLYGWGWGRYGNLGLGDRDDRLIPEKVSSVNGQKMVLVACGWRHTITVSSSGSI  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  255  YTYGWSKYGQLGHGDFEDHLVP  276


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G ++++G ++ GQLG G+ E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  143  AVTVAGHVHSWGRNQNGQLGLGNTEDSLLPQKIQAFEGVRVKMIAAGAEHTAAVTEDGDL  202

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  203  YGWGWGRYGNLGLGDRDDRLIP  224


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            LY++GW  +G+LGHG+      P  ++ L G  I+ I+ G  H +A+T  G ++ WG N+
Sbjct  98   LYSWGWGDFGRLGHGNSSDVFNPQPIQALQGVRITQIACGDSHCLAVTVAGHVHSWGRNQ  157

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  158  NGQLGLGNTEDSLLP  172


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 5/84 (6%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGD----FISPISSGWRHTMALTTDG-  175
            S G + ++G  + GQLGHGD E   VP  L     D      S +  G  HT A + +  
Sbjct  37   SGGVVCSWGRGEDGQLGHGDAEDRPVPTVLTAAFDDAPGGVASVVICGADHTTAYSDEEL  96

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            QLY WGW  FG++G G++ D  +P
Sbjct  97   QLYSWGWGDFGRLGHGNSSDVFNP  120



>ref|NP_001047115.1| Os02g0554100 [Oryza sativa Japonica Group]
 dbj|BAD33304.1| putative UVB-resistance protein (UVR8) [Oryza sativa Japonica 
Group]
 dbj|BAF09029.1| Os02g0554100 [Oryza sativa Japonica Group]
 dbj|BAG91677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGS+YTYGWSKYGQLGHGDFE HLVP KLE L    IS IS GWRHTMAL  DG+L
Sbjct  252  TVSSSGSIYTYGWSKYGQLGHGDFEDHLVPHKLEALKDTTISQISGGWRHTMALAADGKL  311

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  312  YGWGWNKFGQVGVGDNEDHCSP  333


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD +  L+P K+ +++G  +  ++ GWRHT+ +++ G +
Sbjct  200  AVTEDGDLYGWGWGRYGNLGLGDRDDRLIPEKVSSVNGQKMVLVACGWRHTITVSSSGSI  259

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  260  YTYGWSKYGQLGHGDFEDHLVP  281


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G ++++G ++ GQLG G+ E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  148  AVTVAGHVHSWGRNQNGQLGLGNTEDSLLPQKIQAFEGVRVKMIAAGAEHTAAVTEDGDL  207

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  208  YGWGWGRYGNLGLGDRDDRLIP  229


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            LY++GW  +G+LGHG+      P  ++ L G  I+ I+ G  H +A+T  G ++ WG N+
Sbjct  103  LYSWGWGDFGRLGHGNSSDVFNPQPIQALQGVRITQIACGDSHCLAVTVAGHVHSWGRNQ  162

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  163  NGQLGLGNTEDSLLP  177


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 5/84 (6%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGD----FISPISSGWRHTMALTTDG-  175
            S G + ++G  + GQLGHGD E   VP  L     D      S +  G  HT A + +  
Sbjct  42   SGGVVCSWGRGEDGQLGHGDAEDRPVPTVLTAAFDDAPGGVASVVICGADHTTAYSDEEL  101

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            QLY WGW  FG++G G++ D  +P
Sbjct  102  QLYSWGWGDFGRLGHGNSSDVFNP  125



>ref|XP_006647367.1| PREDICTED: ultraviolet-B receptor UVR8-like [Oryza brachyantha]
Length=440

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGS+YTYGWSKYGQLGHGDFE HLVP KLE L    IS IS GWRHTMAL  DG+L
Sbjct  243  TVSSSGSIYTYGWSKYGQLGHGDFEDHLVPHKLEALKDTTISQISGGWRHTMALAADGKL  302

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  303  YGWGWNKFGQVGVGDNEDHCSP  324


 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD +  L+P K+ ++ G  +  ++ GWRHT+ +++ G +
Sbjct  191  AVTEDGDLYGWGWGRYGNLGLGDRDDRLIPEKVSSVEGQKMVLVACGWRHTITVSSSGSI  250

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  251  YTYGWSKYGQLGHGDFEDHLVP  272


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G ++++G ++ GQLG G+ +  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  139  AVTVAGHVHSWGRNQNGQLGLGNTDDSLIPQKIQAFEGVRVKMIAAGAEHTAAVTEDGDL  198

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  199  YGWGWGRYGNLGLGDRDDRLIP  220


 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            LY++GW  +G+LGHG+      P  ++ L G  ++ I+ G  H +A+T  G ++ WG N+
Sbjct  94   LYSWGWGDFGRLGHGNSSDVFNPQPIQALQGVRVAQIACGDSHCLAVTVAGHVHSWGRNQ  153

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  154  NGQLGLGNTDDSLIP  168



>dbj|BAJ95741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGSLYTYGWSKYGQLGHGDFE HLVP K+E L     S IS GWRHTMALT+DG+L
Sbjct  237  TVSSSGSLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSSTSQISGGWRHTMALTSDGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN DHCSP
Sbjct  297  YGWGWNKFGQVGAGDNADHCSP  318


 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G +Y +GW +YG LG GD     VP K+ ++ GD +  ++ GWRHT+ +++ G L
Sbjct  185  AVTEDGDIYGWGWGRYGNLGLGDRNDRFVPEKVSSVEGDKMVLVACGWRHTITVSSSGSL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDFEDHLVP  266


 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P  ++   G  +  I++G  HT A+T DG +
Sbjct  133  AVTMAGEVLSWGRNQNGQLGLGTTEDSLLPQTIQAFEGISVKMIAAGAEHTAAVTEDGDI  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRNDRFVP  214


 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            L T+G  + GQLGHGD E  LVP  +       I+ +  G  HT A + D  Q+Y WGW 
Sbjct  35   LCTWGRGEDGQLGHGDAEDRLVPTVISGFDAPGITSVICGADHTTAYSEDEHQVYSWGWG  94

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  95   DFGRLGHGNSTDVFTP  110


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  ++ G  H +A+T  G++  WG N+
Sbjct  88   VYSWGWGDFGRLGHGNSTDVFTPQPVKALQGIKIKQLACGDSHCLAVTMAGEVLSWGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  148  NGQLGLGTTEDSLLP  162


 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT  166
            +++S G LY +GW+K+GQ+G GD   H  P ++       ++ ++ GWRHT+A T
Sbjct  289  ALTSDGKLYGWGWNKFGQVGAGDNADHCSPAQVNFPEEQKVAQVACGWRHTLAFT  343



>ref|XP_008394185.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
Length=452

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HLVP +LE L   FI   + GWRHTMALT+DG L
Sbjct  248  SVSSSGRLYTYGWSKYGQLGHGDFEDHLVPHELEALSDKFICETAGGWRHTMALTSDGIL  307

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+DHCSP
Sbjct  308  YGWGWNKFGQVGVGDNIDHCSP  329


 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  GSLY +GW +YG LG GD    +VP ++  ++ + +  ++ GWRHT+++++ G+L
Sbjct  196  AVTEDGSLYGWGWGRYGNLGLGDRNDRMVPERVSMVNSEKMVMVACGWRHTISVSSSGRL  255

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  256  YTYGWSKYGQLGHGDFEDHLVP  277


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG L
Sbjct  144  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGLSVKMVAAGAEHTAAVTEDGSL  203

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  204  YGWGWGRYGNLGLGDRNDRMVP  225


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            +S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  
Sbjct  94   NSRSEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGIKIRQIACGDSHCLAVTMEGEVQS  153

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  154  WGRNQNGQLGLGTTEDSLVP  173


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S     ++G  + GQLGHGD E  L+P  L  L G  I  I+ G  HT+A + +  ++Y 
Sbjct  42   SENVFCSWGRGEDGQLGHGDAEDRLLPTHLSALDGHEIVSITCGADHTIAYSNSRSEVYS  101

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  102  WGWGDFGRLGHGNSSDLFTP  121



>gb|EMT03905.1| Putative E3 ubiquitin-protein ligase HERC4 [Aegilops tauschii]
Length=434

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGSLYTYGWSKYGQLGHGDFE HLVP K+E L     S IS GWRHTMALT+DG+L
Sbjct  228  TVSSSGSLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSSTSQISGGWRHTMALTSDGKL  287

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN DHCSP
Sbjct  288  YGWGWNKFGQVGAGDNADHCSP  309


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G +Y +GW +YG LG GD     VP K+ ++ G+ +  ++ GWRHT+ +++ G L
Sbjct  176  AVTEDGEIYGWGWGRYGNLGLGDRNDRFVPEKVSSVEGEKMVLVACGWRHTITVSSSGSL  235

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  236  YTYGWSKYGQLGHGDFEDHLVP  257


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P  ++   G  ++ I++G  HT A+T DG++
Sbjct  124  AVTMAGEVLSWGRNQNGQLGLGTTEDSLLPQTIQAFEGISVNMIAAGAEHTAAVTEDGEI  183

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  184  YGWGWGRYGNLGLGDRNDRFVP  205


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P ++       ++ ++ GWRHT+A T    +
Sbjct  280  ALTSDGKLYGWGWNKFGQVGAGDNADHCSPAQVNFPEEQKVAQVACGWRHTLAFTEKKNV  339

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  340  FAWGRGTSGQLGHGEIVDRNTP  361


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  ++ G  H +A+T  G++  WG N+
Sbjct  79   VYSWGWGDFGRLGHGNSTDVFTPQPVKALQGIKIKQLACGDSHCLAVTMAGEVLSWGRNQ  138

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  139  NGQLGLGTTEDSLLP  153



>dbj|BAJ88198.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGSLYTYGWSKYGQLGHGDFE HLVP K+E L     S IS GWRHTMALT+DG+L
Sbjct  237  TVSSSGSLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSSTSQISGGWRHTMALTSDGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN DHCSP
Sbjct  297  YGWGWNKFGQVGAGDNADHCSP  318


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G +Y +GW +YG LG GD     VP K+ ++ GD +  ++ GWRHT+ +++ G L
Sbjct  185  AVTEDGDIYGWGWGRYGNLGLGDRNDRFVPEKVSSVEGDKMVLVACGWRHTITVSSSGSL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDFEDHLVP  266


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P  ++   G  +  I++G  HT A+T DG +
Sbjct  133  AVTMAGEVLSWGRNQNGQLGLGTTEDSLLPQTIQAFEGISVKMIAAGAEHTAAVTEDGDI  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRNDRFVP  214


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P ++       ++ ++ GWRHT+A T    +
Sbjct  289  ALTSDGKLYGWGWNKFGQVGAGDNADHCSPAQVNFPEEQKVAQVACGWRHTLAFTEKKNV  348

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  349  FAWGRGTSGQLGHGEIVDRNTP  370


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            L T+G  + GQLGHGD E  LVP  +       I+ +  G  HT A + D  Q+Y WGW 
Sbjct  35   LCTWGRGEDGQLGHGDAEDRLVPTVISGFDAPGITSVICGADHTTAYSEDEHQVYSWGWG  94

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  95   DFGRLGHGNSTDVFTP  110


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  ++ G  H +A+T  G++  WG N+
Sbjct  88   VYSWGWGDFGRLGHGNSTDVFTPQPVKALQGIKIKQLACGDSHCLAVTMAGEVLSWGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  148  NGQLGLGTTEDSLLP  162



>pdb|4DNW|A Chain A, Crystal Structure Of Uvb-resistance Protein Uvr8
 pdb|4DNW|B Chain B, Crystal Structure Of Uvb-resistance Protein Uvr8
Length=374

 Score =   138 bits (347),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  227  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKL  286

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  287  YGWGWNKFGQVGVGNNLDQCSP  308


 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  175  AVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGAL  234

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  235  YTYGWSKYGQLGHGDLEDHLIP  256


 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  123  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  182

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  183  YGWGWGRYGNLGLGDRTDRLVP  204


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  77   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRN  136

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  137  QNGQLGLGDTEDSLVP  152


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  27   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDF  86

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  87   GRLGHGNSSDLFTP  100



>ref|XP_002866579.1| UVB-resistance 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42838.1| UVB-resistance 8 [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  298  YGWGWNKFGQVGVGNNLDQCSP  319


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLIP  267


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  88   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRN  147

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  148  QNGQLGLGDTEDSLVP  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>pdb|4D9S|A Chain A, Crystal Structure Of Arabidopsis Thaliana Uvr8 (Uv Resistance 
Locus 8)
 pdb|4D9S|B Chain B, Crystal Structure Of Arabidopsis Thaliana Uvr8 (Uv Resistance 
Locus 8)
Length=406

 Score =   138 bits (348),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  239  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  299  YGWGWNKFGQVGVGNNLDQCSP  320


 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  187  AVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGAL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDLEDHLIP  268


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  135  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRTDRLVP  216


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  89   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRN  148

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  149  QNGQLGLGDTEDSLVP  164


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>ref|XP_009112108.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brassica rapa]
Length=440

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L    IS IS GWRHTMALT+DG+L
Sbjct  240  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALGSSVISQISGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+D CSP
Sbjct  300  YGWGWNKFGQVGVGDNIDQCSP  321


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPRKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +   + +S ++ GWRHT++++  G L
Sbjct  188  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGAEKMSMVACGWRHTISVSYSGAL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDLEDHLIP  269


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SRMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGVRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+GD  D   P
Sbjct  147  GRNQNGQLGLGDTEDSLVP  165


 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHQIVSVTCGADHTVAYSQSRMEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  100  GRLGHGNSSDLFTP  113



>ref|NP_201191.1| ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
 sp|Q9FN03.1|UVR8_ARATH RecName: Full=Ultraviolet-B receptor UVR8; AltName: Full=Protein 
UV-B RESISTANCE 8; AltName: Full=RCC1 domain-containing 
protein UVR8 [Arabidopsis thaliana]
 dbj|BAB11034.1| UVB-resistance protein UVR8 [Arabidopsis thaliana]
 gb|AAM78089.1| AT5g63860/MGI19_6 [Arabidopsis thaliana]
 gb|AAN18169.1| At5g63860/MGI19_6 [Arabidopsis thaliana]
 gb|AED97805.1| ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
Length=440

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  298  YGWGWNKFGQVGVGNNLDQCSP  319


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLIP  267


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRTDRLVP  215


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  88   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRN  147

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  148  QNGQLGLGDTEDSLVP  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>ref|XP_010695065.1| PREDICTED: ultraviolet-B receptor UVR8 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+SSGS+YTYGWSKYGQLGHGDFE HL P KLE L G  IS IS GWRHTMA+T+DG+L
Sbjct  248  TVTSSGSIYTYGWSKYGQLGHGDFEDHLTPFKLEALSGQIISQISGGWRHTMAVTSDGKL  307

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN D C P
Sbjct  308  YGWGWNKFGQVGVGDNADRCFP  329


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G +Y +GW +YG LG GD +  L+P K  ++ G  +  ++ GWRHT+ +T+ G +
Sbjct  196  AVTEAGEVYGWGWGRYGNLGLGDRKDRLIPEKALSIDGIKMVLVACGWRHTITVTSSGSI  255

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH +P
Sbjct  256  YTYGWSKYGQLGHGDFEDHLTP  277


 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++T  G  +  +++G  H+ A+T  G++
Sbjct  144  AVTMDGEVASWGRNQNGQLGIGTAEDSLVPQKIQTFQGIPVKMVAAGAEHSAAVTEAGEV  203

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  204  YGWGWGRYGNLGLGDRKDRLIP  225


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+S G LY +GW+K+GQ+G GD      P ++   +   +  I  GWRHT+A+T    +
Sbjct  300  AVTSDGKLYGWGWNKFGQVGVGDNADRCFPVQVSFPNDQKVVQICCGWRHTLAVTERNNV  359

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G GD VD  SP
Sbjct  360  FSWGRGTNGQLGHGDTVDRNSP  381


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+     +P  ++ L G  I  I+ G  H +A+T DG++  WG N+
Sbjct  99   VYSWGWGDFGRLGHGNSSDLFIPQPIKALDGVKIKQIACGDSHCLAVTMDGEVASWGRNQ  158

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  159  NGQLGIGTAEDSLVP  173


 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  ++ I+ G  HT+A +    Q+Y WGW 
Sbjct  46   VCSWGRGEDGQLGHGDAEDRLSPVQLSELDGHEVNSITCGADHTLAYSEPLSQVYSWGWG  105

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D   P
Sbjct  106  DFGRLGHGNSSDLFIP  121



>gb|AAD43920.1|AF130441_1 UVB-resistance protein UVR8 [Arabidopsis thaliana]
Length=440

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  298  YGWGWNKFGQVGVGNNLDQCSP  319


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLIP  267


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIPIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRTDRLVP  215


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  88   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRN  147

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  148  QNGQLGLGDTEDSLVP  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>emb|CDX81201.1| BnaC09g06120D [Brassica napus]
Length=440

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L    IS IS GWRHTMALT+DG+L
Sbjct  240  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALGSSVISQISGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+D CSP
Sbjct  300  YGWGWNKFGQVGVGDNIDQCSP  321


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPRKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +   + +S ++ GWRHT++++  G L
Sbjct  188  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGAEKMSMVACGWRHTISVSYSGAL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDLEDHLIP  269


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD      P ++    G  +  +S GWRHT+A T    +
Sbjct  292  ALTSDGKLYGWGWNKFGQVGVGDNIDQCSPVQVRFPDGQALVQVSCGWRHTLAGTERNNV  351

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G+G+++D  SP
Sbjct  352  FAWGRGTNGQLGIGESIDRNSP  373


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SRMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGVRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+GD  D   P
Sbjct  147  GRNQNGQLGLGDTEDSLVP  165


 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHQIVSVTCGADHTVAYSQSRMEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  100  GRLGHGNSSDLFTP  113



>emb|CDY60046.1| BnaA09g52370D [Brassica napus]
Length=448

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L    IS IS GWRHTMALT+DG+L
Sbjct  240  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALGSSVISQISGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+D CSP
Sbjct  300  YGWGWNKFGQVGVGDNIDQCSP  321


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPRKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +   + +S ++ GWRHT++++  G L
Sbjct  188  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGAEKMSMVACGWRHTISVSYSGAL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDLEDHLIP  269


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SRMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGVRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+GD  D   P
Sbjct  147  GRNQNGQLGLGDTEDSLVP  165


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 8/90 (9%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLE--------TLHGDFISPISSGWRHTM  157
            +++S G LY +GW+K+GQ+G GD      P ++               +  +S GWRHT+
Sbjct  292  ALTSDGKLYGWGWNKFGQVGVGDNIDQCSPVQVRFPDDQASHVSQFTKVVQVSCGWRHTL  351

Query  158  ALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            A+T    ++ WG    GQ+G+G+ +D  SP
Sbjct  352  AVTERNNVFAWGRGTNGQLGIGEALDRNSP  381


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHQIVSVTCGADHTVAYSQSRMEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  100  GRLGHGNSSDLFTP  113



>ref|XP_006338171.1| PREDICTED: ultraviolet-B receptor UVR8-like [Solanum tuberosum]
Length=447

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG+LYTYGWSKYGQLGHGDFE HL P K++ LH  F S IS GWRHTMALT+DG+LY
Sbjct  243  VSSSGALYTYGWSKYGQLGHGDFEDHLFPHKVQALHESFTSQISGGWRHTMALTSDGKLY  302

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVGV DN DHCSP
Sbjct  303  GWGWNKFGQVGVDDNCDHCSP  323


 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  190  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSANVGEKMFIVACGWRHTICVSSSGAL  249

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  250  YTYGWSKYGQLGHGDFEDHLFP  271


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  138  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPRKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  197

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  198  YGWGWGRYGNLGLGDRNDRLVP  219


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N+
Sbjct  93   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGICIKQIACGDSHCLAVTMEGEVQSWGRNQ  152

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  153  NGQLGLGTTEDSLVP  167


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYG  187
            S   + ++G  + GQLG GD E    P ++  L G  I  ++ G  HT A +    Q+Y 
Sbjct  36   SGNVVCSWGRGEDGQLGLGDAEDRFSPTQVSALDGQEIVSLTCGADHTTAYSEALKQVYS  95

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  96   WGWGDFGRLGHGNSSDLFTP  115



>ref|XP_006280478.1| hypothetical protein CARUB_v10026414mg [Capsella rubella]
 gb|EOA13376.1| hypothetical protein CARUB_v10026414mg [Capsella rubella]
Length=440

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALGNSFISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  298  YGWGWNKFGQVGVGNNLDQCSP  319


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRSDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLVP  267


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRSDRLVP  215


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  88   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRN  147

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  148  QNGQLGLGDTEDSLVP  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>ref|XP_009350705.1| PREDICTED: ultraviolet-B receptor UVR8-like, partial [Pyrus x 
bretschneideri]
Length=407

 Score =   138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HLVP KLE L   FI   S GWRHTMALT+DG L
Sbjct  245  SVSSSGRLYTYGWSKYGQLGHGDFEDHLVPHKLEALSDKFICETSGGWRHTMALTSDGIL  304

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHC P
Sbjct  305  YGWGWNKFGQVGAGDNIDHCFP  326


 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  GSLY +GW +YG LG GD    +VP ++  ++ + +  ++ GWRHT+++++ G+L
Sbjct  193  AVTEDGSLYGWGWGRYGNLGLGDRNDRMVPERVSMVNSEKMVMVACGWRHTISVSSSGRL  252

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  253  YTYGWSKYGQLGHGDFEDHLVP  274


 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG L
Sbjct  141  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGLSVKMVAAGAEHTAAVTEDGSL  200

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  201  YGWGWGRYGNLGLGDRNDRMVP  222


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            +S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  
Sbjct  91   NSRSEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGIKIRQIACGDSHCLAVTMEGEVQS  150

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  151  WGRNQNGQLGLGTTEDSLVP  170


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S     ++G  + GQLGHGD E  L+P  L  L G  I+ ++ G  HT+A + +  ++Y 
Sbjct  39   SENVFCSWGRGEDGQLGHGDAEDRLLPTHLSALDGHEIASVTCGADHTIAYSNSRSEVYS  98

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  99   WGWGDFGRLGHGNSSDLFTP  118



>ref|XP_009350706.1| PREDICTED: ultraviolet-B receptor UVR8-like, partial [Pyrus x 
bretschneideri]
Length=409

 Score =   138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGDFE HLVP KLE L   FI   S GWRHTMALT+DG L
Sbjct  245  SVSSSGRLYTYGWSKYGQLGHGDFEDHLVPHKLEALSDKFICETSGGWRHTMALTSDGIL  304

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHC P
Sbjct  305  YGWGWNKFGQVGAGDNIDHCFP  326


 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  GSLY +GW +YG LG GD    +VP ++  ++ + +  ++ GWRHT+++++ G+L
Sbjct  193  AVTEDGSLYGWGWGRYGNLGLGDRNDRMVPERVSMVNSEKMVMVACGWRHTISVSSSGRL  252

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  253  YTYGWSKYGQLGHGDFEDHLVP  274


 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG L
Sbjct  141  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGLSVKMVAAGAEHTAAVTEDGSL  200

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  201  YGWGWGRYGNLGLGDRNDRMVP  222


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            +S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  
Sbjct  91   NSRSEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGIKIRQIACGDSHCLAVTMEGEVQS  150

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  151  WGRNQNGQLGLGTTEDSLVP  170


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S     ++G  + GQLGHGD E  L+P  L  L G  I+ ++ G  HT+A + +  ++Y 
Sbjct  39   SENVFCSWGRGEDGQLGHGDAEDRLLPTHLSALDGHEIASVTCGADHTIAYSNSRSEVYS  98

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  99   WGWGDFGRLGHGNSSDLFTP  118



>dbj|BAJ91594.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88296.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG+LYTYGWSKYGQLGHGDF+ HLVP KLE L    IS IS GWRHTMA+  DG+L
Sbjct  244  SVSSSGALYTYGWSKYGQLGHGDFQDHLVPRKLEALKDVPISQISGGWRHTMAVAEDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGV DNVDHCSP
Sbjct  304  YGWGWNKFGQVGVEDNVDHCSP  325


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG  D +   VP K+ ++ G+ +  ++ GWRH++++++ G L
Sbjct  192  AITEGGDLYGWGWGRYGNLGLSDRDDRSVPEKVSSVEGEKMVLVACGWRHSVSVSSSGAL  251

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  252  YTYGWSKYGQLGHGDFQDHLVP  273


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G ++++G ++ GQLG G+ +  L+P K++   G  +  I++G  HT A+T  G L
Sbjct  140  TVTFNGQVHSWGRNQNGQLGLGNNQDSLLPQKIKAFEGVCVKMIAAGAEHTTAITEGGDL  199

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+ D  D   P
Sbjct  200  YGWGWGRYGNLGLSDRDDRSVP  221


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            LY++GW  +G+LGHG+      P  +  L G  I  I+ G  H + +T +GQ++ WG N+
Sbjct  95   LYSWGWGDFGRLGHGNSSDVFNPQPIVALQGMKIKQIACGDSHCLTVTFNGQVHSWGRNQ  154

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+N D   P
Sbjct  155  NGQLGLGNNQDSLLP  169


 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            + ++G  + GQLGHGD E   VP  L +     ++ +  G  HT+A + D  QLY WGW 
Sbjct  42   VCSWGRGEDGQLGHGDSEDRPVPTVLTSFDVPRVTSVICGADHTIAYSDDEMQLYSWGWG  101

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  102  DFGRLGHGNSSDVFNP  117



>dbj|BAJ92030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG+LYTYGWSKYGQLGHGDF+ HLVP KLE L    IS IS GWRHTMA+  DG+L
Sbjct  244  SVSSSGALYTYGWSKYGQLGHGDFQDHLVPRKLEALKDVPISQISGGWRHTMAVAEDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGV DNVDHCSP
Sbjct  304  YGWGWNKFGQVGVEDNVDHCSP  325


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG  D +   VP K+ ++ G+ +  ++ GWRH++++++ G L
Sbjct  192  AITEGGDLYGWGWGRYGNLGLSDRDDRSVPEKVSSVEGEKMVLVACGWRHSVSVSSSGAL  251

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  252  YTYGWSKYGQLGHGDFQDHLVP  273


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G ++++G ++ GQLG G+ +  L+P K++   G  +  I++G  HT A+T  G L
Sbjct  140  TVTFNGQVHSWGRNQNGQLGLGNNQDSLLPQKIKAFEGVCVKMIAAGAEHTTAITEGGDL  199

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+ D  D   P
Sbjct  200  YGWGWGRYGNLGLSDRDDRSVP  221


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            LY++GW  +G+LGHG+      P  +  L G  I  I+ G  H + +T +GQ++ WG N+
Sbjct  95   LYSWGWGDFGRLGHGNSSDVFNPQPIVALQGMKIKQIACGDSHCLTVTFNGQVHSWGRNQ  154

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+N D   P
Sbjct  155  NGQLGLGNNQDSLLP  169


 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            + ++G  + GQLGHGD E   VP  L +     ++ +  G  HT+A + D  QLY WGW 
Sbjct  42   VCSWGRGEDGQLGHGDSEDRPVPTVLTSFDVPRVTSVICGADHTIAYSDDEMQLYSWGWG  101

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  102  DFGRLGHGNSSDVFNP  117



>ref|XP_010444307.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
Length=440

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDIEDHLVPHKLEALGNSFISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N D CSP
Sbjct  298  YGWGWNKFGQVGVGNNFDQCSP  319


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAAGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDIEDHLVP  267


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMDGEVQSWGRNQNGQLGLGDTEDSLVPRKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T DG++  WG N
Sbjct  88   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALRGIRIKQIACGDSHCLAVTMDGEVQSWGRN  147

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  148  QNGQLGLGDTEDSLVP  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGLEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>ref|XP_010484148.1| PREDICTED: ultraviolet-B receptor UVR8-like, partial [Camelina 
sativa]
Length=439

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP KLE L   FIS IS GWRHTMALT+DG+L
Sbjct  238  SVSFSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALGNSFISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N D CSP
Sbjct  298  YGWGWNKFGQVGVGNNFDQCSP  319


 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAAGEKMSMVACGWRHTISVSFSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLVP  267


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMDGEVQSWGRNQNGQLGLGDTEDSLVPRKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N
Sbjct  88   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMDGEVQSWGRN  147

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  148  QNGQLGLGDTEDSLVP  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGLEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>emb|CDY43762.1| BnaA06g22980D [Brassica napus]
Length=428

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  239  AVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALSNSVISQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+D CSP
Sbjct  299  YGWGWNKFGQVGVGDNLDQCSP  320


 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT+A++  G L
Sbjct  187  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSASGEKMSMVACGWRHTIAVSYSGAL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDLEDHLVP  268


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  135  AVTMDGEVQSWGRNQNGQLGLGDTEDSLVPKKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  
Sbjct  85   ESRKEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIQQIACGDSHCLAVTMDGEVQS  144

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+GD  D   P
Sbjct  145  WGRNQNGQLGLGDTEDSLVP  164


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHQIVSVTCGADHTVAYSESRKEVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>ref|XP_002522929.1| uvb-resistance protein uvr8, putative [Ricinus communis]
 gb|EEF39472.1| uvb-resistance protein uvr8, putative [Ricinus communis]
Length=437

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGD+  HL+P +LE L G FIS IS GWRHTMA+T+DG+L
Sbjct  237  SVSSSGGLYTYGWSKYGQLGHGDYADHLIPHQLEALQGSFISQISGGWRHTMAVTSDGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD  SP
Sbjct  297  YGWGWNKFGQVGVGDNVDRSSP  318


 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD +  LVP K+   HG+ +  ++ GWRHT+++++ G L
Sbjct  185  AVTEDGELYGWGWGRYGNLGLGDRKDRLVPEKVSLPHGEKMVMVACGWRHTISVSSSGGL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDYADHLIP  266


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  133  AVTMEGQVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGVPIKMVAAGAEHTAAVTEDGEL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRKDRLVP  214


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  +  LHG  I  I+ G  H +A+T +GQ+  WG N+
Sbjct  88   VYSWGWGDFGRLGHGNSSDLFTPQPIRQLHGLKIKQIACGDSHCLAVTMEGQVQSWGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  148  NGQLGLGTTEDSLVP  162


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            T+G  + GQLGHGD +  L P  L TL G  I  +  G  HT+A + +   +Y WGW  F
Sbjct  37   TWGRGEDGQLGHGDAQDRLSPTILSTLEGLEIISVICGADHTIAYSESHTDVYSWGWGDF  96

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  97   GRLGHGNSSDLFTP  110



>ref|NP_001052849.1| Os04g0435700 [Oryza sativa Japonica Group]
 emb|CAE02741.1| OSJNBa0006B20.1 [Oryza sativa Japonica Group]
 dbj|BAF14763.1| Os04g0435700 [Oryza sativa Japonica Group]
 gb|EAY94203.1| hypothetical protein OsI_15977 [Oryza sativa Indica Group]
 gb|EAZ30816.1| hypothetical protein OsJ_14886 [Oryza sativa Japonica Group]
 dbj|BAG94800.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGSLYTYGWSKYGQLGHGDFE HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  247  TVSSSGSLYTYGWSKYGQLGHGDFEDHLVPHKLEALKDSSISQISGGWRHTMALTSDGKL  306

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGD  DHC P
Sbjct  307  YGWGWNKFGQVGVGDTDDHCFP  328


 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+ ++ G+ +  I+ GWRHT+ +++ G L
Sbjct  195  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPEKVSSVEGEKMVLIACGWRHTITVSSSGSL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  255  YTYGWSKYGQLGHGDFEDHLVP  276


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K+++  G  +  I++G  HT A+T DG L
Sbjct  143  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQSFEGVCVKMIAAGAEHTAAVTEDGDL  202

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  203  YGWGWGRYGNLGLGDRNDRLVP  224


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD + H  P +++      ++ ++ GWRHT+A T    +
Sbjct  299  ALTSDGKLYGWGWNKFGQVGVGDTDDHCFPVQVKFPEDQKVAQVACGWRHTLAFTEKKNV  358

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD   P
Sbjct  359  FSWGRGTSGQLGHGEIVDRNKP  380


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  98   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGIKIKQIACGDSHCLAVTMAGEVQSWGRNQ  157

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  158  NGQLGLGTTEDSLLP  172


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 3/78 (4%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDF--ISPISSGWRHTMALTTD-GQLYGWG  193
            L ++G  + GQLGHGD E  LVP  L         I+ +  G  HT A + D  Q+Y WG
Sbjct  43   LCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAAAPGITSVICGADHTTAYSEDEQQVYSWG  102

Query  194  WNKFGQVGVGDNVDHCSP  247
            W  FG++G G++ D  +P
Sbjct  103  WGDFGRLGHGNSSDVFTP  120



>gb|KFK28078.1| hypothetical protein AALP_AA8G469400 [Arabis alpina]
Length=440

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SV+ SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  239  SVTYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALSNSVISQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+D CSP
Sbjct  299  YGWGWNKFGQVGVGDNLDQCSP  320


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++    G+ +S ++ GWRHT+++T  G L
Sbjct  187  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTAAGGEKMSMVACGWRHTISVTYSGAL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDLEDHLVP  268


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  135  AVTMGGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGTRIKMVAAGAEHTAAVTEDGDL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T  G++  
Sbjct  85   ESRKEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIQIKQIACGDSHCLAVTMGGEVQS  144

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+GD  D   P
Sbjct  145  WGRNQNGQLGLGDTEDSLVP  164


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRPSPTQLSALDEHQIVSVTCGADHTIAYSESRKEVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>gb|ACN35037.1| unknown [Zea mays]
Length=220

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGDFE HLVP K+E L    IS IS GWRHTMALT++G+L
Sbjct  13   TVSDSGNLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSTISQISGGWRHTMALTSEGKL  72

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DH SP
Sbjct  73   YGWGWNKFGQVGVGNNDDHSSP  94


 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+ + H  P ++       IS ++ GWRHT+AL+    +
Sbjct  65   ALTSEGKLYGWGWNKFGQVGVGNNDDHSSPGQVSFPEDQKISQVACGWRHTLALSEKKNV  124

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  125  FSWGRGTSGQLGNGEIVDRNTP  146


 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  131  ISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            ++ GWRHT+ ++  G LY +GW+K+GQ+G GD  DH  P
Sbjct  4    VACGWRHTITVSDSGNLYTYGWSKYGQLGHGDFEDHLVP  42



>emb|CDX84451.1| BnaC03g50490D [Brassica napus]
Length=446

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  239  AVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALSNSVISQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+D CSP
Sbjct  299  YGWGWNKFGQVGVGDNLDQCSP  320


 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT+A++  G L
Sbjct  187  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSASGEKMSMVACGWRHTIAVSYSGAL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDLEDHLVP  268


 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K+    G  I  +++G  HT A+T DG L
Sbjct  135  AVTMDGEVQSWGRNQNGQLGLGDTEDSLVPQKIRVFEGLRIKMVAAGAEHTAAVTEDGDL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  W
Sbjct  86   SRKEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMDGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+GD  D   P
Sbjct  146  GRNQNGQLGLGDTEDSLVP  164


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (56%), Gaps = 11/93 (12%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL------ETLHGDF-----ISPISSGWR  148
            +++S G LY +GW+K+GQ+G GD      P ++        +H +      +  +S GWR
Sbjct  291  ALTSDGKLYGWGWNKFGQVGVGDNLDQCSPLQVCLSHSFSNIHTNIFVEQKVVQVSCGWR  350

Query  149  HTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            HT+A+T    ++ WG    GQ+G+G+++D   P
Sbjct  351  HTLAVTEKNNVFAWGRGTNGQLGIGESIDRNYP  383


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHQIVSVTCGADHTVAYSESRKEVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>ref|XP_009355901.1| PREDICTED: ultraviolet-B receptor UVR8-like [Pyrus x bretschneideri]
Length=532

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S+SSSG LYTYGWSKYGQLGHGDFE HLVP KLE L   FI   S GWRHTMALT+DG L
Sbjct  328  SISSSGRLYTYGWSKYGQLGHGDFEDHLVPHKLEALSDKFICETSGGWRHTMALTSDGIL  387

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHC P
Sbjct  388  YGWGWNKFGQVGAGDNIDHCFP  409


 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  GSLY +GW +YG LG GD    +VP ++  ++ + +  ++ GWRHT+++++ G+L
Sbjct  276  AVTEDGSLYGWGWGRYGNLGLGDRNDRMVPERVSMVNSEKMVMVACGWRHTISISSSGRL  335

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  336  YTYGWSKYGQLGHGDFEDHLVP  357


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG L
Sbjct  224  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGLSVKMVAAGAEHTAAVTEDGSL  283

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  284  YGWGWGRYGNLGLGDRNDRMVP  305


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            +S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  
Sbjct  174  NSRSEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGIKIRQIACGDSHCLAVTMEGEVQS  233

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  234  WGRNQNGQLGLGTTEDSLVP  253


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S     ++G  + GQLGHGD E  L+P  L  L G  I+ ++ G  HT+A + +  ++Y 
Sbjct  122  SENVFCSWGRGEDGQLGHGDAEDRLLPTHLSALDGHEIASVTCGADHTIAYSNSRSEVYS  181

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  182  WGWGDFGRLGHGNSSDLFTP  201



>ref|XP_009150449.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
Length=435

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  239  AVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALSNSVISQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN+D CSP
Sbjct  299  YGWGWNKFGQVGVGDNLDQCSP  320


 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT+A++  G L
Sbjct  187  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSASGEKMSMVACGWRHTIAVSYSGAL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDLEDHLVP  268


 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  135  AVTMDGEVQSWGRNQNGQLGLGDTEDSLVPKKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  
Sbjct  85   ESRKEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMDGEVQS  144

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+GD  D   P
Sbjct  145  WGRNQNGQLGLGDTEDSLVP  164


 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHQIVSVTCGADHTVAYSESRKEVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDLFTP  112



>ref|XP_010461084.1| PREDICTED: ultraviolet-B receptor UVR8 [Camelina sativa]
Length=440

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP K+E L   FIS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKVEALGNSFISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  298  YGWGWNKFGQVGVGNNLDQCSP  319


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLVP  267


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMDGEVQSWGRNQNGQLGLGDTEDSLVPRKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  89   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMDGEVQSWGRNQ  148

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+GD  D   P
Sbjct  149  NGQLGLGDTEDSLVP  163


 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G Q+Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGLQVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>ref|XP_006652309.1| PREDICTED: ultraviolet-B receptor UVR8-like [Oryza brachyantha]
Length=446

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSGSLYTYGWSKYGQLGHGDFE HLVP +LE L    IS IS GWRHTMALT+DG+L
Sbjct  240  TVSSSGSLYTYGWSKYGQLGHGDFEDHLVPHELEALKDSSISQISGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGD  DHC P
Sbjct  300  YGWGWNKFGQVGVGDTADHCFP  321


 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+ ++ G+ +  ++ GWRHT+ +++ G L
Sbjct  188  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPEKVSSVEGEKMVLVACGWRHTITVSSSGSL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  136  AVTMAGGVLSWGRNQNGQLGLGTTEDSLLPQKIQAFEGVCVKMIAAGAEHTAAVTEDGDL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P +++      ++ ++ GWRHT+A T    +
Sbjct  292  ALTSDGKLYGWGWNKFGQVGVGDTADHCFPVQVKFPEEQKVAQVACGWRHTLAFTEKKNV  351

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  352  FSWGRGTSGQLGHGEIVDRNTP  373


 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G +  WG N+
Sbjct  91   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGIKIKQIACGDSHCLAVTMAGGVLSWGRNQ  150

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  151  NGQLGLGTTEDSLLP  165


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLY  184
            ++  +L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A +  + Q+Y
Sbjct  33   AAGNALCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPGITSVICGADHTTAYSEVEQQVY  92

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGW  FG++G G++ D  +P
Sbjct  93   SWGWGDFGRLGHGNSSDVFTP  113



>ref|XP_002446509.1| hypothetical protein SORBIDRAFT_06g017130 [Sorghum bicolor]
 gb|EES10837.1| hypothetical protein SORBIDRAFT_06g017130 [Sorghum bicolor]
Length=443

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGDFE HLVP KLE L    IS IS GWRHTMALT++G+L
Sbjct  237  TVSDSGNLYTYGWSKYGQLGHGDFEDHLVPHKLEALKDSTISQISGGWRHTMALTSEGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DHCSP
Sbjct  297  YGWGWNKFGQVGVGNNDDHCSP  318


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ ++  G L
Sbjct  185  AVTEDGDLYGWGWGRYGNLGLGDRNDRLLPEKVSSVEGEKMVLVACGWRHTITVSDSGNL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDFEDHLVP  266


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  133  AVTMAGQVQSWGRNQNGQLGLGTTEDSLLPQKIQAFEGVCVKMIAAGAEHTAAVTEDGDL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRNDRLLP  214


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+ + H  P ++       IS ++ GWRHT+AL+    +
Sbjct  289  ALTSEGKLYGWGWNKFGQVGVGNNDDHCSPVQVHFPEDQKISQVACGWRHTLALSEKKNV  348

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  349  FSWGRGTSGQLGNGEIVDRNTP  370


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  GQ+  WG N+
Sbjct  88   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGLKIKQIACGDSHCLAVTMAGQVQSWGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  148  NGQLGLGTTEDSLLP  162


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A + D  Q+Y WGW 
Sbjct  35   LCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPGITSVICGADHTTAYSEDELQVYSWGWG  94

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  95   DFGRLGHGNSSDVFTP  110



>ref|XP_004975663.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Setaria 
italica]
Length=439

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG++YTYGWSKYGQLGHGDFE HLVP KLE L    IS IS GWRHTMALT++G+L
Sbjct  236  TVSDSGTMYTYGWSKYGQLGHGDFEDHLVPHKLEALKDSTISQISGGWRHTMALTSEGKL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DHCSP
Sbjct  296  YGWGWNKFGQVGVGNNDDHCSP  317


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ ++  G +
Sbjct  184  AVTEDGDLYGWGWGRYGNLGLGDRNDRLLPEKVSSVEGEKMVLVACGWRHTITVSDSGTM  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLVP  265


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  132  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQAFEGVCVKMIAAGAEHTAAVTEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLLP  213


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+ + H  P ++       IS ++ GWRHT+AL+    +
Sbjct  288  ALTSEGKLYGWGWNKFGQVGVGNNDDHCSPVQVHFPEEQKISQVACGWRHTLALSEKKNV  347

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  348  FSWGRGTSGQLGNGEIVDRNTP  369


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSTDVFTPQPVKALQGLKIKQIACGDSHCLAVTMAGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLLP  161


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGW  196
            +L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A + +  Q+Y WGW
Sbjct  33   ALCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPGITSVICGADHTTAYSEEELQVYSWGW  92

Query  197  NKFGQVGVGDNVDHCSP  247
              FG++G G++ D  +P
Sbjct  93   GDFGRLGHGNSTDVFTP  109



>ref|XP_004975662.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Setaria 
italica]
Length=442

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG++YTYGWSKYGQLGHGDFE HLVP KLE L    IS IS GWRHTMALT++G+L
Sbjct  236  TVSDSGTMYTYGWSKYGQLGHGDFEDHLVPHKLEALKDSTISQISGGWRHTMALTSEGKL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DHCSP
Sbjct  296  YGWGWNKFGQVGVGNNDDHCSP  317


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ ++  G +
Sbjct  184  AVTEDGDLYGWGWGRYGNLGLGDRNDRLLPEKVSSVEGEKMVLVACGWRHTITVSDSGTM  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLVP  265


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  132  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQAFEGVCVKMIAAGAEHTAAVTEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLLP  213


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+ + H  P ++       IS ++ GWRHT+AL+    +
Sbjct  288  ALTSEGKLYGWGWNKFGQVGVGNNDDHCSPVQVHFPEEQKISQVACGWRHTLALSEKKNV  347

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  348  FSWGRGTSGQLGNGEIVDRNTP  369


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSTDVFTPQPVKALQGLKIKQIACGDSHCLAVTMAGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLLP  161


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGW  196
            +L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A + +  Q+Y WGW
Sbjct  33   ALCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPGITSVICGADHTTAYSEEELQVYSWGW  92

Query  197  NKFGQVGVGDNVDHCSP  247
              FG++G G++ D  +P
Sbjct  93   GDFGRLGHGNSTDVFTP  109



>ref|XP_009130277.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
Length=436

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  234  SVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALGNSVISQISGGWRHTMALTSDGKL  293

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  294  YGWGWNKFGQVGVGNNLDQCSP  315


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  182  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGGEKMSMVACGWRHTISVSYSGAL  241

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  242  YTYGWSKYGQLGHGDLEDHLVP  263


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  130  AVTMDGEVQSWGRNQNGQLGLGNTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  189

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  190  YGWGWGRYGNLGLGDRNDRLVP  211


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  85   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHGVMIKQIACGDSHCLAVTMDGEVQSWGRNQ  144

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  145  NGQLGLGNTEDSLVP  159


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A +    ++Y WGW  F
Sbjct  34   SWGRGEDGQLGHGDAEDRSSPTQLSALDEHQIVSVTCGADHTVAYSQSRLEVYSWGWGDF  93

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  94   GRLGHGNSSDLFTP  107



>dbj|BAJ33982.1| unnamed protein product [Thellungiella halophila]
Length=440

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALGNSVISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  298  YGWGWNKFGQVGVGNNLDQCSP  319


 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLVP  267


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  
Sbjct  84   ESRMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQS  143

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+GD  D   P
Sbjct  144  WGRNQNGQLGLGDTEDSLVP  163


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRLSPTQLSALDDHQIVSVTCGADHTVAYSESRMEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>ref|XP_006847198.1| hypothetical protein AMTR_s00017p00251580 [Amborella trichopoda]
 gb|ERN08779.1| hypothetical protein AMTR_s00017p00251580 [Amborella trichopoda]
Length=437

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSS G LYTYGWSKYGQLGHGD+E HL+P +L  L  D+I+ IS GWRHTMALT+DG LY
Sbjct  234  VSSIGKLYTYGWSKYGQLGHGDYEDHLIPHQLRALSNDYITQISGGWRHTMALTSDGMLY  293

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQ+GVGDN DHCSP
Sbjct  294  GWGWNKFGQLGVGDNADHCSP  314


 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    L P K+  + G  +S ++ GWRHT+ +++ G+L
Sbjct  181  AVTEDGELFGWGWGRYGNLGLGDRNDRLFPEKVAAIDGQKMSMVACGWRHTIVVSSIGKL  240

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  241  YTYGWSKYGQLGHGDYEDHLIP  262


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V++ G + ++G ++ GQLG G  E  LVP +++   G  +  +++G  HT A+T DG+L
Sbjct  129  AVTAQGEVQSWGRNQNGQLGLGHTEDSLVPQRIQAFQGVPVKMVAAGAEHTAAVTEDGEL  188

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGW ++G +G+GD  D   P
Sbjct  189  FGWGWGRYGNLGLGDRNDRLFP  210


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  +++L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  84   VYSWGWGDFGRLGHGNSSDLFTPRPIKSLQGLKIKQITCGDSHCLAVTAQGEVQSWGRNQ  143

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  144  NGQLGLGHTEDSLVP  158


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYG  187
            S   + ++G  + GQLGHGD E  L P  L  L G  +  ++SG  HT A +    Q+Y 
Sbjct  27   SENVVCSWGRGEDGQLGHGDAEDRLWPTILSALDGHGVVSVTSGADHTTAYSESPFQVYS  86

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  87   WGWGDFGRLGHGNSSDLFTP  106



>ref|XP_006394235.1| hypothetical protein EUTSA_v10004234mg [Eutrema salsugineum]
 gb|ESQ31521.1| hypothetical protein EUTSA_v10004234mg [Eutrema salsugineum]
Length=440

 Score =   136 bits (342),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  238  SVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALGNSVISQISGGWRHTMALTSDGKL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  298  YGWGWNKFGQVGVGNNLDQCSP  319


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGGEKMSMVACGWRHTISVSYSGAL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  246  YTYGWSKYGQLGHGDLEDHLVP  267


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  194  YGWGWGRYGNLGLGDRNDRLVP  215


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  
Sbjct  84   ESRMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQS  143

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+GD  D   P
Sbjct  144  WGRNQNGQLGLGDTEDSLVP  163


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A + +  ++Y WGW  F
Sbjct  38   SWGRGEDGQLGHGDAEDRPSPTQLSALDDHQIVSVTCGADHTVAYSESRMEVYSWGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  98   GRLGHGNSSDLFTP  111



>pdb|4DNV|A Chain A, Crystal Structure Of The W285f Mutant Of Uvb-resistance 
Protein Uvr8
 pdb|4DNV|B Chain B, Crystal Structure Of The W285f Mutant Of Uvb-resistance 
Protein Uvr8
 pdb|4DNV|C Chain C, Crystal Structure Of The W285f Mutant Of Uvb-resistance 
Protein Uvr8
 pdb|4DNV|D Chain D, Crystal Structure Of The W285f Mutant Of Uvb-resistance 
Protein Uvr8
Length=370

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L   FIS IS G+RHTMALT+DG+L
Sbjct  227  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGFRHTMALTSDGKL  286

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  287  YGWGWNKFGQVGVGNNLDQCSP  308


 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  175  AVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGAL  234

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  235  YTYGWSKYGQLGHGDLEDHLIP  256


 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  123  AVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  182

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  183  YGWGWGRYGNLGLGDRTDRLVP  204


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  77   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRN  136

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  137  QNGQLGLGDTEDSLVP  152


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  27   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDF  86

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  87   GRLGHGNSSDLFTP  100



>ref|XP_009404858.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   135 bits (341),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSG+LYTYGWSKYGQLGHGDFE HL P  LE L    IS IS GWRHTMALT+DG+L
Sbjct  238  AVSSSGNLYTYGWSKYGQLGHGDFEDHLSPHLLEALKDSCISQISGGWRHTMALTSDGRL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQ+GVGDN DHCSP
Sbjct  298  YGWGWNKFGQLGVGDNDDHCSP  319


 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG  D    L P K+ ++ G+ +  ++ GWRHT+A+++ G L
Sbjct  186  AVTEDGDLYGWGWGRYGNLGLADRNDRLTPEKVTSIKGENMVLVACGWRHTIAVSSSGNL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH SP
Sbjct  246  YTYGWSKYGQLGHGDFEDHLSP  267


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  +  LVP K++   G  +  I++G  HT A+T DG L
Sbjct  134  AVTMNGEVQSWGRNQNGQLGLGTTDDSLVPQKIQAFQGICVKMIAAGAEHTAAVTEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+ D  D  +P
Sbjct  194  YGWGWGRYGNLGLADRNDRLTP  215


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ L    I  I+ G  H +A+T +G++  W
Sbjct  85   SDEQVYSWGWGDFGRLGHGNSSDVFTPQPIKALQRLKIKQIACGDSHCLAVTMNGEVQSW  144

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  145  GRNQNGQLGLGTTDDSLVP  163


 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S   + ++G  + GQLGHGD E  L+P  L  L    I  ++ G  HT A + +D Q+Y 
Sbjct  32   SGSDICSWGRGEDGQLGHGDAEDRLLPTLLCALDSRSIVSVTCGADHTTAYSESDEQVYS  91

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  92   WGWGDFGRLGHGNSSDVFTP  111



>emb|CDY31347.1| BnaA02g33940D [Brassica napus]
Length=436

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HLVP KLE L    IS IS GWRHTMALT+DG+L
Sbjct  234  SVSYSGALYTYGWSKYGQLGHGDLEDHLVPHKLEALGNSVISQISGGWRHTMALTSDGKL  293

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG+G+N+D CSP
Sbjct  294  YGWGWNKFGQVGMGNNLDQCSP  315


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+ +S ++ GWRHT++++  G L
Sbjct  182  AVTEDGDLYGWGWGRYGNLGLGDRNDRLVPERVTSAGGEKMSMVACGWRHTISVSYSGAL  241

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  242  YTYGWSKYGQLGHGDLEDHLVP  263


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  130  AVTMDGEVQSWGRNQNGQLGLGNTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  189

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  190  YGWGWGRYGNLGLGDRNDRLVP  211


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  85   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHGVMIKQIACGDSHCLAVTMDGEVQSWGRNQ  144

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  145  NGQLGLGNTEDSLVP  159


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A +    ++Y WGW  F
Sbjct  34   SWGRGEDGQLGHGDAEDRSSPTQLSALDEHQIVSVTCGADHTVAYSQSRLEVYSWGWGDF  93

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  94   GRLGHGNSSDLFTP  107



>ref|XP_009393818.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSG+LYTYGWSKYGQLGHGDFE HL P  LE L    IS IS GWRHTMALT+DG+L
Sbjct  245  TVSSSGNLYTYGWSKYGQLGHGDFEDHLSPHWLEVLKDSCISQISGGWRHTMALTSDGRL  304

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG+GDN DHCSP
Sbjct  305  YGWGWNKFGQVGIGDNDDHCSP  326


 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ +++ G L
Sbjct  193  AVTEDGDLYGWGWGRYGNLGLGDRNDRLIPEKVASIKGEKMVLVACGWRHTITVSSSGNL  252

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH SP
Sbjct  253  YTYGWSKYGQLGHGDFEDHLSP  274


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  141  AVTMDGEVQSWGRNQNGQLGLGTTEDSLIPQKIQAFQGICVKMIAAGAEHTAAVTEDGDL  200

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  201  YGWGWGRYGNLGLGDRNDRLIP  222


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T DG++  W
Sbjct  92   SDDQVYSWGWGDFGRLGHGNSSDVFSPQPIKVLQGLKIKQIACGDSHCLAVTMDGEVQSW  151

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  152  GRNQNGQLGLGTTEDSLIP  170


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S  ++ ++G  + GQLGHGD E  L P  L  L    I  ++ G  HT A + +D Q+Y 
Sbjct  39   SGNAMCSWGRGEDGQLGHGDAEDRLFPTILSALDSQGIVSVTCGADHTAAYSQSDDQVYS  98

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  SP
Sbjct  99   WGWGDFGRLGHGNSSDVFSP  118



>gb|EPS71760.1| hypothetical protein M569_02995, partial [Genlisea aurea]
Length=441

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSGSLYTYGWSKYGQLGHGDFE HL+P ++E L G  IS IS GWRHTMA+T  G+L
Sbjct  239  SVSSSGSLYTYGWSKYGQLGHGDFEDHLIPHEVEALKGHQISQISGGWRHTMAVTCGGEL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGD+ DHC P
Sbjct  299  YGWGWNKFGQVGVGDDADHCLP  320


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G+ E  LVP K+E+  G  +  +++G  HT A+T DG+L
Sbjct  135  AVTMNGEVQSWGRNQNGQLGLGNTEDSLVPRKIESFEGIAVKMVAAGAEHTAAVTEDGEL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLIP  216


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+    G  +  ++ GWRHT+++++ G L
Sbjct  187  AVTEDGELYGWGWGRYGNLGLGDRNDRLIPEKVTASAGKKMVLVACGWRHTISVSSSGSL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLIP  268


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW+K+GQ+G GD   H +P K++      +  +S GWRHT+A++    +
Sbjct  291  AVTCGGELYGWGWNKFGQVGVGDDADHCLPVKVKFPFDQRVVTVSCGWRHTIAVSERQNV  350

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G GD+VD   P
Sbjct  351  FSWGRGINGQLGHGDSVDRNLP  372


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            ++++GW  +G+LGHG+     +P  ++   G  I  I+ G  H +A+T +G++  WG N+
Sbjct  90   VHSWGWGDFGRLGHGNSTDLFLPQPIKAFQGLKIKQIACGDSHCLAVTMNGEVQSWGRNQ  149

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  150  NGQLGLGNTEDSLVP  164


 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            T+G  + GQLGHGD E  L P +L  L G  I  +  G  HT A +    Q++ WGW  F
Sbjct  39   TWGRGEDGQLGHGDTEDRLSPTQLTALDGQEIVSVICGADHTTAYSESRLQVHSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  99   GRLGHGNSTDLFLP  112



>ref|XP_003579788.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brachypodium distachyon]
Length=449

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VSSSG LYTYGWSKYGQLGHGDFE HL P K+E L     S IS GWRHTMALT+DG+L
Sbjct  244  TVSSSGILYTYGWSKYGQLGHGDFEDHLFPHKVEALKDSSTSQISGGWRHTMALTSDGKL  303

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GD+VDHCSP
Sbjct  304  YGWGWNKFGQVGAGDSVDHCSP  325


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD     VP K+  + G+ +  I+ GWRHT+ +++ G L
Sbjct  192  AVTEDGDLYGWGWGRYGNLGLGDRNDRFVPEKVSLVEGEKMVLIACGWRHTITVSSSGIL  251

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  252  YTYGWSKYGQLGHGDFEDHLFP  273


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  140  AVTMGGEVQSWGRNQNGQLGLGTTEDSLLPQKIQAFEGICVKMIAAGAEHTAAVTEDGDL  199

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  200  YGWGWGRYGNLGLGDRNDRFVP  221


 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G GD   H  P ++       ++ ++ GWRHT+A T    +
Sbjct  296  ALTSDGKLYGWGWNKFGQVGAGDSVDHCSPVQVMFPAEQKVAQVACGWRHTLAYTEKKNV  355

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD   P
Sbjct  356  FAWGRGTSGQLGHGEIVDRNKP  377


 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  +  L G  I  ++ G  H +A+T  G++  WG N+
Sbjct  95   VYSWGWGDFGRLGHGNSSDVFTPQPVRALQGIKIKQMACGDSHCLAVTMGGEVQSWGRNQ  154

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  155  NGQLGLGTTEDSLLP  169


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            L ++G  + GQLGHGD E  LVP  +       I+ +  G  HT A +  + Q+Y WGW 
Sbjct  42   LCSWGRGEDGQLGHGDAEDRLVPTVISGFDAPRITSVICGADHTTAYSEEEQQVYSWGWG  101

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  102  DFGRLGHGNSSDVFTP  117



>ref|XP_007048504.1| Regulator of chromosome condensation (RCC1) family protein isoform 
1 [Theobroma cacao]
 gb|EOX92661.1| Regulator of chromosome condensation (RCC1) family protein isoform 
1 [Theobroma cacao]
Length=441

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDF+ HLVP K+E L   FI  IS GWRHTMALT+ G+L
Sbjct  239  SVSVTGGLYTYGWSKYGQLGHGDFKDHLVPHKVEALADSFIKQISGGWRHTMALTSGGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  299  YGWGWNKFGQVGVGDNDDHCSP  320


 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ +  ++ GWRHT++++  G L
Sbjct  187  AVSGDGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMDMVACGWRHTISVSVTGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFKDHLVP  268


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ DG L
Sbjct  135  AVTMEGEVLSWGRNQNGQLGLGTTEDSLVPKKIQAFQGVSIKMVAAGAEHTAAVSGDGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S G +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SRGEVYSWGWGDFGRLGHGNSSDVFTPQPIKALHGLTIKQIACGDSHCLAVTMEGEVLSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSLVP  164


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  +  G  HT A + + G++Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIISVICGADHTTAYSLSRGEVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDVFTP  112



>ref|XP_007048505.1| Regulator of chromosome condensation (RCC1) family protein isoform 
2 [Theobroma cacao]
 gb|EOX92662.1| Regulator of chromosome condensation (RCC1) family protein isoform 
2 [Theobroma cacao]
Length=443

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDF+ HLVP K+E L   FI  IS GWRHTMALT+ G+L
Sbjct  241  SVSVTGGLYTYGWSKYGQLGHGDFKDHLVPHKVEALADSFIKQISGGWRHTMALTSGGKL  300

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN DHCSP
Sbjct  301  YGWGWNKFGQVGVGDNDDHCSP  322


 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLH--GDFISPISSGWRHTMALTTDG  175
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+  G+ +  ++ GWRHT++++  G
Sbjct  187  AVSGDGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNLQGEKMDMVACGWRHTISVSVTG  246

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
             LY +GW+K+GQ+G GD  DH  P
Sbjct  247  GLYTYGWSKYGQLGHGDFKDHLVP  270


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ DG L
Sbjct  135  AVTMEGEVLSWGRNQNGQLGLGTTEDSLVPKKIQAFQGVSIKMVAAGAEHTAAVSGDGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S G +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SRGEVYSWGWGDFGRLGHGNSSDVFTPQPIKALHGLTIKQIACGDSHCLAVTMEGEVLSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSLVP  164


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  +  G  HT A + + G++Y WGW  F
Sbjct  39   SWGRGEDGQLGHGDAEDRLSPTQLSALDGHEIISVICGADHTTAYSLSRGEVYSWGWGDF  98

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  99   GRLGHGNSSDVFTP  112



>gb|KHG16477.1| putative E3 ubiquitin-protein ligase HERC4 [Gossypium arboreum]
Length=527

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E L    I  IS GWRHTMALT+DG+L
Sbjct  239  SVSVTGGLYTYGWSKYGQLGHGDFEDHLVPYKVEALADSSIKQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN D CSP
Sbjct  299  YGWGWNKFGQVGVGDNTDICSP  320


 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G+LY +GW +YG LG GD    LVP K+ TL+ + ++ ++ GWRHT++++  G L
Sbjct  187  AISKEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNEEKMNMVACGWRHTISVSVTGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLVP  268


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E   VP K++   G  I  +++G  HT A++ +G L
Sbjct  135  AVTMEGEVQSWGRNQNGQLGLGTTEDSPVPQKIKAFQGISIKMVAAGAEHTAAISKEGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SNAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSPVP  164


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  I  I+ G  HT+A + ++ ++Y WGW 
Sbjct  37   ICSWGRGEDGQLGHGDAEDRLSPTRLSALDGHDIISITCGADHTIAYSLSNAEVYSWGWG  96

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  97   DFGRLGHGNSSDLFTP  112


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 17/96 (18%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDF--------------EYHLVPCKLETLHGDFISPISS  139
            +++S G LY +GW+K+GQ+G GD               + H   C  + L    +  +S 
Sbjct  291  ALTSDGKLYGWGWNKFGQVGVGDNTDICSPVQVKFPNDQAHSCYCCFQILK---VVQVSC  347

Query  140  GWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            GWRHT+A+T +  ++ WG    GQ+G G+++D   P
Sbjct  348  GWRHTLAITEEQNIFSWGRGTNGQLGHGESMDRNFP  383



>ref|XP_003602664.1| RCC1 and BTB domain-containing protein [Medicago truncatula]
 ref|XP_003638235.1| RCC1 and BTB domain-containing protein [Medicago truncatula]
 gb|AES72915.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=439

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGD + HLVP KL+      I  +S GWRHTMALTT GQL
Sbjct  237  SVSSSGELYTYGWSKYGQLGHGDCKDHLVPHKLQAFSDKLICQVSGGWRHTMALTTGGQL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD CSP
Sbjct  297  YGWGWNKFGQVGVGDNVDRCSP  318


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++T  G  I  +++G  H++A+T +G+L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQTFQGVPIKMVAAGAEHSVAITENGEL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D C P
Sbjct  194  YGWGWGRYGNLGLGDRNDRCIP  215


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD     +P K+ ++  D +  ++ GWRHT+++++ G+L
Sbjct  186  AITENGELYGWGWGRYGNLGLGDRNDRCIPEKV-SVDCDKMVLVACGWRHTISVSSSGEL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTYGWSKYGQLGHGDCKDHLVP  266


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+     +P  +  L G  I  I+ G  H +A+T +G++  
Sbjct  84   ESKVEVYSWGWGDFGRLGHGNSSDLFIPQPIRALQGLRIKQIACGDSHCLAVTMEGEVQS  143

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  144  WGRNQNGQLGLGTTEDSLVP  163


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQ  178
            ++ S   + ++G  + GQLGHGD +  L+P +L  L    I  +  G  HT+A + +  +
Sbjct  29   ALISGNVVCSWGRGEDGQLGHGDTDDRLLPTQLSALDAQQIVSVVCGADHTLAYSESKVE  88

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G G++ D   P
Sbjct  89   VYSWGWGDFGRLGHGNSSDLFIP  111



>gb|KJB33341.1| hypothetical protein B456_006G007400 [Gossypium raimondii]
Length=396

 Score =   132 bits (333),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS  G LYTYGWSKYGQLGHGDFE HLVP K+E L    I  IS GWRHTMALT+DG+L
Sbjct  239  SVSVIGGLYTYGWSKYGQLGHGDFEDHLVPYKVEALADSSIKQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN D CSP
Sbjct  299  YGWGWNKFGQVGVGDNTDICSP  320


 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G+LY +GW +YG LG GD    LVP K+ TL+ + ++ ++ GWRHT++++  G L
Sbjct  187  AISKEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNEEKMNIVACGWRHTISVSVIGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLVP  268


 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E   VP K++   G  I  +++G  HT A++ +G L
Sbjct  135  AVTMEGEVQSWGRNQNGQLGLGTTEDSPVPQKIKAFQGISIKMVAAGAEHTAAISKEGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SNAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSPVP  164


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  I  I+ G  HT+A + ++ ++Y WGW 
Sbjct  37   ICSWGRGEDGQLGHGDAEDRLSPTRLSALDGHDIISITCGADHTIAYSLSNAEVYSWGWG  96

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  97   DFGRLGHGNSSDLFTP  112



>gb|KJB33343.1| hypothetical protein B456_006G007400 [Gossypium raimondii]
Length=434

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS  G LYTYGWSKYGQLGHGDFE HLVP K+E L    I  IS GWRHTMALT+DG+L
Sbjct  239  SVSVIGGLYTYGWSKYGQLGHGDFEDHLVPYKVEALADSSIKQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN D CSP
Sbjct  299  YGWGWNKFGQVGVGDNTDICSP  320


 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G+LY +GW +YG LG GD    LVP K+ TL+ + ++ ++ GWRHT++++  G L
Sbjct  187  AISKEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNEEKMNIVACGWRHTISVSVIGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLVP  268


 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E   VP K++   G  I  +++G  HT A++ +G L
Sbjct  135  AVTMEGEVQSWGRNQNGQLGLGTTEDSPVPQKIKAFQGISIKMVAAGAEHTAAISKEGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SNAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSPVP  164


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  I  I+ G  HT+A + ++ ++Y WGW 
Sbjct  37   ICSWGRGEDGQLGHGDAEDRLSPTRLSALDGHDIISITCGADHTIAYSLSNAEVYSWGWG  96

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  97   DFGRLGHGNSSDLFTP  112



>ref|NP_001141147.1| putative regulator of chromosome condensation (RCC1) family protein 
[Zea mays]
 gb|ACF85525.1| unknown [Zea mays]
 gb|ACN34239.1| unknown [Zea mays]
 tpg|DAA37721.1| TPA: putative regulator of chromosome condensation (RCC1) family 
protein [Zea mays]
Length=443

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGDFE HLVP K+E L    IS IS GWRHTMALT++G+L
Sbjct  236  TVSDSGNLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSTISQISGGWRHTMALTSEGKL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DH SP
Sbjct  296  YGWGWNKFGQVGVGNNDDHSSP  317


 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ ++  G L
Sbjct  184  AVTEDGDLYGWGWGRYGNLGLGDRNDRLLPEKVSSVEGEKMVLVACGWRHTITVSDSGNL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLVP  265


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++      +  I++G  HT A+T DG L
Sbjct  132  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQAFESVCVKMIAAGAEHTAAVTEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLLP  213


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+ + H  P ++       IS ++ GWRHT+AL+    +
Sbjct  288  ALTSEGKLYGWGWNKFGQVGVGNNDDHSSPGQVSFPEDQKISQVACGWRHTLALSEKKNV  347

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  348  FSWGRGTSGQLGNGEIVDRNTP  369


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGLKIKQIACGDSHCLAVTMAGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLLP  161


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A + D  Q+Y WGW 
Sbjct  34   LCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPAITSVICGADHTTAYSEDELQVYSWGWG  93

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  94   DFGRLGHGNSSDVFTP  109



>gb|KJB33342.1| hypothetical protein B456_006G007400 [Gossypium raimondii]
Length=432

 Score =   132 bits (333),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS  G LYTYGWSKYGQLGHGDFE HLVP K+E L    I  IS GWRHTMALT+DG+L
Sbjct  230  SVSVIGGLYTYGWSKYGQLGHGDFEDHLVPYKVEALADSSIKQISGGWRHTMALTSDGKL  289

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN D CSP
Sbjct  290  YGWGWNKFGQVGVGDNTDICSP  311


 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G+LY +GW +YG LG GD    LVP K+ TL+ + ++ ++ GWRHT++++  G L
Sbjct  178  AISKEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNEEKMNIVACGWRHTISVSVIGGL  237

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  238  YTYGWSKYGQLGHGDFEDHLVP  259


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E   VP K++   G  I  +++G  HT A++ +G L
Sbjct  126  AVTMEGEVQSWGRNQNGQLGLGTTEDSPVPQKIKAFQGISIKMVAAGAEHTAAISKEGAL  185

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  186  YGWGWGRYGNLGLGDRNDRLVP  207


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  77   SNAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  136

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  137  GRNQNGQLGLGTTEDSPVP  155


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLY-TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQ  178
            +S++G++  ++G  + GQLGHGD E  L P +L  L G  I  I+ G  HT+A + ++ +
Sbjct  21   ISAAGNIICSWGRGEDGQLGHGDAEDRLSPTRLSALDGHDIISITCGADHTIAYSLSNAE  80

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G G++ D  +P
Sbjct  81   VYSWGWGDFGRLGHGNSSDLFTP  103



>gb|KJB33340.1| hypothetical protein B456_006G007400 [Gossypium raimondii]
Length=441

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS  G LYTYGWSKYGQLGHGDFE HLVP K+E L    I  IS GWRHTMALT+DG+L
Sbjct  239  SVSVIGGLYTYGWSKYGQLGHGDFEDHLVPYKVEALADSSIKQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN D CSP
Sbjct  299  YGWGWNKFGQVGVGDNTDICSP  320


 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G+LY +GW +YG LG GD    LVP K+ TL+ + ++ ++ GWRHT++++  G L
Sbjct  187  AISKEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNEEKMNIVACGWRHTISVSVIGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLVP  268


 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E   VP K++   G  I  +++G  HT A++ +G L
Sbjct  135  AVTMEGEVQSWGRNQNGQLGLGTTEDSPVPQKIKAFQGISIKMVAAGAEHTAAISKEGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SNAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSPVP  164


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  I  I+ G  HT+A + ++ ++Y WGW 
Sbjct  37   ICSWGRGEDGQLGHGDAEDRLSPTRLSALDGHDIISITCGADHTIAYSLSNAEVYSWGWG  96

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  97   DFGRLGHGNSSDLFTP  112



>gb|KJB33344.1| hypothetical protein B456_006G007400 [Gossypium raimondii]
Length=437

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS  G LYTYGWSKYGQLGHGDFE HLVP K+E L    I  IS GWRHTMALT+DG+L
Sbjct  239  SVSVIGGLYTYGWSKYGQLGHGDFEDHLVPYKVEALADSSIKQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDN D CSP
Sbjct  299  YGWGWNKFGQVGVGDNTDICSP  320


 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G+LY +GW +YG LG GD    LVP K+ TL+ + ++ ++ GWRHT++++  G L
Sbjct  187  AISKEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNEEKMNIVACGWRHTISVSVIGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLVP  268


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E   VP K++   G  I  +++G  HT A++ +G L
Sbjct  135  AVTMEGEVQSWGRNQNGQLGLGTTEDSPVPQKIKAFQGISIKMVAAGAEHTAAISKEGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SNAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSPVP  164


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  I  I+ G  HT+A + ++ ++Y WGW 
Sbjct  37   ICSWGRGEDGQLGHGDAEDRLSPTRLSALDGHDIISITCGADHTIAYSLSNAEVYSWGWG  96

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  97   DFGRLGHGNSSDLFTP  112



>gb|ACG32833.1| HECT domain and RCC1-like domain-containing protein 2 [Zea mays]
Length=353

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGDFE HLVP K+E L    IS IS GWRHTMALT++G+L
Sbjct  236  TVSDSGNLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSTISQISGGWRHTMALTSEGKL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DH SP
Sbjct  296  YGWGWNKFGQVGVGNNDDHSSP  317


 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ ++  G L
Sbjct  184  AVTEDGDLYGWGWGRYGNLGLGDRNDRLLPEKVSSVEGEKMVLVACGWRHTITVSDSGNL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLVP  265


 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++      +  I++G  HT A+T DG L
Sbjct  132  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQAFESVCVKMIAAGAEHTAAVTEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLLP  213


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGLKIKQIACGDSHCLAVTMAGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLLP  161


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A + D  Q+Y WGW 
Sbjct  34   LCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPAITSVICGADHTTAYSEDELQVYSWGWG  93

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  94   DFGRLGHGNSSDVFTP  109



>ref|XP_008667511.1| PREDICTED: putative regulator of chromosome condensation (RCC1) 
family protein isoform X2 [Zea mays]
Length=372

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGDFE HLVP K+E L    IS IS GWRHTMALT++G+L
Sbjct  236  TVSDSGNLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSTISQISGGWRHTMALTSEGKL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DH SP
Sbjct  296  YGWGWNKFGQVGVGNNDDHSSP  317


 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ ++  G L
Sbjct  184  AVTEDGDLYGWGWGRYGNLGLGDRNDRLLPEKVSSVEGEKMVLVACGWRHTITVSDSGNL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLVP  265


 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++      +  I++G  HT A+T DG L
Sbjct  132  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQAFESVCVKMIAAGAEHTAAVTEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLLP  213


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+ + H  P ++       IS ++ GWRHT+AL+    +
Sbjct  288  ALTSEGKLYGWGWNKFGQVGVGNNDDHSSPGQVSFPEDQKISQVACGWRHTLALSEKKNV  347

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  348  FSWGRGTSGQLGNGEIVDRNTP  369


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGLKIKQIACGDSHCLAVTMAGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLLP  161


 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A + D  Q+Y WGW 
Sbjct  34   LCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPAITSVICGADHTTAYSEDELQVYSWGWG  93

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  94   DFGRLGHGNSSDVFTP  109



>ref|XP_008667510.1| PREDICTED: putative regulator of chromosome condensation (RCC1) 
family protein isoform X1 [Zea mays]
Length=417

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG+LYTYGWSKYGQLGHGDFE HLVP K+E L    IS IS GWRHTMALT++G+L
Sbjct  236  TVSDSGNLYTYGWSKYGQLGHGDFEDHLVPHKVEALKDSTISQISGGWRHTMALTSEGKL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N DH SP
Sbjct  296  YGWGWNKFGQVGVGNNDDHSSP  317


 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    L+P K+ ++ G+ +  ++ GWRHT+ ++  G L
Sbjct  184  AVTEDGDLYGWGWGRYGNLGLGDRNDRLLPEKVSSVEGEKMVLVACGWRHTITVSDSGNL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  244  YTYGWSKYGQLGHGDFEDHLVP  265


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K++      +  I++G  HT A+T DG L
Sbjct  132  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQAFESVCVKMIAAGAEHTAAVTEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLLP  213


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+ + H  P ++       IS ++ GWRHT+AL+    +
Sbjct  288  ALTSEGKLYGWGWNKFGQVGVGNNDDHSSPGQVSFPEDQKISQVACGWRHTLALSEKKNV  347

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD  +P
Sbjct  348  FSWGRGTSGQLGNGEIVDRNTP  369


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGLKIKQIACGDSHCLAVTMAGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLLP  161


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            L ++G  + GQLGHGD E  LVP  L       I+ +  G  HT A + D  Q+Y WGW 
Sbjct  34   LCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAPAITSVICGADHTTAYSEDELQVYSWGWG  93

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  94   DFGRLGHGNSSDVFTP  109



>pdb|4DNU|A Chain A, Crystal Structure Of The W285a Mutant Of Uvb-resistance 
Protein Uvr8
Length=372

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS SG+LYTYGWSKYGQLGHGD E HL+P KLE L   FIS IS G RHT ALT+DG+L
Sbjct  229  SVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGARHTXALTSDGKL  288

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVG+N+D CSP
Sbjct  289  YGWGWNKFGQVGVGNNLDQCSP  310


 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG GD E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  125  AVTXEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKXVAAGAEHTAAVTEDGDL  184

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  185  YGWGWGRYGNLGLGDRTDRLVP  206


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP ++ +  G+  S ++ GWRHT++++  G L
Sbjct  177  AVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKXSXVACGWRHTISVSYSGAL  236

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  237  YTYGWSKYGQLGHGDLEDHLIP  258


 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  76   SGXEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTXEGEVQSW  135

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+GD  D   P
Sbjct  136  GRNQNGQLGLGDTEDSLVP  154


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT+A +  G ++Y WGW  F
Sbjct  29   SWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGXEVYSWGWGDF  88

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  89   GRLGHGNSSDLFTP  102



>gb|KHN31182.1| Putative E3 ubiquitin-protein ligase HERC4 [Glycine soja]
Length=441

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG +YTYGWSKYGQLGHG+FE  LVP KL+ L    IS +S GWRH+MALT+ G L
Sbjct  236  SVSSSGGIYTYGWSKYGQLGHGNFEDSLVPQKLQALSDKLISQVSGGWRHSMALTSTGLL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQVGVGDN+DHCSP
Sbjct  296  FGWGWNKFGQVGVGDNLDHCSP  317


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K++   G  I  +++G  H++A+T +G+L
Sbjct  132  AVTMEGEVQSWGRNQNGQLGLGNTEDSLVPQKIQAFKGVPIKMVAAGAEHSVAITENGEL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D  +P
Sbjct  192  YGWGWGRYGNLGLGDRNDRWNP  213


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD      P K+ ++  D +  ++ GWRHT+++++ G +
Sbjct  184  AITENGELYGWGWGRYGNLGLGDRNDRWNPEKVSSVDCDKMVMVACGWRHTISVSSSGGI  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G G+  D   P
Sbjct  244  YTYGWSKYGQLGHGNFEDSLVP  265


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   LY++GW  +G+LGHG+    L+P  +  L G  I  I+ G  H +A+T +G++  W
Sbjct  83   SRNELYSWGWGDFGRLGHGNSSDLLIPQPIIALQGLRIKQIACGDSHCLAVTMEGEVQSW  142

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G+  D   P
Sbjct  143  GRNQNGQLGLGNTEDSLVP  161


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD +   +P +L  L    I  I+ G  HT+A + +  +LY WGW  F
Sbjct  36   SWGRGEDGQLGHGDTDDRPLPTQLSALDAQHIDSIACGADHTLAYSESRNELYSWGWGDF  95

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  96   GRLGHGNSSDLLIP  109



>ref|XP_003523212.2| PREDICTED: ultraviolet-B receptor UVR8-like [Glycine max]
Length=482

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG +YTYGWSKYGQLGHG+FE  LVP KL+ L    IS +S GWRH+MALT+ G L
Sbjct  278  SVSSSGGIYTYGWSKYGQLGHGNFEDSLVPQKLQALSDKLISQVSGGWRHSMALTSTGLL  337

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQVGVGDN+DHCSP
Sbjct  338  FGWGWNKFGQVGVGDNLDHCSP  359


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K++   G  I  +++G  H++A+T +G+L
Sbjct  174  AVTMEGEVQSWGRNQNGQLGLGNTEDSLVPQKIQAFKGVPIKMVAAGAEHSVAITENGEL  233

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D  +P
Sbjct  234  YGWGWGRYGNLGLGDRNDRWNP  255


 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD      P K+ ++  D +  ++ GWRHT+++++ G +
Sbjct  226  AITENGELYGWGWGRYGNLGLGDRNDRWNPEKVSSVDCDKMVMVACGWRHTISVSSSGGI  285

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G G+  D   P
Sbjct  286  YTYGWSKYGQLGHGNFEDSLVP  307


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   LY++GW  +G+LGHG+    L+P  +  L G  I  I+ G  H +A+T +G++  W
Sbjct  125  SRNELYSWGWGDFGRLGHGNSSDLLIPQPIIALQGLRIKQIACGDSHCLAVTMEGEVQSW  184

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G+  D   P
Sbjct  185  GRNQNGQLGLGNTEDSLVP  203


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD +   +P +L  L    I  I+ G  HT+A + +  +LY WGW  F
Sbjct  78   SWGRGEDGQLGHGDTDDRPLPTQLSALDAQHIDSIACGADHTLAYSESRNELYSWGWGDF  137

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  138  GRLGHGNSSDLLIP  151



>ref|XP_007137765.1| hypothetical protein PHAVU_009G153900g [Phaseolus vulgaris]
 gb|ESW09759.1| hypothetical protein PHAVU_009G153900g [Phaseolus vulgaris]
Length=443

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHG+FE  LVP KL+ L G+ I  +S GWRH+MALT+ G L
Sbjct  237  SVSSFGGLYTYGWSKYGQLGHGNFEDSLVPHKLQALSGELICQVSGGWRHSMALTSTGLL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD CSP
Sbjct  297  YGWGWNKFGQVGVGDNVDRCSP  318


 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD     +P K+ ++  D +  ++ GWRHT+++++ G L
Sbjct  185  AITENGELYGWGWGRYGNLGLGDRNDRWIPEKVSSIECDKMVMVACGWRHTISVSSFGGL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G G+  D   P
Sbjct  245  YTYGWSKYGQLGHGNFEDSLVP  266


 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++T     I  +++G  H++A+T +G+L
Sbjct  133  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIKTFQEVPIKMVAAGAEHSVAITENGEL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRNDRWIP  214


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   LY++GW  +G+LGHG+    L+P  +  L G  I  I+ G  H +A+T +G++  W
Sbjct  84   SRNELYSWGWGDFGRLGHGNSSDLLIPQPIVALQGLRIKQIACGDSHCLAVTMEGEVQSW  143

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  144  GRNQNGQLGLGTTEDSLVP  162


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = +2

Query  14   SGSLY-TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            SGS+  ++G  + GQLGHGD +   +P +L  L    I  I+ G  HT+A + +  +LY 
Sbjct  31   SGSVVCSWGRGEDGQLGHGDTDDRPLPTQLSALDAQQIDSIACGADHTLAYSESRNELYS  90

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D   P
Sbjct  91   WGWGDFGRLGHGNSSDLLIP  110



>gb|KHN09639.1| Putative E3 ubiquitin-protein ligase HERC4 [Glycine soja]
Length=440

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHG+FE  LVP KL+ L    IS +S GWRH+MALT+ G L
Sbjct  236  SVSSLGGLYTYGWSKYGQLGHGNFEDSLVPQKLQALSDKLISQVSGGWRHSMALTSTGLL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD CSP
Sbjct  296  YGWGWNKFGQVGVGDNVDRCSP  317


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++T  G  I  +++G  H++A+T +G+L
Sbjct  132  AVTMEGEVQSWGRNQNGQLGLGTSEDSLVPQKIQTFQGVPIKMVAAGAEHSVAITENGEL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRWIP  213


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD     +P K+ ++  D +  ++ GWRHT+++++ G L
Sbjct  184  AITENGELYGWGWGRYGNLGLGDRNDRWIPEKVSSVDCDKMVMVACGWRHTISVSSLGGL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G G+  D   P
Sbjct  244  YTYGWSKYGQLGHGNFEDSLVP  265


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   LY++GW  +G+LGHG+    L+P  +  L G  I  I+ G  H +A+T +G++  W
Sbjct  83   SRNELYSWGWGDFGRLGHGNSSDLLIPQPIIALQGLRIKQIACGDSHCLAVTMEGEVQSW  142

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G + D   P
Sbjct  143  GRNQNGQLGLGTSEDSLVP  161


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD +  L+P  L  L    I  I+ G  HT+A + +  +LY WGW  F
Sbjct  36   SWGRGEDGQLGHGDTDDRLLPTHLSALDAQQIDSIACGADHTLAYSESRNELYSWGWGDF  95

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  96   GRLGHGNSSDLLIP  109



>gb|ACU19352.1| unknown [Glycine max]
Length=440

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHG+FE  LVP KL+ L    IS +S GWRH+MALT+ G L
Sbjct  236  SVSSLGGLYTYGWSKYGQLGHGNFEDSLVPQKLQALSDKLISQVSGGWRHSMALTSTGLL  295

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD CSP
Sbjct  296  YGWGWNKFGQVGVGDNVDRCSP  317


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++T  G  I  +++G  H++A+T +G+L
Sbjct  132  AVTMEGEVQSWGRNQNGQLGLGTSEDSLVPQKIQTFQGVPIKMVAAGAEHSVAITENGEL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRWIP  213


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD     +P K+ ++  D +  ++ GWRHT+++++ G L
Sbjct  184  AITENGELYGWGWGRYGNLGLGDRNDRWIPEKVSSVDCDKMVMVACGWRHTISVSSLGGL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G G+  D   P
Sbjct  244  YTYGWSKYGQLGHGNFEDSLVP  265


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   LY++GW  +G+LGHG+    L+P  +  L G  I  I+ G  H +A+T +G++  W
Sbjct  83   SRNELYSWGWGDFGRLGHGNSSDLLIPQPIIALQGLRIKQIACGDSHCLAVTMEGEVQSW  142

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G + D   P
Sbjct  143  GRNQNGQLGLGTSEDSLVP  161


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD +  L+P  L  L    I  I+ G  HT+A + +  +LY WGW  F
Sbjct  36   SWGRGEDGQLGHGDTDDRLLPTHLSALDAQQIDSIACGADHTLAYSESRNELYSWGWGDF  95

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  96   GRLGHGNSSDLLIP  109



>ref|XP_003526878.2| PREDICTED: ultraviolet-B receptor UVR8-like [Glycine max]
Length=474

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSS G LYTYGWSKYGQLGHG+FE  LVP KL+ L    IS +S GWRH+MALT+ G L
Sbjct  270  SVSSLGGLYTYGWSKYGQLGHGNFEDSLVPQKLQALSDKLISQVSGGWRHSMALTSTGLL  329

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD CSP
Sbjct  330  YGWGWNKFGQVGVGDNVDRCSP  351


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++T  G  I  +++G  H++A+T +G+L
Sbjct  166  AVTMEGEVQSWGRNQNGQLGLGTSEDSLVPQKIQTFQGVPIKMVAAGAEHSVAITENGEL  225

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  226  YGWGWGRYGNLGLGDRNDRWIP  247


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD     +P K+ ++  D +  ++ GWRHT+++++ G L
Sbjct  218  AITENGELYGWGWGRYGNLGLGDRNDRWIPEKVSSVDCDKMVMVACGWRHTISVSSLGGL  277

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G G+  D   P
Sbjct  278  YTYGWSKYGQLGHGNFEDSLVP  299


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   LY++GW  +G+LGHG+    L+P  +  L G  I  I+ G  H +A+T +G++  W
Sbjct  117  SRNELYSWGWGDFGRLGHGNSSDLLIPQPIIALQGLRIKQIACGDSHCLAVTMEGEVQSW  176

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G + D   P
Sbjct  177  GRNQNGQLGLGTSEDSLVP  195


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD +  L+P  L  L    I  I+ G  HT+A + +  +LY WGW  F
Sbjct  70   SWGRGEDGQLGHGDTDDRLLPTHLSALDAQQIDSIACGADHTLAYSESRNELYSWGWGDF  129

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  130  GRLGHGNSSDLLIP  143



>gb|KJB71361.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=439

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 68/82 (83%), Gaps = 3/82 (4%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  240  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNK   VGVGDN DHCSP
Sbjct  300  YGWGWNK---VGVGDNADHCSP  318


 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  188  AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+F     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SCTEVYSWGWGDFGRLGHGNFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSTEDSLVP  165


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSCTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G+  D  +P
Sbjct  100  GRLGHGNFSDLFTP  113



>ref|XP_004502975.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Cicer 
arietinum]
Length=443

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGD E +LVP KL+ L    IS ++ GWRHTMALTT G L
Sbjct  239  SVSSSGGLYTYGWSKYGQLGHGDNEDYLVPHKLQALSDKLISQVAGGWRHTMALTTGGLL  298

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD  SP
Sbjct  299  YGWGWNKFGQVGVGDNVDRNSP  320


 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  H++A+T +G+L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQKFQGIPIKMVAAGAEHSVAITENGEL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D C P
Sbjct  194  YGWGWGRYGNLGLGDRNDRCIP  215


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            +++ +G LY +GW +YG LG GD     +P K+   L  D +  ++ GWRHT+++++ G 
Sbjct  186  AITENGELYGWGWGRYGNLGLGDRNDRCIPEKVSVDLQCDKMVMVACGWRHTISVSSSGG  245

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            LY +GW+K+GQ+G GDN D+  P
Sbjct  246  LYTYGWSKYGQLGHGDNEDYLVP  268


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+     +P  +  L G  I  I+ G  H +A+T +G++  
Sbjct  84   ESRVEVYSWGWGDFGRLGHGNSSDLFIPQPIRALQGLRIRQIACGDSHCLAVTMEGEVQS  143

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  144  WGRNQNGQLGLGTTEDSLVP  163


 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S   + ++G  + GQLGHGD    L+P +L  L    I  +  G  HT+A + +  ++Y 
Sbjct  32   SGNVVCSWGRGEDGQLGHGDTVDRLLPTQLSALDAQQIVSVVCGADHTIAYSESRVEVYS  91

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D   P
Sbjct  92   WGWGDFGRLGHGNSSDLFIP  111



>ref|XP_004502976.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Cicer 
arietinum]
Length=441

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYTYGWSKYGQLGHGD E +LVP KL+ L    IS ++ GWRHTMALTT G L
Sbjct  237  SVSSSGGLYTYGWSKYGQLGHGDNEDYLVPHKLQALSDKLISQVAGGWRHTMALTTGGLL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVGVGDNVD  SP
Sbjct  297  YGWGWNKFGQVGVGDNVDRNSP  318


 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  H++A+T +G+L
Sbjct  134  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQKFQGIPIKMVAAGAEHSVAITENGEL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D C P
Sbjct  194  YGWGWGRYGNLGLGDRNDRCIP  215


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ +G LY +GW +YG LG GD     +P K+ ++  D +  ++ GWRHT+++++ G L
Sbjct  186  AITENGELYGWGWGRYGNLGLGDRNDRCIPEKV-SVDCDKMVMVACGWRHTISVSSSGGL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GDN D+  P
Sbjct  245  YTYGWSKYGQLGHGDNEDYLVP  266


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHG+     +P  +  L G  I  I+ G  H +A+T +G++  
Sbjct  84   ESRVEVYSWGWGDFGRLGHGNSSDLFIPQPIRALQGLRIRQIACGDSHCLAVTMEGEVQS  143

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  144  WGRNQNGQLGLGTTEDSLVP  163


 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYG  187
            S   + ++G  + GQLGHGD    L+P +L  L    I  +  G  HT+A + +  ++Y 
Sbjct  32   SGNVVCSWGRGEDGQLGHGDTVDRLLPTQLSALDAQQIVSVVCGADHTIAYSESRVEVYS  91

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D   P
Sbjct  92   WGWGDFGRLGHGNSSDLFIP  111



>ref|XP_004503906.1| PREDICTED: ultraviolet-B receptor UVR8-like [Cicer arietinum]
Length=454

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVSSSG LYT+GW KYGQLGHG+FE HLVPCK++ L   FIS +S GWRH+MALT+ GQL
Sbjct  238  SVSSSGGLYTHGWGKYGQLGHGNFEDHLVPCKVQALSDKFISQVSGGWRHSMALTSTGQL  297

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQ+GVG+N D  +P
Sbjct  298  FGWGWNKFGQIGVGNNFDCSTP  319


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD     +P K+   HG+ I  +S GWRHT+++++ G L
Sbjct  186  AITEDGDLYGWGWGQYGNLGLGDTNNRSIPEKVTVDHGEKIVMVSCGWRHTISVSSSGGL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW K+GQ+G G+  DH  P
Sbjct  246  YTHGWGKYGQLGHGNFEDHLVP  267


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+    + ++G ++ G+LG G  +   VP KL T  G  I+ +++G  H++A+T DG L
Sbjct  134  AVTMESKVLSWGRNQNGELGIGTTKDSPVPQKLFTFEGIHINMVAAGAEHSVAITEDGDL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  +   P
Sbjct  194  YGWGWGQYGNLGLGDTNNRSIP  215


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
            ++Y+ GW  +G+LGHGD    L+P  +  L G  I  ++ G  H +A+T + ++  WG N
Sbjct  88   NVYSCGWGDFGRLGHGDHSDLLIPHPIRALQGLRIKQLACGDSHCLAVTMESKVLSWGRN  147

Query  200  KFGQVGVGDNVDHCSP  247
            + G++G+G   D   P
Sbjct  148  QNGELGIGTTKDSPVP  163


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD    L+P KL    G  I  ++ G  +T+  +  G  +Y  GW  F
Sbjct  38   SWGRGEDGQLGHGDTNDRLLPTKLSAFDGQNIVSVTCGADYTVVRSESGCNVYSCGWGDF  97

Query  206  GQVGVGDNVDHCSP  247
            G++G GD+ D   P
Sbjct  98   GRLGHGDHSDLLIP  111



>ref|XP_007159870.1| hypothetical protein PHAVU_002G274700g [Phaseolus vulgaris]
 gb|ESW31864.1| hypothetical protein PHAVU_002G274700g [Phaseolus vulgaris]
Length=356

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG LY+YGW KYGQLGHGDFE HLVP K+ETL   FIS +S GWRH+MALT+ GQL+
Sbjct  159  VSSSGGLYSYGWGKYGQLGHGDFEDHLVPRKVETLIDKFISQVSGGWRHSMALTSSGQLF  218

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQ+GVG+N+D  SP
Sbjct  219  GWGWNKFGQIGVGNNLDCWSP  239


 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G+LY +GW +YG LG GD    L+P K+ T+    I+ ++ GWRHT+ +++ G L
Sbjct  107  AVTEDGNLYGWGWGRYGNLGLGDRNDRLLPQKV-TIDDYKITLVACGWRHTICVSSSGGL  165

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW K+GQ+G GD  DH  P
Sbjct  166  YSYGWGKYGQLGHGDFEDHLVP  187


 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SV+    + ++G +K G+LG G  E  L+P K++   G  +  +++G  H++A+T DG L
Sbjct  55   SVTMDKLVLSWGHNKNGELGLGTTEDSLLPQKIQKFEGIPVKMVAAGAEHSVAVTEDGNL  114

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  115  YGWGWGRYGNLGLGDRNDRLLP  136


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S  ++Y++GW  +G+LGHGD    L+P  +  L G  I  ++ G  H +++T D  +  
Sbjct  5    ESGRTVYSWGWGDFGRLGHGDHNDMLIPHPIRALEGLMIQQVACGDSHCLSVTMDKLVLS  64

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG NK G++G+G   D   P
Sbjct  65   WGHNKNGELGLGTTEDSLLP  84



>ref|XP_007159868.1| hypothetical protein PHAVU_002G274700g [Phaseolus vulgaris]
 gb|ESW31862.1| hypothetical protein PHAVU_002G274700g [Phaseolus vulgaris]
Length=472

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG LY+YGW KYGQLGHGDFE HLVP K+ETL   FIS +S GWRH+MALT+ GQL+
Sbjct  275  VSSSGGLYSYGWGKYGQLGHGDFEDHLVPRKVETLIDKFISQVSGGWRHSMALTSSGQLF  334

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQ+GVG+N+D  SP
Sbjct  335  GWGWNKFGQIGVGNNLDCWSP  355


 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G+LY +GW +YG LG GD    L+P K+ T+    I+ ++ GWRHT+ +++ G L
Sbjct  223  AVTEDGNLYGWGWGRYGNLGLGDRNDRLLPQKV-TIDDYKITLVACGWRHTICVSSSGGL  281

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW K+GQ+G GD  DH  P
Sbjct  282  YSYGWGKYGQLGHGDFEDHLVP  303


 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SV+    + ++G +K G+LG G  E  L+P K++   G  +  +++G  H++A+T DG L
Sbjct  171  SVTMDKLVLSWGHNKNGELGLGTTEDSLLPQKIQKFEGIPVKMVAAGAEHSVAVTEDGNL  230

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  231  YGWGWGRYGNLGLGDRNDRLLP  252


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S  ++Y++GW  +G+LGHGD    L+P  +  L G  I  ++ G  H +++T D  +  
Sbjct  121  ESGRTVYSWGWGDFGRLGHGDHNDMLIPHPIRALEGLMIQQVACGDSHCLSVTMDKLVLS  180

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG NK G++G+G   D   P
Sbjct  181  WGHNKNGELGLGTTEDSLLP  200


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-  178
            ++ S   + ++G  + GQLGHGD +  L+P KL  L    I  ++ G  HTMA +  G+ 
Sbjct  66   ALLSGNVVCSWGQGEDGQLGHGDTDDRLLPTKLSALDDQDIISVTCGADHTMARSESGRT  125

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G GD+ D   P
Sbjct  126  VYSWGWGDFGRLGHGDHNDMLIP  148



>gb|KHN17397.1| Putative E3 ubiquitin-protein ligase HERC4 [Glycine soja]
Length=386

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG LYT GW KYGQLGHGDFE HLVP K++ L   FIS +S GWRH+MALT+ GQL 
Sbjct  186  VSSSGGLYTNGWGKYGQLGHGDFEDHLVPRKVQALSDKFISQVSGGWRHSMALTSSGQLL  245

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQ+GVG+N D CSP
Sbjct  246  GWGWNKFGQIGVGNNFDCCSP  266


 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+    + ++G ++ G+LG G  E  L+P K++   GD ++ ++ GWRHT+ +++ G L
Sbjct  133  AVTMDSQVLSWGRNQNGELGLGTAEDSLLPQKIQIFEGDKMAMVACGWRHTICVSSSGGL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW K+GQ+G GD  DH  P
Sbjct  193  YTNGWGKYGQLGHGDFEDHLVP  214


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHGD    L+P  ++ L G  I  I+ G  H +A+T D Q+  WG N+
Sbjct  88   VYSWGWGDFGRLGHGDHSDLLIPHPIKALQGLMIQQIACGDSHCLAVTMDSQVLSWGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             G++G+G   D   P
Sbjct  148  NGELGLGTAEDSLLP  162


 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYG  187
            S   + ++G  + GQLGHGD +  L P KL  L G  I  ++ G  HTMA +  G+ +Y 
Sbjct  31   SGNVVCSWGRGEDGQLGHGDTDDRLFPTKLSALDGQDIICVTCGADHTMARSESGRDVYS  90

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G GD+ D   P
Sbjct  91   WGWGDFGRLGHGDHSDLLIP  110



>ref|XP_007159869.1| hypothetical protein PHAVU_002G274700g [Phaseolus vulgaris]
 gb|ESW31863.1| hypothetical protein PHAVU_002G274700g [Phaseolus vulgaris]
Length=436

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG LY+YGW KYGQLGHGDFE HLVP K+ETL   FIS +S GWRH+MALT+ GQL+
Sbjct  239  VSSSGGLYSYGWGKYGQLGHGDFEDHLVPRKVETLIDKFISQVSGGWRHSMALTSSGQLF  298

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQ+GVG+N+D  SP
Sbjct  299  GWGWNKFGQIGVGNNLDCWSP  319


 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G+LY +GW +YG LG GD    L+P K+ T+    I+ ++ GWRHT+ +++ G L
Sbjct  187  AVTEDGNLYGWGWGRYGNLGLGDRNDRLLPQKV-TIDDYKITLVACGWRHTICVSSSGGL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW K+GQ+G GD  DH  P
Sbjct  246  YSYGWGKYGQLGHGDFEDHLVP  267


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SV+    + ++G +K G+LG G  E  L+P K++   G  +  +++G  H++A+T DG L
Sbjct  135  SVTMDKLVLSWGHNKNGELGLGTTEDSLLPQKIQKFEGIPVKMVAAGAEHSVAVTEDGNL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLLP  216


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S  ++Y++GW  +G+LGHGD    L+P  +  L G  I  ++ G  H +++T D  +  
Sbjct  85   ESGRTVYSWGWGDFGRLGHGDHNDMLIPHPIRALEGLMIQQVACGDSHCLSVTMDKLVLS  144

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG NK G++G+G   D   P
Sbjct  145  WGHNKNGELGLGTTEDSLLP  164


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-  178
            ++ S   + ++G  + GQLGHGD +  L+P KL  L    I  ++ G  HTMA +  G+ 
Sbjct  30   ALLSGNVVCSWGQGEDGQLGHGDTDDRLLPTKLSALDDQDIISVTCGADHTMARSESGRT  89

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G GD+ D   P
Sbjct  90   VYSWGWGDFGRLGHGDHNDMLIP  112



>ref|XP_003525133.1| PREDICTED: ultraviolet-B receptor UVR8-like [Glycine max]
Length=437

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VSSSG LYT GW KYGQLGHGDFE HLVP K++ L   FIS +S GWRH+MALT+ GQL 
Sbjct  237  VSSSGGLYTNGWGKYGQLGHGDFEDHLVPRKVQALSDKFISQVSGGWRHSMALTSSGQLL  296

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQ+GVG+N D CSP
Sbjct  297  GWGWNKFGQIGVGNNFDCCSP  317


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G+LY +GW +YG LG GD    L+P K+ T+ GD ++ ++ GWRHT+ +++ G L
Sbjct  185  AITKDGNLYGWGWGRYGNLGLGDRNDRLLPEKV-TVDGDKMAMVACGWRHTICVSSSGGL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW K+GQ+G GD  DH  P
Sbjct  244  YTNGWGKYGQLGHGDFEDHLVP  265


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+    + ++G ++ G+LG G  E  L+P K++      I  +++G  H++A+T DG L
Sbjct  133  AVTMDSQVLSWGRNQNGELGLGTAEDSLLPQKIQIFEEIPIKMVAAGAEHSVAITKDGNL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRNDRLLP  214


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHGD    L+P  ++ L G  I  I+ G  H +A+T D Q+  
Sbjct  83   ESGRDVYSWGWGDFGRLGHGDHSDLLIPHPIKALQGLMIQQIACGDSHCLAVTMDSQVLS  142

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ G++G+G   D   P
Sbjct  143  WGRNQNGELGLGTAEDSLLP  162


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYG  187
            S   + ++G  + GQLGHGD +  L P KL  L G  I  ++ G  HTMA +  G+ +Y 
Sbjct  31   SGNVVCSWGRGEDGQLGHGDTDDRLFPTKLSALDGQDIICVTCGADHTMARSESGRDVYS  90

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G GD+ D   P
Sbjct  91   WGWGDFGRLGHGDHSDLLIP  110



>gb|KEH20913.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=276

 Score =   120 bits (301),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +S GWRH+MALT++GQL
Sbjct  62   SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQVSGGWRHSMALTSNGQL  121

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQ+G+G N D  SP
Sbjct  122  FGWGWNKFGQIGIGHNFDCSSP  143


 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  11   AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKV-NIDGDKIVMVSCGWRHTISISSSGGL  69

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  70   YTHGWSKYGQLGHGDFEDCLVP  91


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  131  ISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            +++G  H++A+T DG LYGWGW ++G +G+GD  D   P
Sbjct  2    VAAGAEHSVAITEDGDLYGWGWGRYGNLGLGDTNDRLIP  40



>gb|AET04806.2| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=315

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +S GWRH+MALT++GQL
Sbjct  101  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQVSGGWRHSMALTSNGQL  160

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQ+G+G N D  SP
Sbjct  161  FGWGWNKFGQIGIGHNFDCSSP  182


 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  50   AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKV-NIDGDKIVMVSCGWRHTISISSSGGL  108

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  109  YTHGWSKYGQLGHGDFEDCLVP  130


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            + ++G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG LYGWGW +
Sbjct  5    VLSWGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDLYGWGWGR  64

Query  203  FGQVGVGDNVDHCSP  247
            +G +G+GD  D   P
Sbjct  65   YGNLGLGDTNDRLIP  79



>gb|AET04804.2| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=400

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +S GWRH+MALT++GQL
Sbjct  186  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQVSGGWRHSMALTSNGQL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQ+G+G N D  SP
Sbjct  246  FGWGWNKFGQIGIGHNFDCSSP  267


 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  135  AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKVN-IDGDKIVMVSCGWRHTISISSSGGL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  194  YTHGWSKYGQLGHGDFEDCLVP  215


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  32   YGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKFGQ  211
            +G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG LYGWGW ++G 
Sbjct  93   WGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDLYGWGWGRYGN  152

Query  212  VGVGDNVDHCSP  247
            +G+GD  D   P
Sbjct  153  LGLGDTNDRLIP  164



>gb|AET04805.2| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=361

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +S GWRH+MALT++GQL
Sbjct  186  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQVSGGWRHSMALTSNGQL  245

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQ+G+G N D  SP
Sbjct  246  FGWGWNKFGQIGIGHNFDCSSP  267


 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  135  AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKVN-IDGDKIVMVSCGWRHTISISSSGGL  193

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  194  YTHGWSKYGQLGHGDFEDCLVP  215


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  32   YGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKFGQ  211
            +G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG LYGWGW ++G 
Sbjct  93   WGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDLYGWGWGRYGN  152

Query  212  VGVGDNVDHCSP  247
            +G+GD  D   P
Sbjct  153  LGLGDTNDRLIP  164



>gb|AET04807.2| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=449

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +S GWRH+MALT++GQL
Sbjct  235  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQVSGGWRHSMALTSNGQL  294

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQ+G+G N D  SP
Sbjct  295  FGWGWNKFGQIGIGHNFDCSSP  316


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  184  AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKVN-IDGDKIVMVSCGWRHTISISSSGGL  242

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  243  YTHGWSKYGQLGHGDFEDCLVP  264


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+    + ++G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG L
Sbjct  132  AVTMENKVLSWGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDTNDRLIP  213


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHGD     +P  +  L G  I  IS G  H +A+T + ++  W
Sbjct  83   SGKDVYSWGWGDFGRLGHGDPSDLFIPHPIRALQGLRIKQISCGDCHCLAVTMENKVLSW  142

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ G++G+G   D   P
Sbjct  143  GRNQNGELGLGTTKDSHVP  161


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYGWGWNKF  205
            ++G  + GQLGHGD +  L+P KL    G  I  ++ G  +T+A +  G+ +Y WGW  F
Sbjct  36   SWGRGEDGQLGHGDTDDRLLPTKLSAFDGQDIVSVTCGADYTVARSKSGKDVYSWGWGDF  95

Query  206  GQVGVGDNVDHCSP  247
            G++G GD  D   P
Sbjct  96   GRLGHGDPSDLFIP  109



>gb|KEH20912.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=410

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +S GWRH+MALT++GQL
Sbjct  235  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQVSGGWRHSMALTSNGQL  294

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGWNKFGQ+G+G N D  SP
Sbjct  295  FGWGWNKFGQIGIGHNFDCSSP  316


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  184  AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKVN-IDGDKIVMVSCGWRHTISISSSGGL  242

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  243  YTHGWSKYGQLGHGDFEDCLVP  264


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+    + ++G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG L
Sbjct  132  AVTMENKVLSWGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDTNDRLIP  213


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHGD     +P  +  L G  I  IS G  H +A+T + ++  
Sbjct  82   KSGKDVYSWGWGDFGRLGHGDPSDLFIPHPIRALQGLRIKQISCGDCHCLAVTMENKVLS  141

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ G++G+G   D   P
Sbjct  142  WGRNQNGELGLGTTKDSHVP  161


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYGWGWNKF  205
            ++G  + GQLGHGD +  L+P KL    G  I  ++ G  +T+A +  G+ +Y WGW  F
Sbjct  36   SWGRGEDGQLGHGDTDDRLLPTKLSAFDGQDIVSVTCGADYTVARSKSGKDVYSWGWGDF  95

Query  206  GQVGVGDNVDHCSP  247
            G++G GD  D   P
Sbjct  96   GRLGHGDPSDLFIP  109



>ref|XP_001757031.1| predicted protein [Physcomitrella patens]
 gb|EDQ78262.1| predicted protein [Physcomitrella patens]
Length=420

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V++SG+LYT+GWSKYGQLGHGDFE HLVP +++ L    I  +S GWRHT+AL  DG+L
Sbjct  237  AVANSGNLYTFGWSKYGQLGHGDFEDHLVPHQVQALKNKTIQAVSGGWRHTVALDEDGEL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG G+  DH SP
Sbjct  297  YGWGWNKFGQVGCGNTDDHNSP  318


 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ SG LY +GW +YG LG GD    LVP ++  + G+ ++ ++ GWRHT+A+   G L
Sbjct  185  AVTESGKLYGWGWGRYGNLGLGDRNDRLVPGEVAAVPGEKMNLVACGWRHTIAVANSGNL  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTFGWSKYGQLGHGDFEDHLVP  266


 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++   G LY +GW+K+GQ+G G+ + H  P  +  +  + ++ ++ GWRHT+A+T  G +
Sbjct  289  ALDEDGELYGWGWNKFGQVGCGNTDDHNSPKLITGIVNEKVTRVTCGWRHTVAITDRGNV  348

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG    GQ+G GD VD C P
Sbjct  349  YSWGRGTSGQLGHGDAVDRCVP  370


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G ++++G ++ GQLG G  E  LVP K+    G  +  +++G  HT A+T  G+L
Sbjct  133  AITGDGEVHSWGRNQNGQLGLGHTEDVLVPNKVAAFEGIAVKMLAAGAEHTAAVTESGKL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDRNDRLVP  214


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S+ ++Y++GW  +G+LGHG+     +P  ++ L G  I  I+ G  H +A+T DG+++ 
Sbjct  83   ESTRTVYSWGWGDFGRLGHGNSSDLFIPRAIKGLKGLEIKQIACGDSHCLAITGDGEVHS  142

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D   P
Sbjct  143  WGRNQNGQLGLGHTEDVLVP  162


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYGWGWN  199
            + ++G  + GQLGHGD E   +P  +  L    IS I+ G  HT A +   + +Y WGW 
Sbjct  35   VCSWGRGEDGQLGHGDAEERHLPLVISALDDCEISSITCGADHTTARSESTRTVYSWGWG  94

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D   P
Sbjct  95   DFGRLGHGNSSDLFIP  110



>gb|KJB71362.1| hypothetical protein B456_011G118200 [Gossypium raimondii]
Length=421

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS +G LYTYGWSKYGQLGHGDFE HLVP K+E+L   FI  I+ GWRHTMALT+DG+L
Sbjct  240  SVSDTGRLYTYGWSKYGQLGHGDFEDHLVPHKVESLADSFIKQIAGGWRHTMALTSDGKL  299

Query  182  YGWGWNKFGQ  211
            YGWGWNKFGQ
Sbjct  300  YGWGWNKFGQ  309


 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS  G+LY +GW +YG LG GD    LVP K+ TL+G+ ++ ++ GWRHT++++  G+L
Sbjct  188  AVSEEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNGEKMNMVACGWRHTISVSDTGRL  247

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  248  YTYGWSKYGQLGHGDFEDHLVP  269


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A++ +G L
Sbjct  136  AVTMEGEVQSWGRNQNGQLGLGSTEDSLVPQKIQAFQGISIKMVAAGAEHTAAVSEEGAL  195

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  196  YGWGWGRYGNLGLGDRNDRLVP  217


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S   +Y++GW  +G+LGHG+F     P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  87   SCTEVYSWGWGDFGRLGHGNFSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  146

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  147  GRNQNGQLGLGSTEDSLVP  165


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYGWGWNKF  205
            ++G  + GQLGHGD E  L P +L  L G  I  ++ G  HT A +    ++Y WGW  F
Sbjct  40   SWGRGEDGQLGHGDAEDRLSPTRLSALDGLDIISVTCGADHTTAYSLSCTEVYSWGWGDF  99

Query  206  GQVGVGDNVDHCSP  247
            G++G G+  D  +P
Sbjct  100  GRLGHGNFSDLFTP  113



>ref|XP_001778783.1| predicted protein [Physcomitrella patens]
 gb|EDQ56369.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ SG++YT+GWSKYGQLGHGDF  HL+P +++ L    I  I+ GWRHT AL +DG+LY
Sbjct  238  VAESGNMYTFGWSKYGQLGHGDFADHLIPHQVQALKSKKIQAITGGWRHTFALDSDGRLY  297

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQVG G+  D  SP
Sbjct  298  GWGWNKFGQVGCGNTEDQSSP  318


 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G LY +GW +YG LG GD E  LVP ++  + G+ +  ++ GWRHT+ +   G +
Sbjct  185  AVTENGKLYGWGWGRYGNLGLGDREDRLVPDQVAAVAGELMKMVACGWRHTICVAESGNM  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  245  YTFGWSKYGQLGHGDFADHLIP  266


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++ S G LY +GW+K+GQ+G G+ E    P  ++ L    ++ +  GWRHT+A+T  G +
Sbjct  289  ALDSDGRLYGWGWNKFGQVGCGNTEDQSSPQLVKGLQDQVVTVVQCGWRHTLAMTDRGNV  348

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG    GQ+G GD VD  +P
Sbjct  349  YSWGRGTSGQLGHGDTVDRSTP  370


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++++ G +  +G ++ GQLG G  E  L P KL    G  +  +++G  HT A+T +G+L
Sbjct  133  AITTDGEVLGWGRNQNGQLGLGHTEDVLTPHKLTAFEGVAVKMLAAGAEHTTAVTENGKL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  193  YGWGWGRYGNLGLGDREDRLVP  214


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            +S+ ++Y++GW  +G+LGHG+     +P  ++ L G  +  I+ G  H +A+TTDG++ G
Sbjct  83   NSTKTVYSWGWGDFGRLGHGNSSDLFIPQPIKALKGLEVKQIACGDSHCLAITTDGEVLG  142

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ GQ+G+G   D  +P
Sbjct  143  WGRNQNGQLGLGHTEDVLTP  162


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +2

Query  14   SGSLY-TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYG  187
            SG L  ++G  + GQLGHGD E    P  +  L    IS ++ G  HT AL+   + +Y 
Sbjct  31   SGDLVCSWGRGEDGQLGHGDAEERHFPTIVSALDDCEISSVTCGADHTTALSNSTKTVYS  90

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D   P
Sbjct  91   WGWGDFGRLGHGNSSDLFIP  110



>ref|XP_002963525.1| hypothetical protein SELMODRAFT_438355 [Selaginella moellendorffii]
 gb|EFJ35396.1| hypothetical protein SELMODRAFT_438355 [Selaginella moellendorffii]
Length=430

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG LYTYGWSKYGQLGHGD+  HL+P ++  L    I+ +S GWRHT+ALT  G+L
Sbjct  228  AVSQSGKLYTYGWSKYGQLGHGDYADHLLPHQVAALAEFNITQVSGGWRHTVALTEAGKL  287

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GD  DH SP
Sbjct  288  YGWGWNKFGQVGSGDVDDHTSP  309


 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    ++P ++  +  + +  ++ GWRHT+A++  G+L
Sbjct  176  AVTDGGKLYGWGWGRYGNLGLGDRGDRMLPAEVPAVGDEKMCMVACGWRHTIAVSQSGKL  235

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  236  YTYGWSKYGQLGHGDYADHLLP  257


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V++ G +Y++G ++ GQLG GD +  LVP KL    G  +  +++G  HT A+T  G+L
Sbjct  124  AVTADGEVYSWGRNQNGQLGLGDTDDSLVPHKLLAFEGVSVKMLAAGAEHTAAVTDGGKL  183

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  184  YGWGWGRYGNLGLGDRGDRMLP  205


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
            ++Y++GW  +G+LGHG+     VP  ++ L G  I  I+ G  H +A+T DG++Y WG N
Sbjct  78   TIYSWGWGDFGRLGHGNSSDLFVPHPIKALQGLEIRQIACGDSHCLAVTADGEVYSWGRN  137

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  138  QNGQLGLGDTDDSLVP  153


 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E   +P  +  L+   IS ++ G  HT A + T   +Y WGW  F
Sbjct  28   SFGRGEDGQLGHGDAEDRHLPRIIGALNDCEISLVACGADHTTAYSATRLTIYSWGWGDF  87

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  88   GRLGHGNSSDLFVP  101



>ref|XP_002981556.1| hypothetical protein SELMODRAFT_179009 [Selaginella moellendorffii]
 gb|EFJ17371.1| hypothetical protein SELMODRAFT_179009 [Selaginella moellendorffii]
Length=430

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +VS SG LYTYGWSKYGQLGHGD+  HL+P ++  L    I+ +S GWRHT+ALT  G+L
Sbjct  228  AVSQSGKLYTYGWSKYGQLGHGDYADHLLPHQVAALAEFNITQVSGGWRHTVALTEAGKL  287

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GD  DH SP
Sbjct  288  YGWGWNKFGQVGSGDVDDHTSP  309


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ SG LY +GW +YG LG GD    ++P ++  +  + +  ++ GWRHT+A++  G+L
Sbjct  176  AVTDSGKLYGWGWGRYGNLGLGDRGDRMLPAEVPAVGDEKMCMVACGWRHTIAVSQSGKL  235

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  236  YTYGWSKYGQLGHGDYADHLLP  257


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V++ G +Y++G ++ GQLG GD +  LVP KL    G  +  +++G  HT A+T  G+L
Sbjct  124  AVTADGEVYSWGRNQNGQLGLGDTDDSLVPHKLLAFEGVSVKMLAAGAEHTAAVTDSGKL  183

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  184  YGWGWGRYGNLGLGDRGDRMLP  205


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
            ++Y++GW  +G+LGHG+     VP  ++ L G  I  I+ G  H +A+T DG++Y WG N
Sbjct  78   TIYSWGWGDFGRLGHGNSSDLFVPHPIKALQGLEIRQIACGDSHCLAVTADGEVYSWGRN  137

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+GD  D   P
Sbjct  138  QNGQLGLGDTDDSLVP  153


 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWNKF  205
            ++G  + GQLGHGD E  L+P  +  L+   IS ++ G  HT A + T   +Y WGW  F
Sbjct  28   SFGRGEDGQLGHGDAEDRLLPRIIGALNDCEISLVACGADHTTAYSATRLTIYSWGWGDF  87

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D   P
Sbjct  88   GRLGHGNSSDLFVP  101



>gb|EEE57180.1| hypothetical protein OsJ_07117 [Oryza sativa Japonica Group]
Length=463

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 66/97 (68%), Gaps = 15/97 (15%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISS-----------GWR  148
            +VSSSGS+YTYGWSKYGQLGHGDFE HLVP KLE L    IS   +           G+R
Sbjct  247  TVSSSGSIYTYGWSKYGQLGHGDFEDHLVPHKLEALKDTTISQEEAVELIFFFLGDEGFR  306

Query  149  ----HTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
                   AL  DG+LYGWGWNKFGQVGVGDN DHCSP
Sbjct  307  VGGGIQWALAADGKLYGWGWNKFGQVGVGDNEDHCSP  343


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD +  L+P K+ +++G  +  ++ GWRHT+ +++ G +
Sbjct  195  AVTEDGDLYGWGWGRYGNLGLGDRDDRLIPEKVSSVNGQKMVLVACGWRHTITVSSSGSI  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  255  YTYGWSKYGQLGHGDFEDHLVP  276


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G ++++G ++ GQLG G+ E  L+P K++   G  +  I++G  HT A+T DG L
Sbjct  143  AVTVAGHVHSWGRNQNGQLGLGNTEDSLLPQKIQAFEGVRVKMIAAGAEHTAAVTEDGDL  202

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  203  YGWGWGRYGNLGLGDRDDRLIP  224


 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++++ G LY +GW+K+GQ+G GD E H  P ++   +   +  ++ GWRHT+ALT    +
Sbjct  314  ALAADGKLYGWGWNKFGQVGVGDNEDHCSPVQVNFPNEQKVVQVACGWRHTLALTEAKNV  373

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G+ VD   P
Sbjct  374  FSWGRGTSGQLGHGEIVDRNIP  395


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            LY++GW  +G+LGHG+      P  ++ L G  I+ I+ G  H +A+T  G ++ WG N+
Sbjct  98   LYSWGWGDFGRLGHGNSSDVFNPQPIQALQGVRITQIACGDSHCLAVTVAGHVHSWGRNQ  157

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  158  NGQLGLGNTEDSLLP  172


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 5/84 (6%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGD----FISPISSGWRHTMALTTDG-  175
            S G + ++G  + GQLGHGD E   VP  L     D      S +  G  HT A + +  
Sbjct  37   SGGVVCSWGRGEDGQLGHGDAEDRPVPTVLTAAFDDAPGGVASVVICGADHTTAYSDEEL  96

Query  176  QLYGWGWNKFGQVGVGDNVDHCSP  247
            QLY WGW  FG++G G++ D  +P
Sbjct  97   QLYSWGWGDFGRLGHGNSSDVFNP  120



>ref|XP_008781629.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoenix dactylifera]
Length=320

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + S+SG+LYT+GWSKYGQLGHGDFE HL+P +LE L    IS IS GWRHTMALT+DG+L
Sbjct  243  AASASGNLYTFGWSKYGQLGHGDFEDHLIPHQLEALKDSCISQISGGWRHTMALTSDGRL  302

Query  182  YGWGWNKF  205
            YGWGWNK 
Sbjct  303  YGWGWNKV  310


 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+  + G  +  ++ GWRHT+A +  G L
Sbjct  191  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPEKVSAIEGQKMVLVACGWRHTIAASASGNL  250

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  251  YTFGWSKYGQLGHGDFEDHLIP  272


 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  +  +++G  HT A+T DG+L
Sbjct  139  AVTVDGVVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQGIAVKMVAAGAEHTAAVTEDGEL  198

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  199  YGWGWGRYGNLGLGDRNDRLVP  220


 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T DG +  WG N+
Sbjct  94   VYSWGWGDFGRLGHGNSSDVFTPQPIKALQGLKIKQIACGDSHCLAVTVDGVVQSWGRNQ  153

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  154  NGQLGLGTTEDSLVP  168


 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQ  178
            ++ S   + ++G  + GQLGHGD E   +P  L  L+      ++ G  HT A + ++ Q
Sbjct  34   ALLSDNVVCSWGRGEDGQLGHGDAEDRHLPTLLSALNNPGFVSVTCGADHTTAYSESELQ  93

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G G++ D  +P
Sbjct  94   VYSWGWGDFGRLGHGNSSDVFTP  116



>ref|XP_008442150.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X4 [Cucumis melo]
Length=376

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G L+ +GW +YG LG GD    LVP K+ ++       IS GWRHTMALTTDG+L
Sbjct  179  AVTEDGELFGWGWGRYGNLGLGDRNDRLVPQKVSSVD------ISGGWRHTMALTTDGKL  232

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGWNKFGQVG GDN+DHCSP
Sbjct  233  YGWGWNKFGQVGAGDNIDHCSP  254


 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K++   G  I  +++G  HT A+T DG+L
Sbjct  127  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFEGIPIKMVAAGAEHTAAVTEDGEL  186

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            +GWGW ++G +G+GD  D   P
Sbjct  187  FGWGWGRYGNLGLGDRNDRLVP  208


 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++++ G LY +GW+K+GQ+G GD   H  P +++      +  IS GWRHT+A+T    +
Sbjct  225  ALTTDGKLYGWGWNKFGQVGAGDNIDHCSPIQIKFPQDQKVIQISCGWRHTLAVTDKQNV  284

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G G++VD  +P
Sbjct  285  FSWGRGTNGQLGHGESVDRNTP  306


 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  81   EVYSWGWGDFGRLGHGNSSDLFTPKPIKALHGLKIRQIACGDSHCLAVTMEGEVQSWGRN  140

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G   D   P
Sbjct  141  QNGQLGLGTTEDSLVP  156


 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E    P +L  L G  I  ++ G  HT A +    ++Y WGW 
Sbjct  29   VCSWGRGEDGQLGHGDAEDRFSPTQLSALDGHEIVSVTCGADHTTAYSEARTEVYSWGWG  88

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  89   DFGRLGHGNSSDLFTP  104



>gb|KJB33345.1| hypothetical protein B456_006G007400 [Gossypium raimondii]
Length=348

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            SVS  G LYTYGWSKYGQLGHGDFE HLVP K+E L    I  IS GWRHTMALT+DG+L
Sbjct  239  SVSVIGGLYTYGWSKYGQLGHGDFEDHLVPYKVEALADSSIKQISGGWRHTMALTSDGKL  298

Query  182  YGWGWNKF  205
            YGWGWNK 
Sbjct  299  YGWGWNKV  306


 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G+LY +GW +YG LG GD    LVP K+ TL+ + ++ ++ GWRHT++++  G L
Sbjct  187  AISKEGALYGWGWGRYGNLGLGDRNDRLVPEKVSTLNEEKMNIVACGWRHTISVSVIGGL  246

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD  DH  P
Sbjct  247  YTYGWSKYGQLGHGDFEDHLVP  268


 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E   VP K++   G  I  +++G  HT A++ +G L
Sbjct  135  AVTMEGEVQSWGRNQNGQLGLGTTEDSPVPQKIKAFQGISIKMVAAGAEHTAAISKEGAL  194

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  195  YGWGWGRYGNLGLGDRNDRLVP  216


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  W
Sbjct  86   SNAEVYSWGWGDFGRLGHGNSSDLFTPQPIKALHGLRIKQIACGDSHCLAVTMEGEVQSW  145

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D   P
Sbjct  146  GRNQNGQLGLGTTEDSPVP  164


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQLYGWGWN  199
            + ++G  + GQLGHGD E  L P +L  L G  I  I+ G  HT+A + ++ ++Y WGW 
Sbjct  37   ICSWGRGEDGQLGHGDAEDRLSPTRLSALDGHDIISITCGADHTIAYSLSNAEVYSWGWG  96

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  97   DFGRLGHGNSSDLFTP  112



>ref|XP_002959204.1| hypothetical protein VOLCADRAFT_70529 [Volvox carteri f. nagariensis]
 gb|EFJ39741.1| hypothetical protein VOLCADRAFT_70529 [Volvox carteri f. nagariensis]
Length=367

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            VS  G ++T+GWSKYGQLGHGD     VPC++  L    IS ++ GWRHTMA  + G LY
Sbjct  237  VSEDGRVFTFGWSKYGQLGHGDHTDRTVPCQVAALRHTRISSVAGGWRHTMAADSSGNLY  296

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
            GWGWNKFGQ+G+GD+ D  SP
Sbjct  297  GWGWNKFGQLGLGDSSDRPSP  317


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLE-TLHGDFISPISSGWRHTMALTTDGQ  178
            +  SSG+LY +GW+K+GQLG GD      P  +   L G  +S ++ GWRHT+A+T  G+
Sbjct  288  AADSSGNLYGWGWNKFGQLGLGDSSDRPSPVLVGGALAGQRVSLVTCGWRHTVAVTEGGR  347

Query  179  LYGWGWNKFGQVGVGDNVD  235
            +Y WG    GQ+G G   D
Sbjct  348  VYSWGRGVNGQLGHGAEQD  366


 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S G +Y++GW  +G+LGHGD     VP  +E   G  +  ++ G  HT+ +  +G+L+ +
Sbjct  83   SRGQVYSWGWGDFGRLGHGDCNDVFVPRPIEFFSGRPVHRVACGDTHTLVVAGEGELFTF  142

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G N+ GQ+G+G   D  SP
Sbjct  143  GRNQNGQLGLGHTNDCLSP  161


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+  G L+T+G ++ GQLG G     L P  +  L G+ +  ++ G  H++A T  G ++
Sbjct  133  VAGEGELFTFGRNQNGQLGLGHTNDCLSPQLVVALQGERVRSVACGSEHSLAATESGTVF  192

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGW ++G +G G++ D   P
Sbjct  193  SWGWGRYGNLGDGESQDRYLP  213


 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQ  178
            ++ S G + ++G  + GQLGHG  +  L P  + TL    I  +  G  +T+A+  + GQ
Sbjct  27   AILSCGIVTSWGRGEDGQLGHGQADECLAPKAISTLTDAGIESVVCGAEYTIAVAPSRGQ  86

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G GD  D   P
Sbjct  87   VYSWGWGDFGRLGHGDCNDVFVP  109



>emb|CDY39843.1| BnaC02g42750D [Brassica napus]
Length=404

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 62/110 (56%), Gaps = 28/110 (25%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGD----------------------------FEYHLVPCK  97
            +V+  G LY +GW +YG  G GD                               HLVP K
Sbjct  174  AVTEDGDLYGWGWGRYGNFGLGDRNDRLVPERVTSASGEKMSMVACGWRHTISDHLVPHK  233

Query  98   LETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            LE L    IS IS GWRHTMALT+DG+LYGWGWNKFGQVGVG+NVD CSP
Sbjct  234  LEALGNSVISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVGNNVDQCSP  283


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  122  AVTMEGEVQSWGRNQNGQLGLGNTEDSLVPQKIQAFEGVRIKMVAAGAEHTAAVTEDGDL  181

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G  G+GD  D   P
Sbjct  182  YGWGWGRYGNFGLGDRNDRLVP  203


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++S G LY +GW+K+GQ+G G+      P ++       +  +S GWRHT+A+T    +
Sbjct  254  ALTSDGKLYGWGWNKFGQVGVGNNVDQCSPVQVRFPDDQALVQVSCGWRHTLAVTERNNV  313

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G+G+++D  SP
Sbjct  314  FAWGRGTNGQLGIGESLDRNSP  335


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N
Sbjct  76   EVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGVRIKQIACGDNHCLAVTMEGEVQSWGRN  135

Query  200  KFGQVGVGDNVDHCSP  247
            + GQ+G+G+  D   P
Sbjct  136  QNGQLGLGNTEDSLVP  151


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWN  199
            + ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+  +    ++Y WGW 
Sbjct  24   VCSWGRGEDGQLGHGDAEDRSSPTQLSALDEHQIVSVTCGADHTVTYSQSRLEVYSWGWG  83

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G++ D  +P
Sbjct  84   DFGRLGHGNSSDLFTP  99



>ref|XP_001702277.1| hypothetical protein CHLREDRAFT_122886 [Chlamydomonas reinhardtii]
 gb|EDO97078.1| predicted protein [Chlamydomonas reinhardtii]
Length=376

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+  G ++T+GWSKYGQLGHGD   H  PC +  L    +S ++ GWRHTMA  ++G LY
Sbjct  235  VTDEGRVFTFGWSKYGQLGHGDHVDHTRPCLVAGLQHCRVSTVAGGWRHTMAADSEGNLY  294

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGWNKFGQ+G+GD+ D  +P
Sbjct  295  AWGWNKFGQLGLGDSEDRAAP  315


 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + + +G+++++GW +YG LG GD +    P ++  L G  ++ +  GWRH+  +T +G++
Sbjct  182  AATEAGTVFSWGWGRYGNLGDGDSQDRYTPTRVVGLDGVTVTSVVCGWRHSAVVTDEGRV  241

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + +GW+K+GQ+G GD+VDH  P
Sbjct  242  FTFGWSKYGQLGHGDHVDHTRP  263


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   GSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGW  196
            G+LYT+G ++ GQLG G     L P  +  L G+ +S ++ G  H++A T  G ++ WGW
Sbjct  135  GALYTFGRNQNGQLGLGHTNDCLSPQLVTALQGERVSSVACGSEHSLAATEAGTVFSWGW  194

Query  197  NKFGQVGVGDNVDHCSP  247
             ++G +G GD+ D  +P
Sbjct  195  GRYGNLGDGDSQDRYTP  211


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTT-DGQL  181
             SS G +Y++GW  +G+LGHG+     VP  +    G  ++ ++ G  HT+ +T  DG L
Sbjct  78   ASSRGQIYSWGWGDFGRLGHGECGDVFVPRPIAFFSGRPVARVACGDTHTLVVTQGDGAL  137

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +G N+ GQ+G+G   D  SP
Sbjct  138  YTFGRNQNGQLGLGHTNDCLSP  159


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 12/90 (13%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHG------------DFISPISSGW  145
            +  S G+LY +GW+K+GQLG GD E    P  +                   ++ ++ GW
Sbjct  286  AADSEGNLYAWGWNKFGQLGLGDSEDRAAPTPVAGFGLAGGGVEAGAATPRRVALLACGW  345

Query  146  RHTMALTTDGQLYGWGWNKFGQVGVGDNVD  235
            RHT+A+T  G++Y WG    GQ+G G   D
Sbjct  346  RHTVAVTEAGEVYSWGRGVNGQLGHGAEQD  375



>ref|XP_005647780.1| UVB-resistance 8 [Coccomyxa subellipsoidea C-169]
 gb|EIE23236.1| UVB-resistance 8 [Coccomyxa subellipsoidea C-169]
Length=434

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +   +G++YT+GWSKYGQLGHGD    LVP  +E+L    I  I+ GWRHT A    G+L
Sbjct  237  AADETGAVYTFGWSKYGQLGHGDCIDQLVPKAVESLKDSRIVLIAGGWRHTSAADDSGKL  296

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WGWNKFGQ+G+G N D  +P
Sbjct  297  YSWGWNKFGQLGIGSNTDSNAP  318


 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            + +S+G ++ +GW +YG LG G  E   +P ++  L G  ++ ++ GWRH++A    G +
Sbjct  185  AATSAGDVFAWGWGRYGNLGVGPPEDRHLPSQVHGLEGVKVTSVACGWRHSIAADETGAV  244

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW+K+GQ+G GD +D   P
Sbjct  245  YTFGWSKYGQLGHGDCIDQLVP  266


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G L+++G ++ GQLG G     ++P  +E+L G  ++ I+ G  H++A T+ G +
Sbjct  133  AVTDTGELFSFGRNQNGQLGLGTTSDAILPQPVESLRGQEVTSIACGGEHSLAATSAGDV  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WGW ++G +GVG   D   P
Sbjct  193  FAWGWGRYGNLGVGPPEDRHLP  214


 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHGD     +P  +  L G  I  ++ G  HT+A+T  G+L+ +G N+
Sbjct  88   VYSWGWGDFGRLGHGDCNDVFIPQPIRALAGRNIVKVACGDTHTLAVTDTGELFSFGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  148  NGQLGLGTTSDAILP  162


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +   SG LY++GW+K+GQLG G       P  ++ L+   +  +S GWRHT A+T  G +
Sbjct  289  AADDSGKLYSWGWNKFGQLGIGSNTDSNAPVPVQGLNTSPVKLLSCGWRHTFAVTEAGDV  348

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G  +  D  +P
Sbjct  349  FSWGRGVNGQLGHNEPKDTNAP  370


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTT-DGQLYG  187
            S+G   ++G  + GQLGHGD E    P  +  L     S + SG  +++AL+    ++Y 
Sbjct  31   SNGIALSWGRGEDGQLGHGDAEERKKPRAIFHLMQASCSAVCSGAEYSVALSQPRNEVYS  90

Query  188  WGWNKFGQVGVGDNVD  235
            WGW  FG++G GD  D
Sbjct  91   WGWGDFGRLGHGDCND  106



>ref|NP_001288968.1| ultraviolet-B receptor UVR8 [Brassica rapa]
 gb|ABV89648.1| UVB-resistance 8 [Brassica rapa]
Length=432

 Score = 79.0 bits (193),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  FISPISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            F S IS GWRHTM LT+DG+LYGWGWNKFGQVGVG+N+D CSP
Sbjct  269  FFSQISGGWRHTMPLTSDGKLYGWGWNKFGQVGVGNNLDQCSP  311


 Score = 40.0 bits (92),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +1

Query  1    ICFFLWFFIYLWLEQIWPTWTRGF*IPPCSL  93
            I F LW  IYLW+EQIWPT T      PC L
Sbjct  229  ISFLLWSIIYLWMEQIWPTRTWRLGGSPCFL  259


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T DG++  WG N+
Sbjct  85   VYSWGWGDFGRLGHGNSSDLFTPLPIKALHGVMIKQIACGDSHCLAVTMDGEVQSWGRNQ  144

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G+  D   P
Sbjct  145  NGQLGLGNTEDSLVP  159


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            ++S G LY +GW+K+GQ+G G+      P ++       +  +S GWRHT+A+T    ++
Sbjct  283  LTSDGKLYGWGWNKFGQVGVGNNLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVF  342

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG    GQ+G+G+++D  SP
Sbjct  343  AWGRGTNGQLGIGESLDRNSP  363


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G+ E  LVP K++   G  I  +++G  HT A+T DG L
Sbjct  130  AVTMDGEVQSWGRNQNGQLGLGNTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDL  189

Query  182  YGWGWNKFGQVGVGDNVDH  238
            YGW   K  + G+ D  D 
Sbjct  190  YGWD-GKIWKFGISDRNDR  207


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QLYGWGWNKF  205
            ++G  + GQLGHGD E    P +L  L    I  ++ G  HT+A +    ++Y WGW  F
Sbjct  34   SWGRGEDGQLGHGDAEDRSSPTQLSALDEHQIVSVTCGADHTVAYSQSRLEVYSWGWGDF  93

Query  206  GQVGVGDNVDHCSP  247
            G++G G++ D  +P
Sbjct  94   GRLGHGNSSDLFTP  107



>ref|XP_009769437.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 59/109 (54%), Gaps = 28/109 (26%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISP------------------  130
            VSSSG+LYTYGWSKYGQLGHGDFE HL P K++ LH  F S                   
Sbjct  237  VSSSGALYTYGWSKYGQLGHGDFEDHLFPHKVQALHDSFTSQFGQVGVGDNVDHCSPVQV  296

Query  131  ----------ISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCSP  247
                      IS GWRHT+A+T    ++ WG    GQ+G G++VD   P
Sbjct  297  KFPHDQKVILISCGWRHTLAVTERQNVFSWGRGTNGQLGHGESVDRNVP  345


 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 58/110 (53%), Gaps = 28/110 (25%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G LY +GW +YG LG GD    LVP K+    G+ +  ++ GWRHT+ +++ G L
Sbjct  184  AVTEDGELYGWGWGRYGNLGLGDRNDRLVPVKVSATVGEKMFMVACGWRHTICVSSSGAL  243

Query  182  YGWGWNK----------------------------FGQVGVGDNVDHCSP  247
            Y +GW+K                            FGQVGVGDNVDHCSP
Sbjct  244  YTYGWSKYGQLGHGDFEDHLFPHKVQALHDSFTSQFGQVGVGDNVDHCSP  293


 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G + ++G ++ GQLG G  E  LVP K+E   G  +  +++G  HT A+T DG+L
Sbjct  132  AVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIEAFKGIPVKMVAAGAEHTAAVTEDGEL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  192  YGWGWGRYGNLGLGDRNDRLVP  213


 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ LHG  I  I+ G  H +A+T +G++  WG N+
Sbjct  87   VYSWGWGDFGRLGHGNSSDLFTPQPIKALHGICIKQIACGDSHCLAVTMEGEVQSWGRNQ  146

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  147  NGQLGLGTTEDSLVP  161


 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTD-GQLYG  187
            S+  + ++G  + GQLG GD E    P ++  L    I  ++ G  H  A +    Q+Y 
Sbjct  30   SANIVVSWGRGEDGQLGLGDAEDRFSPTQVSALDEQQIVSVTCGADHATAYSEALKQVYS  89

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WGW  FG++G G++ D  +P
Sbjct  90   WGWGDFGRLGHGNSSDLFTP  109



>gb|KIY98506.1| putative E3 ubiquitin-protein ligase HERC1 [Monoraphidium neglectum]
Length=421

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +  +YT+GW ++GQ+GHGD E  L   ++  L    I  ++ GWRHT AL  DG+ 
Sbjct  250  AVTDNHRIYTFGWGRFGQIGHGDNEDRLTAAEVTPLAHVAIKRVAGGWRHTAALDADGRC  309

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WGW KFGQ+G+GD+ D  +P
Sbjct  310  YTWGWGKFGQLGLGDDRDRNAP  331


 Score = 75.5 bits (184),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            +S G +Y++GW KYG LG G  E   VP   + L G  ++ ++ GWRH++A+T + ++Y 
Sbjct  200  TSGGQVYSFGWGKYGCLGDGSREDRHVPTLTKGLEGVHVAQVACGWRHSIAVTDNHRIYT  259

Query  188  WGWNKFGQVGVGDNVD  235
            +GW +FGQ+G GDN D
Sbjct  260  FGWGRFGQIGHGDNED  275


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDG-QL  181
            V   G + ++G  + GQLGHGD E   +P  ++ L G  IS +S G  +++A++ +  Q+
Sbjct  42   VVDCGVVVSFGKGEDGQLGHGDAESCAMPQPVKALRGKAISSVSCGAEYSIAVSHETRQV  101

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WGW  FG++G G ++D  SP
Sbjct  102  YSWGWGDFGRLGHGHSLDCFSP  123


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            + +G LY +G ++ GQLG G  E  L P +++ L    +  +S+G  H++  T+ GQ+Y 
Sbjct  148  TEAGELYAFGRNQNGQLGVGSTEDVLAPRRVDALADVNVISVSAGAEHSVVATSGGQVYS  207

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            +GW K+G +G G   D   P
Sbjct  208  FGWGKYGCLGDGSREDRHVP  227


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG       P  +  L G  +  ++ G  HT+  T  G+LY +G N+
Sbjct  101  VYSWGWGDFGRLGHGHSLDCFSPQPITALSGVAVRQVACGDAHTLVATEAGELYAFGRNQ  160

Query  203  FGQVGVGDNVDHCSP  247
             GQ+GVG   D  +P
Sbjct  161  NGQLGVGSTEDVLAP  175


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++ + G  YT+GW K+GQLG GD      P  + TL G     ++ GWRHT+  T DG +
Sbjct  302  ALDADGRCYTWGWGKFGQLGLGDDRDRNAPTLVATLDGRHAVLVACGWRHTVVTTADGAI  361



>ref|XP_003706150.1| PREDICTED: uncharacterized protein LOC100881287 [Megachile rotundata]
Length=1884

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             ++++ G ++T+GW  +GQLGHG+ +  +VP  + +L G  I  IS+G  HT+AL+T+G +
Sbjct  938   ALTADGRVFTWGWGVHGQLGHGNTDKKIVPTLITSLLGTVIRYISAGHAHTLALSTEGIV  997

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N FGQ+GVG NV    P
Sbjct  998   YAFGCNIFGQLGVGSNVKSSVP  1019


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G S++GQLG G       P  +  L  + I    +G  H++ALT DG++
Sbjct  887  AVTNNG-VYAWGSSRFGQLGLGKILQCSTPELITYLAQEVIIDAVAGQYHSVALTADGRV  945

Query  182  YGWGWNKFGQVGVGD  226
            + WGW   GQ+G G+
Sbjct  946  FTWGWGVHGQLGHGN  960



>ref|XP_008208309.1| PREDICTED: uncharacterized protein LOC100677930 [Nasonia vitripennis]
Length=1769

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++++ G L+T+GW  +GQLGHG+ E    PC +  L G  +  +S+G+ HT+AL+ DG +
Sbjct  869  AITADGRLFTWGWGVHGQLGHGNTEAKRQPCLVTALLGVVVRHVSAGYAHTVALSADGLV  928

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +G N FGQ+GVG++    SP
Sbjct  929  YAFGCNLFGQLGVGNDGKCTSP  950


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G +KYGQLG G+      P  +  L  + I    +G  H+ A+T DG+L
Sbjct  818  AVTNNG-VYVWGGNKYGQLGLGEVRECPNPELITALAQEIIVEAVAGQHHSAAITADGRL  876

Query  182  YGWGWNKFGQVGVGD  226
            + WGW   GQ+G G+
Sbjct  877  FTWGWGVHGQLGHGN  891



>gb|KEH22986.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=390

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+++G LY +G +++GQLG G+ +    P  L+T   +  S +S G RH+  LT DG L+
Sbjct  282  VTANGQLYAFGGNQFGQLGTGNDQTETSPKLLDTFENNLSSIVSCGARHSALLTDDGHLF  341

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGWNK+GQ+G+GD+VD   P
Sbjct  342  TWGWNKYGQLGLGDSVDRNIP  362


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            ++ +G+L T+GW  +GQ G G+    L P  + +L G  +  I++G  HT+ +T +GQLY
Sbjct  230  ITDTGALLTFGWGLHGQCGQGNNADQLRPTLVPSLLGTRVKQIAAGLWHTLCVTANGQLY  289

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G++    SP
Sbjct  290  AFGGNQFGQLGTGNDQTETSP  310



>ref|XP_005847046.1| hypothetical protein CHLNCDRAFT_134694 [Chlorella variabilis]
 gb|EFN54944.1| hypothetical protein CHLNCDRAFT_134694 [Chlorella variabilis]
Length=434

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V   G++YT+GW  Y QL  GD + H VP ++E +    ++ ++ GWRHTMA  + G+L
Sbjct  233  AVDEGGAMYTWGWGAYAQLMQGDRKDHYVPKRVEAVQ--QVATVAGGWRHTMAADSQGRL  290

Query  182  YGWGWNKFGQVGVGDNVD  235
            +  GWNKFGQ GVG N D
Sbjct  291  FASGWNKFGQCGVGHNED  308


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+S G +Y +GW +YG +G G+ +   +P   + L G  ++ ++ GWRH++A+   G +Y
Sbjct  182  VTSEGEVYCWGWGRYGNIGDGESQDRHLPTLAKGLEGVKVAQVNCGWRHSIAVDEGGAMY  241

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGW  + Q+  GD  DH  P
Sbjct  242  TWGWGAYAQLMQGDRKDHYVP  262


 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LG GD +   +PC L  L G  ++ ++ G  HT+  T +GQL+ +G N+
Sbjct  84   VYSWGWGDFGRLGTGDVKDVFIPCPLPALAGRRVASVACGDTHTLVATAEGQLFAFGRNQ  143

Query  203  FGQVGVGDNVDHCSP  247
             GQ G+G   D   P
Sbjct  144  NGQCGLGSIQDCLEP  158


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +  S G L+  GW+K+GQ G G  E  +   ++E L G+ +  + SGW+HTMA+T  G+ 
Sbjct  283  AADSQGRLFASGWNKFGQCGVGHNEDVVRVQQVEALAGERVVQVKSGWKHTMAVTHTGKF  342

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG N  GQ+G     D  SP
Sbjct  343  FSWGRNVNGQLGHSGMQDSNSP  364


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
             ++ G L+ +G ++ GQ G G  +  L P  +  L G  +  ++ G  H+M +T++G++Y
Sbjct  130  ATAEGQLFAFGRNQNGQCGLGSIQDCLEPQLVTALQGKEVVAVACGAEHSMCVTSEGEVY  189

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGW ++G +G G++ D   P
Sbjct  190  CWGWGRYGNIGDGESQDRHLP  210


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTT-DGQ  178
            S  S   + ++G  + GQLGHGD E    P  + +L     + +  G  ++MA+   D Q
Sbjct  24   STPSGSMVLSWGRGEDGQLGHGDAEDRQEPQAVFSLLHRGATSVHCGAEYSMAVAGGDKQ  83

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +Y WGW  FG++G GD  D   P
Sbjct  84   VYSWGWGDFGRLGTGDVKDVFIP  106



>ref|XP_011067663.1| PREDICTED: uncharacterized protein LOC105154086 [Acromyrmex echinatior]
Length=1877

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             ++++ G ++T+GW  +GQLGHG+ +   +P  ++ L G  +  IS+G+ HT+AL+ DG L
Sbjct  930   ALTADGRIFTWGWGVHGQLGHGNTDEKAIPSLVKALLGIVVCCISAGYAHTLALSIDGVL  989

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N  GQ+G GDN+    P
Sbjct  990   YAFGCNILGQLGTGDNIKSSVP  1011


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G S++GQLG G       P  + +L  + I    +G  H++ALT DG++
Sbjct  879  AVTNNG-IYAWGASQFGQLGLGKVLQCSSPELVTSLAQEIIVDAVAGQYHSVALTADGRI  937

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WGW   GQ+G G+  +   P
Sbjct  938  FTWGWGVHGQLGHGNTDEKAIP  959



>ref|XP_003698590.1| PREDICTED: uncharacterized protein LOC100869963 [Apis florea]
Length=1858

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             +++S G ++T+GW  +GQLGHG+ +  + P  + +L G  I  I++G  HT+AL+T+G +
Sbjct  936   ALTSDGRVFTWGWGVHGQLGHGNTDKKMTPTLVTSLLGIVIRFITAGHAHTLALSTEGII  995

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N FGQ+GVG+N+    P
Sbjct  996   YAFGCNIFGQLGVGNNIKSSVP  1017


 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G S++GQLG G       P  + +L  + I    +G  H++ALT+DG++
Sbjct  885  AVTNNG-VYAWGSSQFGQLGLGKILQCSTPELITSLAQEVIIDAVAGQYHSVALTSDGRV  943

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WGW   GQ+G G+     +P
Sbjct  944  FTWGWGVHGQLGHGNTDKKMTP  965



>gb|EGI69856.1| X-linked retinitis pigmentosa GTPase regulator-like protein [Acromyrmex 
echinatior]
Length=2956

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             ++++ G ++T+GW  +GQLGHG+ +   +P  ++ L G  +  IS+G+ HT+AL+ DG L
Sbjct  2010  ALTADGRIFTWGWGVHGQLGHGNTDEKAIPSLVKALLGIVVCCISAGYAHTLALSIDGVL  2069

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N  GQ+G GDN+    P
Sbjct  2070  YAFGCNILGQLGTGDNIKSSVP  2091


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             +V+++G +Y +G S++GQLG G       P  + +L  + I    +G  H++ALT DG++
Sbjct  1959  AVTNNG-IYAWGASQFGQLGLGKVLQCSSPELVTSLAQEIIVDAVAGQYHSVALTADGRI  2017

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             + WGW   GQ+G G+  +   P
Sbjct  2018  FTWGWGVHGQLGHGNTDEKAIP  2039



>gb|KEH22985.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=482

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+++G LY +G +++GQLG G+ +    P  L+T   +  S +S G RH+  LT DG L+
Sbjct  374  VTANGQLYAFGGNQFGQLGTGNDQTETSPKLLDTFENNLSSIVSCGARHSALLTDDGHLF  433

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGWNK+GQ+G+GD+VD   P
Sbjct  434  TWGWNKYGQLGLGDSVDRNIP  454


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            ++ +G+L T+GW  +GQ G G+    L P  + +L G  +  I++G  HT+ +T +GQLY
Sbjct  322  ITDTGALLTFGWGLHGQCGQGNNADQLRPTLVPSLLGTRVKQIAAGLWHTLCVTANGQLY  381

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G++    SP
Sbjct  382  AFGGNQFGQLGTGNDQTETSP  402



>ref|XP_003486520.1| PREDICTED: hypothetical protein LOC100745121 [Bombus impatiens]
Length=1865

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             ++++ G ++T+GW  +GQLGHG+ +  + P  + +L G  I  I++G  HT+AL+T+G +
Sbjct  936   ALTADGRVFTWGWGVHGQLGHGNTDKKMTPTLVTSLLGTVIRYITAGHAHTLALSTEGIV  995

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N FGQ+GVG NV    P
Sbjct  996   YAFGCNIFGQLGVGSNVKSSVP  1017


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G S++GQLG G       P  + +L  + I    +G  H++ALT DG++
Sbjct  885  AVTNNG-VYAWGSSQFGQLGLGKVLQCSTPELITSLAQEVIIDAVAGQYHSVALTADGRV  943

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WGW   GQ+G G+     +P
Sbjct  944  FTWGWGVHGQLGHGNTDKKMTP  965



>ref|XP_011170369.1| PREDICTED: uncharacterized protein LOC105203292 [Solenopsis invicta]
Length=1887

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             ++++ G ++T+GW  +GQLGHG+ +    P  ++ L G  +  IS+G+ HT+AL+ DG +
Sbjct  931   ALTADGRIFTWGWGVHGQLGHGNTDEKTTPSLVKALLGVVVCHISAGYAHTLALSVDGVV  990

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N  GQ+G GDNV    P
Sbjct  991   YAFGCNVLGQLGTGDNVKSSVP  1012


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G S++GQLG G       P  + +L  + I    +G  H++ALT DG++
Sbjct  880  AVTNNG-IYAWGASQFGQLGLGKVLQCSNPELVTSLAQESIVDAVAGQYHSVALTADGRI  938

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WGW   GQ+G G+  +  +P
Sbjct  939  FTWGWGVHGQLGHGNTDEKTTP  960



>gb|KFZ48697.1| RCC1 and BTB domain-containing protein 1 [Caprimulgus carolinensis]
Length=285

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPIQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLETL G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLETLCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_011397979.1| putative E3 ubiquitin-protein ligase HERC1 [Auxenochlorella protothecoides]
 gb|KFM25091.1| putative E3 ubiquitin-protein ligase HERC1 [Auxenochlorella protothecoides]
Length=430

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V   G LY +GW KYG LG G+   H +P  +E      I+    GWRHT A+  +G+L
Sbjct  184  AVVEGGQLYVWGWGKYGNLGLGNELDHRLPVHVEVPGAPTITTACCGWRHTAAVDAEGRL  243

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WGWNK+GQ+G+G++ +   P
Sbjct  244  YTWGWNKYGQLGLGNHENQSRP  265


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT-TDGQ  178
            +V + G LYT+GW+KYGQLG G+ E    P  + +L    +  +S GWRHT+ +     +
Sbjct  236  AVDAEGRLYTWGWNKYGQLGLGNHENQSRPSLVSSLSTSAVHSVSGGWRHTLVIAGPQHE  295

Query  179  LYGWGWNKFGQVGVGDNVDHCS  244
            ++ WGWN+FGQ+G+ D +  CS
Sbjct  296  VFAWGWNRFGQLGL-DGIQDCS  316


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G++Y +G ++ GQLG       L P ++  L G  +  +S G  H++A+   GQL
Sbjct  132  ALTVDGAVYAFGRNQAGQLGIPSQYDALEPTRVAALEGKHVRQVSCGGEHSLAVVEGGQL  191

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WGW K+G +G+G+ +DH  P
Sbjct  192  YVWGWGKYGNLGLGNELDHRLP  213


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            S SS    Y++GW  +G+LGH   +    P  +  L G  ++ ++ G  HT+ALT DG +
Sbjct  80   SSSSRRETYSWGWGDFGRLGHAQADDVWTPKPIRGLSGLTLAQVACGDMHTLALTVDGAV  139

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +G N+ GQ+G+    D   P
Sbjct  140  YAFGRNQAGQLGIPSQYDALEP  161


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLE-TLHGDFISPISSGWRHTMALTTDGQLYGWGW  196
             ++ +GW+++GQLG    +    PC++   L G  +  + +GWRH++A+T +G++Y WG 
Sbjct  295  EVFAWGWNRFGQLGLDGIQDCSRPCRIRGELEGCSVRSVQAGWRHSIAVTREGEVYVWGR  354

Query  197  NKFGQVGVG  223
               G +G+G
Sbjct  355  GASGVLGLG  363



>dbj|GAM25816.1| hypothetical protein SAMD00019534_089910 [Acytostelium subglobosum 
LB1]
Length=1618

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            + S+G+LYT+G   +G+LGHGD E  L P +++ L+G FI+ +S G  HT+ALT  GQL+
Sbjct  255  IDSAGTLYTWGRGDHGRLGHGDTENVLAPKRVDALYGHFITSVSLGGGHTLALTKSGQLF  314

Query  185  GWGWNKFGQVGVG  223
             WG  + GQ+G G
Sbjct  315  TWGRGESGQLGHG  327


 Score = 59.3 bits (142),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFE-YHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ  178
            +++ SG L+T+G  + GQLGHG F+   + P +++ +    ++ I++G  H++    DG 
Sbjct  306  ALTKSGQLFTWGRGESGQLGHGSFQTQQMSPKQVQAMTDQTVTYITAGGYHSIVQCVDGS  365

Query  179  LYGWGWNKFGQVGVGDN  229
            +Y WG   +G +G+G++
Sbjct  366  VYAWGMGDYGCLGIGNS  382


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
            ++SG +YT+G  + G+LGHG+ +    P  +++L    I  +  G + T+ALT DG L  
Sbjct  150  TNSGLIYTWGDGQTGRLGHGNEDSLAHPMPIDSLRQYKIKAVCCGGKGTVALTHDGVLLT  209

Query  188  WGWNKFGQVGVGDNVDHCS  244
            WG N FGQ+G   + DH +
Sbjct  210  WGNNDFGQLGRRTDSDHTA  228



>ref|XP_010173413.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like, partial 
[Caprimulgus carolinensis]
Length=306

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPIQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLETL G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLETLCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_006609775.1| PREDICTED: uncharacterized protein LOC102675157 [Apis dorsata]
Length=1857

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             +++S G ++T+GW  +GQLGHG+ +  + P  + +L G  I  I++G  HT+AL+ +G +
Sbjct  936   ALTSDGRVFTWGWGVHGQLGHGNTDKKMTPTLVTSLLGIVIRFITAGHAHTLALSIEGII  995

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N FGQ+GVG+N+    P
Sbjct  996   YAFGCNIFGQLGVGNNIKSSVP  1017


 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G S++GQLG G       P  + +L  + I    +G  H++ALT+DG++
Sbjct  885  AVTNNG-VYAWGSSQFGQLGLGKILQCSTPELITSLAQEVIVDAVAGQYHSVALTSDGRV  943

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WGW   GQ+G G+     +P
Sbjct  944  FTWGWGVHGQLGHGNTDKKMTP  965



>gb|KFQ25495.1| RCC1 and BTB domain-containing protein 1 [Merops nubicus]
Length=285

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  +  I+ G+ HT+ALT +G L
Sbjct  195  AVINNGEVYGWGYNGTGQLGLGNNGNQLTPCRVAALHGVCVLQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVINNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGTGQLGLGNNGNQLTP  224


 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_011169147.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like [Solenopsis 
invicta]
Length=531

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++  +G +Y +G++  GQLG G++   + PC++ TL G  I  ++ G+ HT+ALT +GQL
Sbjct  195  ALLENGEVYGWGYNGVGQLGIGNYVNQMTPCRIGTLLGTVIVKVACGYVHTLALTDEGQL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G+ +  + C+P
Sbjct  255  YVWGGNSYGQLGISNKTNACNP  276


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            +++  G +Y +G +  GQ G        VP ++ + L G  ++ I+ G   T+AL  +G+
Sbjct  142  ALNEDGEIYAWGQNNCGQAGSSITTNQGVPRQVNSNLAGKKVAQIACGQTSTVALLENGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+ V+  +P
Sbjct  202  VYGWGYNGVGQLGIGNYVNQMTP  224


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G +Y++G + Y +LG+G     L P ++ +L    I  I+ G  H++AL  DG++
Sbjct  90   ALTKEGEVYSWGHNGYCELGNGTCNQGLYPTQVNSLGIKRIVDIACGSHHSVALNEDGEI  149

Query  182  YGWGWNKFGQVG  217
            Y WG N  GQ G
Sbjct  150  YAWGQNNCGQAG  161



>ref|XP_008933926.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like, partial 
[Merops nubicus]
Length=295

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  +  I+ G+ HT+ALT +G L
Sbjct  201  AVINNGEVYGWGYNGTGQLGLGNNGNQLTPCRVAALHGVCVLQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVINNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGTGQLGLGNNGNQLTP  230


 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>gb|KFP47281.1| RCC1 and BTB domain-containing protein 1 [Cathartes aura]
Length=285

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVGALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|EFZ12117.1| hypothetical protein SINV_05294 [Solenopsis invicta]
Length=585

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++  +G +Y +G++  GQLG G++   + PC++ TL G  I  ++ G+ HT+ALT +GQL
Sbjct  249  ALLENGEVYGWGYNGVGQLGIGNYVNQMTPCRIGTLLGTVIVKVACGYVHTLALTDEGQL  308

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G+ +  + C+P
Sbjct  309  YVWGGNSYGQLGISNKTNACNP  330


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            +++  G +Y +G +  GQ G        VP ++ + L G  ++ I+ G   T+AL  +G+
Sbjct  196  ALNEDGEIYAWGQNNCGQAGSSITTNQGVPRQVNSNLAGKKVAQIACGQTSTVALLENGE  255

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+ V+  +P
Sbjct  256  VYGWGYNGVGQLGIGNYVNQMTP  278


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
             +Y++G + Y +LG+G     L P ++ +L    I  I+ G  H++AL  DG++Y WG N
Sbjct  150  KVYSWGHNGYCELGNGTCNQGLYPTQVNSLGIKRIVDIACGSHHSVALNEDGEIYAWGQN  209

Query  200  KFGQVG  217
              GQ G
Sbjct  210  NCGQAG  215



>gb|KFO04430.1| RCC1 and BTB domain-containing protein 1, partial [Balearica 
regulorum gibbericeps]
Length=348

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGISPVQVCTNLLLKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCNNCLGTGDNQSTIVPKKLEALCGKKISNLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      SP
Sbjct  97   YAWGHNGYSQLGNGTTNQGISP  118



>gb|KFV01705.1| RCC1 and BTB domain-containing protein 1, partial [Tauraco erythrolophus]
Length=348

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQICTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|KFQ55655.1| RCC1 and BTB domain-containing protein 1, partial [Pelecanus 
crispus]
Length=348

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_008865570.1| hypothetical protein H310_03477 [Aphanomyces invadans]
 gb|ETW05793.1| hypothetical protein H310_03477 [Aphanomyces invadans]
Length=1299

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  GS+Y++G    G+LGHGD +   +P K++ LHG  I  + +G  HT A+T+ G++
Sbjct  567  AVTGDGSVYSWGSGSNGKLGHGDEDNRDIPTKIQGLHGKVIQDVKAGCEHTTAITSTGEM  626

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG +  G++G GDNV   +P
Sbjct  627  YTWGHSDSGRLGHGDNVTRKTP  648


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 6/68 (9%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGD----FISPISSGWRHTMALTT  169
            ++++ G LYT+G +  GQ GHG     L P   E L+ D     ++ ++ GW HT+  TT
Sbjct  453  AITTQGRLYTWGKNNQGQCGHGHTNDQLTPA--EVLYFDEMELKVATVAGGWEHTLICTT  510

Query  170  DGQLYGWG  193
             GQ +  G
Sbjct  511  GGQAFACG  518



>emb|CDW87540.1| kinesin motor domain containing protein [Stylonychia lemnae]
Length=1347

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +2

Query  5     VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
             V+S G + ++G   +GQLGHGD E + +P  +ETL    I  ++ GW+HTM+L++ G+++
Sbjct  954   VTSDGMILSWGRGIFGQLGHGDTENYSLPTPIETLVKIQIIQVACGWQHTMSLSSQGRVF  1013

Query  185   GWGWNKFGQVGVGDNVDHCSP  247
              WG+ + GQ+G GD  D+  P
Sbjct  1014  SWGYGEDGQLGHGDTNDYLLP  1034


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGD--FISPISSGWRHTMALT--T  169
             S+SS G ++++G+ + GQLGHGD   +L+P +L+    +   +S I+ G  H+  +T  +
Sbjct  1005  SLSSQGRVFSWGYGEDGQLGHGDTNDYLLPKELDYFKKNQLRVSFIACGHSHSGCITDSS  1064

Query  170   DGQLYGWGWNKFGQVGVGDNVDHCSP  247
               QLY WG N   ++ + DN +   P
Sbjct  1065  SAQLYMWGCNPDSRLMIDDNENQLLP  1090


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +2

Query  11   SSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGW  190
            S+  +Y +G  K G+ G+G      +P ++ + +    S +S G+ H+  +T+DG +  W
Sbjct  906  SNCKIYVWGSGKDGRCGNGKESSEKLPNQINSQYK--FSQLSCGYHHSAGVTSDGMILSW  963

Query  191  GWNKFGQVGVGDNVDHCSP  247
            G   FGQ+G GD  ++  P
Sbjct  964  GRGIFGQLGHGDTENYSLP  982


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 20/95 (21%)
 Frame = +2

Query  5     VSSSGSLYTYGWSKYGQLGHGDFEYHLV--------------------PCKLETLHGDFI  124
             ++    +Y +G   +G+LG G    H +                    P  + TL  + +
Sbjct  1216  LNEGNQIYAFGKLSHGRLGLGSLPKHSLKSGGLNPDNSQSEGVDHVSEPTIIHTLINEKV  1275

Query  125   SPISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDN  229
               IS+G RH   +T  G+LY WG+N + Q+G+GD+
Sbjct  1276  LQISAGCRHAACITDQGKLYVWGFNFYEQLGLGDS  1310



>ref|XP_009983470.1| PREDICTED: RCC1 and BTB domain-containing protein 1, partial 
[Tauraco erythrolophus]
Length=354

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQICTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_010298033.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like, partial 
[Balearica regulorum gibbericeps]
Length=354

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGISPVQVCTNLLLKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCNNCLGTGDNQSTIVPKKLEALCGKKISNLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      SP
Sbjct  103  YAWGHNGYSQLGNGTTNQGISP  124



>gb|EJY75989.1| Kinesin motor domain containing protein [Oxytricha trifallax]
Length=1386

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             +V+S G + ++G   +GQLGHGD E + +P  +E L    I  +S GW+H+MAL++ G++
Sbjct  980   AVTSDGMILSWGRGIFGQLGHGDTENYSLPTPIEALVKIQIIQVSCGWQHSMALSSQGRI  1039

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             + WG+ + GQ+G GD  D+  P
Sbjct  1040  FSWGYGEDGQLGHGDTNDYLLP  1061


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = +2

Query  8     SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             + S  ++ +G  K G+ G+G      +P +  T H    + +S G+ H+ A+T+DG +  
Sbjct  932   NQSYKVFVWGSGKDGRCGNGKESSEKLPNQANTSHN--FTQLSCGYHHSAAVTSDGMILS  989

Query  188   WGWNKFGQVGVGDNVDHCSP  247
             WG   FGQ+G GD  ++  P
Sbjct  990   WGRGIFGQLGHGDTENYSLP  1009


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISP--ISSGWRHTMALTTDG  175
             ++SS G ++++G+ + GQLGHGD   +L+P +++    + I+   I+ G  H+  + TDG
Sbjct  1032  ALSSQGRIFSWGYGEDGQLGHGDTNDYLLPKEIDFFRKNSINVGMIACGHSHSGCI-TDG  1090

Query  176   ---QLYGWGWNKFGQVGVGDNVDHCSP  247
                QLY WG N   ++ + +N +   P
Sbjct  1091  QSSQLYLWGCNPDCRLMIEENENQLLP  1117



>ref|XP_009489754.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like, partial 
[Pelecanus crispus]
Length=359

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>emb|CAD41017.1| OSJNBb0086G13.15 [Oryza sativa Japonica Group]
Length=256

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG G  E  L+P K+++  G  +  I++G  HT A+T DG L
Sbjct  143  AVTMAGEVQSWGRNQNGQLGLGTTEDSLLPQKIQSFEGVCVKMIAAGAEHTAAVTEDGDL  202

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  203  YGWGWGRYGNLGLGDRNDRLVP  224


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+      P  ++ L G  I  I+ G  H +A+T  G++  WG N+
Sbjct  98   VYSWGWGDFGRLGHGNSSDVFTPQPVKALQGIKIKQIACGDSHCLAVTMAGEVQSWGRNQ  157

Query  203  FGQVGVGDNVDHCSP  247
             GQ+G+G   D   P
Sbjct  158  NGQLGLGTTEDSLLP  172


 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 3/78 (4%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDF--ISPISSGWRHTMALTTD-GQLYGWG  193
            L ++G  + GQLGHGD E  LVP  L         I+ +  G  HT A + D  Q+Y WG
Sbjct  43   LCSWGRGEDGQLGHGDAEDRLVPTVLSGFDAAAPGITSVICGADHTTAYSEDEQQVYSWG  102

Query  194  WNKFGQVGVGDNVDHCSP  247
            W  FG++G G++ D  +P
Sbjct  103  WGDFGRLGHGNSSDVFTP  120



>ref|XP_007207458.1| hypothetical protein PRUPE_ppa005731mg [Prunus persica]
 gb|EMJ08657.1| hypothetical protein PRUPE_ppa005731mg [Prunus persica]
Length=446

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDGQ  178
            +S  G ++ +G +++GQLG G  E   +P  L++  L       +S G RH+  LT DGQ
Sbjct  336  ISVDGRVHAFGGNQFGQLGTGADEAETLPRPLDSPSLESKHAKVVSCGARHSAILTEDGQ  395

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            LYGWGWNK+GQ+G+GD+VD   P
Sbjct  396  LYGWGWNKYGQLGLGDSVDRNLP  418


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  65   GDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKFGQVGVGDNVDHCS  244
            GD  + L PC +    G  I+ +++G RHT+AL+  GQ++GWG+   GQ+G+G  V   S
Sbjct  180  GDDFFTLSPCLVTLGPGVRITSVAAGGRHTLALSDMGQVWGWGYGGEGQLGLGTRVKMVS  239



>ref|XP_004516428.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Cicer 
arietinum]
Length=482

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G +Y +G +++GQLG G+ +    P  L+T   +    +S G RH+  LT DG L+
Sbjct  374  VTVNGQIYAFGGNQFGQLGTGNDQPETSPKLLDTFENNLCKIVSCGARHSALLTDDGHLF  433

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGWNK+GQ+G+GD+VD   P
Sbjct  434  TWGWNKYGQLGLGDSVDRNIP  454


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            ++ +G+L T+GW  YGQ G G+    L P  + +L    +  I+ G  HT+ +T +GQ+Y
Sbjct  322  ITDTGALLTFGWGLYGQCGQGNNADQLRPTLVPSLLATRVKQIAVGLWHTLCVTVNGQIY  381

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G++    SP
Sbjct  382  AFGGNQFGQLGTGNDQPETSP  402



>ref|XP_004516429.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Cicer 
arietinum]
Length=481

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G +Y +G +++GQLG G+ +    P  L+T   +    +S G RH+  LT DG L+
Sbjct  373  VTVNGQIYAFGGNQFGQLGTGNDQPETSPKLLDTFENNLCKIVSCGARHSALLTDDGHLF  432

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WGWNK+GQ+G+GD+VD   P
Sbjct  433  TWGWNKYGQLGLGDSVDRNIP  453


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            ++ +G+L T+GW  YGQ G G+    L P  + +L    +  I+ G  HT+ +T +GQ+Y
Sbjct  321  ITDTGALLTFGWGLYGQCGQGNNADQLRPTLVPSLLATRVKQIAVGLWHTLCVTVNGQIY  380

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G++    SP
Sbjct  381  AFGGNQFGQLGTGNDQPETSP  401



>ref|XP_001600404.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like [Nasonia 
vitripennis]
Length=533

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+  G ++ +G++  GQLG G++   L PCK+  L+G  I  ++ G+ HT+AL+ +G L
Sbjct  196  AVTDVGEVFGWGYNGVGQLGIGNYVNQLSPCKVTGLNGIVIEKVACGYAHTLALSDEGAL  255

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N FGQ+G+G+  + C+P
Sbjct  256  YVWGGNGFGQLGLGNKANACTP  277


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++++ G +Y++G + Y +LG+G     L P     L+   ++ I+ G  H++ALT DG++
Sbjct  91   ALTNKGEIYSWGHNGYCELGNGSTNQGLTPTLCLNLNEKVVTAIACGSHHSVALTEDGEV  150

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N  GQV  G + +  +P
Sbjct  151  YSWGQNNCGQVSSGISSNQGAP  172


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            +++  G +Y++G +  GQ+  G       P K+ + L G  +  I+ G   +MA+T  G+
Sbjct  143  ALTEDGEVYSWGQNNCGQVSSGISSNQGAPRKVNSALTGKVVVSIACGQTSSMAVTDVGE  202

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            ++GWG+N  GQ+G+G+ V+  SP
Sbjct  203  VFGWGYNGVGQLGIGNYVNQLSP  225



>ref|XP_003288451.1| hypothetical protein DICPUDRAFT_79261 [Dictyostelium purpureum]
 gb|EGC35023.1| hypothetical protein DICPUDRAFT_79261 [Dictyostelium purpureum]
Length=1909

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G L T+G  + GQLGHGD +  + P  +++L   +I+ +  G +HT+ LT +G++
Sbjct  703  AVRANGELLTWGVGEEGQLGHGDTQNQVEPKVIQSLTSFWITQVQCGEKHTICLTKNGKV  762

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG +++GQ+G+GD   +C P
Sbjct  763  YTWGSSEYGQLGLGDTTRYCKP  784


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++S  G +YT+G  +  +LGHG+ +    P  +E L    I  IS G RHT  LT  G++
Sbjct  855  AISECGDVYTWGTGQ--ELGHGNNQTESTPKLVEALRNQSIRQISCGGRHTAFLTDSGRI  912

Query  182  YGWGWNKFGQVG  217
            +  G + FGQ+G
Sbjct  913  FTSGKDSFGQLG  924



>ref|XP_009567013.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Cuculus 
canorus]
Length=537

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNANQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNANQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPIQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>gb|KFQ00070.1| RCC1 and BTB domain-containing protein 1 [Leptosomus discolor]
Length=531

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V S+G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVSNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+ ++G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVSNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|EMC87683.1| RCC1 and BTB domain-containing protein 1 [Columba livia]
Length=531

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V S+G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVSNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+ ++G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVSNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_005501892.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Columba 
livia]
Length=537

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V S+G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVSNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+ ++G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVSNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>gb|KFO81948.1| RCC1 and BTB domain-containing protein 1 [Cuculus canorus]
Length=531

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNANQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNANQLTP  224


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPIQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_009953619.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Leptosomus 
discolor]
Length=537

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V S+G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVSNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+ ++G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVSNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_005789489.1| hypothetical protein EMIHUDRAFT_362321, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD37060.1| hypothetical protein EMIHUDRAFT_362321, partial [Emiliania huxleyi 
CCMP1516]
Length=335

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++++ GS++++G   +GQLGHGD +  L+P K+ET  G  +  +S+GW H++A+T DG +
Sbjct  173  ALTADGSVWSWGGGLFGQLGHGDEQDQLLPKKIETFAGRRVVAVSAGWMHSLAITADGAV  232

Query  182  YGWGWNKFGQVGVGD  226
            + WGW  +G++G  D
Sbjct  233  WSWGWGGYGKLGQRD  247


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++++ G+++++GW  YG+LG  D    L+P K+E   G  +  +S+G RH++A T DG  
Sbjct  225  AITADGAVWSWGWGGYGKLGQRDRHAQLLPMKVEAFTGRRVVTVSAGARHSLATTADGAA  284

Query  182  YGWGWNKFGQVGVGD  226
            + WG    G++G GD
Sbjct  285  WSWGAGGNGRLGHGD  299



>gb|KFV83244.1| RCC1 and BTB domain-containing protein 1 [Struthio camelus australis]
Length=531

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  +  I+SG+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCVLQIASGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLSTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_009676892.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Struthio 
camelus australis]
 ref|XP_009676893.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Struthio 
camelus australis]
 ref|XP_009676894.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Struthio 
camelus australis]
 ref|XP_009676895.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Struthio 
camelus australis]
 ref|XP_009676896.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Struthio 
camelus australis]
Length=537

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  +  I+SG+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCVLQIASGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLSTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_003630329.1| RCC1 and BTB domain-containing protein [Medicago truncatula]
Length=230

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  134  AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKV-NIDGDKIVMVSCGWRHTISISSSGGL  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  193  YTHGWSKYGQLGHGDFEDCLVP  214


 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  32   YGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNKFGQ  211
            +G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG LYGWGW ++G 
Sbjct  92   WGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDLYGWGWGRYGN  151

Query  212  VGVGDNVDHCSP  247
            +G+GD  D   P
Sbjct  152  LGLGDTNDRLIP  163


 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPI  133
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +
Sbjct  185  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQV  228



>gb|KFP56585.1| RCC1 and BTB domain-containing protein 1, partial [Cariama cristata]
Length=383

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  47   AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  106

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  107  YAWGANTYGQLGTGNKSNQLSP  128


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
            LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G++YGWG+N
Sbjct  1    LYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGEVYGWGYN  60

Query  200  KFGQVGVGDNVDHCSP  247
              GQ+G+G+N +  +P
Sbjct  61   GNGQLGLGNNGNQLTP  76



>ref|XP_009693232.1| PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB domain-containing 
protein 1, partial [Cariama cristata]
Length=392

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  56   AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  115

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  116  YAWGANTYGQLGTGNKSNQLSP  137


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            SV   G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  3    SVCMDGXLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  62

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  63   VYGWGYNGNGQLGLGNNGNQLTP  85



>ref|XP_010088595.1| hypothetical protein L484_016988 [Morus notabilis]
 gb|EXB36736.1| hypothetical protein L484_016988 [Morus notabilis]
Length=464

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDGQ  178
            VS  G +Y +G +++GQLG G  +   +P  L++  L G     +S G RH+  +T DGQ
Sbjct  349  VSVDGHVYAFGGNQFGQLGTGADQAETLPRLLDSPCLEGKNAKMVSCGARHSAIVTEDGQ  408

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            L+ WGWNK+GQ+G+GD+VD  +P
Sbjct  409  LFSWGWNKYGQLGLGDSVDRSTP  431


 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            ++ +G+L T+GW  YGQ G G     L P  + +L G  +  I++G  HT+ ++ DG +Y
Sbjct  297  ITDAGALLTFGWGLYGQCGQGGTYDQLRPTFVNSLSGVRVEKIAAGLWHTLCVSVDGHVY  356

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G +     P
Sbjct  357  AFGGNQFGQLGTGADQAETLP  377



>ref|XP_646416.1| regulator of chromosome condensation  domain-containing protein 
[Dictyostelium discoideum AX4]
 gb|EAL72317.1| regulator of chromosome condensation  domain-containing protein 
[Dictyostelium discoideum AX4]
Length=2044

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G L T+G  + GQLGHGD    + P  +++L   +I+ +  G +HT+ LT +G++
Sbjct  818  AVRANGELLTWGVGENGQLGHGDTNNQIEPKIIQSLTSFWITQVQCGEKHTICLTKNGKV  877

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG +++GQ+G+GD   H SP
Sbjct  878  YSWGASEYGQLGLGDVTQHSSP  899


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 2/72 (3%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             +++  G +YT+G  +  +LGHG       P  +E L    I  IS G RHT  LT  G++
Sbjct  970   AITECGDVYTWGTGQ--ELGHGGNSTETSPKLIEALRNQSIRQISCGGRHTAFLTDSGRI  1027

Query  182   YGWGWNKFGQVG  217
             +  G + FGQ+G
Sbjct  1028  FTCGKDSFGQLG  1039



>gb|KFR17176.1| RCC1 and BTB domain-containing protein 1 [Opisthocomus hoazin]
Length=531

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGACILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            V+ +  ++ +G +    LG GD +  +VP KLE L G  +S +S G   H +  T DG++
Sbjct  37   VTHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKVSSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|KGN54275.1| hypothetical protein Csa_4G296280 [Cucumis sativus]
Length=417

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDGQ  178
            +++ G +Y +G +++GQLG G  +   +P  L+   L G     +S G RH + LT DGQ
Sbjct  305  ITAEGLVYAFGGNQFGQLGTGTDQGETIPRLLDAPILEGKCAKRVSCGARHNVVLTDDGQ  364

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            L+ WGWNK+GQ+G+GD++D   P
Sbjct  365  LFSWGWNKYGQLGLGDSIDRNIP  387


 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G+L T+GW  YGQ G G+    L P  + +L    +  IS+G  HT+ +T +G +Y
Sbjct  253  VTDTGALLTFGWGLYGQCGQGNTNDLLRPTCVSSLSSTQVESISAGLWHTVCITAEGLVY  312

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G +     P
Sbjct  313  AFGGNQFGQLGTGTDQGETIP  333



>gb|KFQ24239.1| RCC1 and BTB domain-containing protein 1 [Mesitornis unicolor]
Length=531

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V S+G +Y +G++  GQLG G+    L PC++  LHG  +  I+ G+ HT+ALT +G L
Sbjct  195  AVVSNGEVYGWGYNGNGQLGIGNNGNQLTPCRVAALHGVCVLQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+ ++G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRISNCLQAKMVVGIACGQTSSMAVVSNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGIGNNGNQLTP  224


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H++AL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPLQVCTNLLIKKVVEVACGSHHSLALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVICTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_009941085.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Opisthocomus 
hoazin]
Length=537

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGACILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            V+ +  ++ +G +    LG GD +  +VP KLE L G  +S +S G   H +  T DG++
Sbjct  43   VTHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKVSSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>gb|ABR17254.1| unknown [Picea sitchensis]
Length=286

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWNK  202
            +Y++GW  +G+LGHG+     +P  ++TL G  I  I+ G  H +A+T +G++  WG N+
Sbjct  88   VYSWGWGDFGRLGHGNSSDLFIPHAIKTLQGLQIKQIACGDSHCLAVTINGEVQSWGRNQ  147

Query  203  FGQVGVGDNVDHCSP  247
             GQ+GVGDN+DH  P
Sbjct  148  NGQLGVGDNIDHSFP  162


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+ +G + ++G ++ GQLG GD   H  P +++    + +  +S GWRHT+A+T    +
Sbjct  133  AVTINGEVQSWGRNQNGQLGVGDNIDHSFPQRVKLPAEEEVVQVSCGWRHTVAITGKSNV  192

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG    GQ+G GD +D   P
Sbjct  193  FSWGRGTSGQLGHGDILDRNMP  214


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = +2

Query  23   LYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL--YGWGW  196
            + ++G  + GQLGHGD E   +P  +  L G  I+ +  G  HT A  +D +L  Y WGW
Sbjct  35   VCSWGRGEDGQLGHGDAEDRPMPTFVSALDGCEITSVICGADHTTAY-SDSRLVVYSWGW  93

Query  197  NKFGQVGVGDNVDHCSP  247
              FG++G G++ D   P
Sbjct  94   GDFGRLGHGNSSDLFIP  110



>ref|XP_004938775.1| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X15 
[Gallus gallus]
Length=458

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  253  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  312

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  313  YAWGANTYGQLGTGNKSNQLSP  334


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+  +G+
Sbjct  200  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQDKMVVGIACGQTSSMAVVNNGE  259

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  260  VYGWGYNGNGQLGLGNNGNQLTP  282


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  149  TEDGEVYAWGHNGYSQLGNGATNQGVTPVQVCTNLLLKKVIEVACGSHHSMALSFDGDLY  208

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  209  AWGYNNCGQVGSGSTANQPTP  229


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQLYGWGW  196
             ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++Y WG 
Sbjct  100  EVFVFGLNCSNCLGTGDSQSTIVPKKLEALCGKKISSLSYGSGPHVLLCTEDGEVYAWGH  159

Query  197  NKFGQVGVGDNVDHCSP  247
            N + Q+G G      +P
Sbjct  160  NGYSQLGNGATNQGVTP  176



>ref|WP_042122221.1| hypothetical protein, partial [Paenibacillus senegalensis]
Length=359

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ SG +Y++GW  +GQLGHGD E  L P K+E L    I  +++G  H++ALT  G++
Sbjct  209  ALTKSGDVYSFGWGLHGQLGHGDTENQLTPKKIEDLSD--IQAVAAGANHSLALTKSGEV  266

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +G    GQ+G GD  D  +P
Sbjct  267  YSFGRGNTGQLGHGDTDDQLTP  288


 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ SG +Y++G+  +G+LGHGD +  L P K+E L    I  I++G  H++ALT  G +
Sbjct  159  ALTKSGDVYSFGFGLFGRLGHGDTDSQLEPKKIEDLSD--IQAIAAGGNHSLALTKSGDV  216

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +GW   GQ+G GD  +  +P
Sbjct  217  YSFGWGLHGQLGHGDTENQLTP  238


 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYGWGWN  199
            S++++G   YG+LGHGD    L P K+E L    I  I++G  H++ALT  G +Y +G+ 
Sbjct  16   SVFSFGMGMYGKLGHGDTANQLAPKKIEGLSD--IQAIAAGTNHSLALTKSGDVYSFGFG  73

Query  200  KFGQVGVGDNVDHCSP  247
             FG++G G+      P
Sbjct  74   LFGRLGHGNTDSQLEP  89


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ SG +Y++G    GQLGHGD +  L P K+E L    I  I++G  H++ALT  G +
Sbjct  259  ALTKSGEVYSFGRGNTGQLGHGDTDDQLTPKKIEGLKD--IQAIAAGDFHSLALTKSGDV  316

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +G    G +G GD  +   P
Sbjct  317  YSFGNGTSG-LGHGDTANQLEP  337


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ SG +Y++G    G LGHG+ E    P K+E+L    +  I++G  H++ALT  G +
Sbjct  110  ALTKSGDVYSFGNGTSG-LGHGNTEDQSTPKKIESLSD--VQAIAAGGNHSLALTKSGDV  166

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +G+  FG++G GD      P
Sbjct  167  YSFGFGLFGRLGHGDTDSQLEP  188


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++ SG +Y++G+  +G+LGHG+ +  L P K+E L    I  I++G  H++ALT  G +
Sbjct  60   ALTKSGDVYSFGFGLFGRLGHGNTDSQLEPKKIEGLSD--IQAIAAGDFHSLALTKSGDV  117

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y +G    G +G G+  D  +P
Sbjct  118  YSFGNGTSG-LGHGNTEDQSTP  138



>ref|XP_010186472.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Mesitornis 
unicolor]
Length=537

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V S+G +Y +G++  GQLG G+    L PC++  LHG  +  I+ G+ HT+ALT +G L
Sbjct  201  AVVSNGEVYGWGYNGNGQLGIGNNGNQLTPCRVAALHGVCVLQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+ ++G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRISNCLQAKMVVGIACGQTSSMAVVSNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGIGNNGNQLTP  230


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H++AL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPLQVCTNLLIKKVVEVACGSHHSLALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVICTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_011010790.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X5 [Populus 
euphratica]
 ref|XP_011010791.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X5 [Populus 
euphratica]
Length=401

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLE--TLHGDFISPISSGWRHTMALTTDGQ  178
            ++  G +Y +G +++GQLG G  E   +P  LE   L    +  +S G RH+  L  DGQ
Sbjct  289  ITIDGRVYVFGGNQFGQLGTGASEGETLPRLLEDPCLESKLVKMVSCGARHSAILLEDGQ  348

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            ++ WGWNK+GQ+GVGD++D  +P
Sbjct  349  VFSWGWNKYGQLGVGDSIDRNTP  371


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G+L T+GW  YGQ GHG     L P  L +L G  I  I++G  HTM +T DG++Y
Sbjct  237  VTDAGTLLTFGWGLYGQCGHGSTNDQLRPTCLPSLSGIQIERIAAGLWHTMCITIDGRVY  296

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G +     P
Sbjct  297  VFGGNQFGQLGTGASEGETLP  317



>gb|KFV43848.1| RCC1 and BTB domain-containing protein 1 [Tyto alba]
Length=531

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRIAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNSCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNSCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCNNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_009973887.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Tyto alba]
Length=537

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRIAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNSCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNSCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCNNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_003630330.1| RCC1 and BTB domain-containing protein [Medicago truncatula]
Length=279

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  183  AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKV-NIDGDKIVMVSCGWRHTISISSSGGL  241

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  242  YTHGWSKYGQLGHGDFEDCLVP  263


 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+    + ++G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG L
Sbjct  131  AVTMENKVLSWGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDL  190

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  191  YGWGWGRYGNLGLGDTNDRLIP  212


 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPI  133
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +
Sbjct  234  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQV  277


 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHGD     +P  +  L G  I  IS G  H +A+T + ++  
Sbjct  81   KSGKDVYSWGWGDFGRLGHGDPSDLFIPHPIRALQGLRIKQISCGDCHCLAVTMENKVLS  140

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ G++G+G   D   P
Sbjct  141  WGRNQNGELGLGTTKDSHVP  160


 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYGWGWNKF  205
            ++G  + GQLGHGD +  L+P KL    G  I  ++ G  +T+A +  G+ +Y WGW  F
Sbjct  35   SWGRGEDGQLGHGDTDDRLLPTKLSAFDGQDIVSVTCGADYTVARSKSGKDVYSWGWGDF  94

Query  206  GQVGVGDNVDHCSP  247
            G++G GD  D   P
Sbjct  95   GRLGHGDPSDLFIP  108



>ref|XP_004142058.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Cucumis 
sativus]
Length=485

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDGQ  178
            +++ G +Y +G +++GQLG G  +   +P  L+   L G     +S G RH + LT DGQ
Sbjct  373  ITAEGLVYAFGGNQFGQLGTGTDQGETIPRLLDAPILEGKCAKRVSCGARHNVVLTDDGQ  432

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            L+ WGWNK+GQ+G+GD++D   P
Sbjct  433  LFSWGWNKYGQLGLGDSIDRNIP  455


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G+L T+GW  YGQ G G+    L P  + +L    +  IS+G  HT+ +T +G +Y
Sbjct  321  VTDTGALLTFGWGLYGQCGQGNTNDLLRPTCVSSLSSTQVESISAGLWHTVCITAEGLVY  380

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G +     P
Sbjct  381  AFGGNQFGQLGTGTDQGETIP  401



>gb|KFQ95445.1| RCC1 and BTB domain-containing protein 1 [Nipponia nippon]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITDNDEVFVFGLNCNNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_004166562.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Cucumis 
sativus]
Length=472

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDGQ  178
            +++ G +Y +G +++GQLG G  +   +P  L+   L G     +S G RH + LT DGQ
Sbjct  360  ITAEGLVYAFGGNQFGQLGTGTDQGETIPRLLDAPILEGKCAKRVSCGARHNVVLTDDGQ  419

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            L+ WGWNK+GQ+G+GD++D   P
Sbjct  420  LFSWGWNKYGQLGLGDSIDRNIP  442


 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G+L T+GW  YGQ G G+    L P  + +L    +  IS+G  HT+ +T +G +Y
Sbjct  308  VTDTGALLTFGWGLYGQCGQGNTNDLLRPTCVSSLSSTQVESISAGLWHTVCITAEGLVY  367

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G +     P
Sbjct  368  AFGGNQFGQLGTGTDQGETIP  388



>ref|XP_008448195.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Cucumis 
melo]
Length=499

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDGQ  178
            +++ G +Y +G +++GQLG G  +   +P  L+   L G   + +S G RH + LT DGQ
Sbjct  387  ITAEGLVYAFGGNQFGQLGTGTDQGETIPRLLDAPILEGKRANRVSCGARHNVILTDDGQ  446

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            L+ WGWNK+GQ+G+GD++D   P
Sbjct  447  LFSWGWNKYGQLGLGDSIDRNIP  469


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G+L T+GW  YGQ G G+    L P  + +L    +  IS+G  HT+ +T +G +Y
Sbjct  335  VTDTGALLTFGWGLYGQCGQGNTNDLLRPTCVSSLSSTQVESISAGLWHTVCITAEGLVY  394

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G +     P
Sbjct  395  AFGGNQFGQLGTGTDQGETIP  415



>ref|XP_417063.2| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X9 
[Gallus gallus]
 ref|XP_004938773.1| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X13 
[Gallus gallus]
 ref|XP_004938774.1| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X14 
[Gallus gallus]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQDKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGATNQGVTPVQVCTNLLLKKVIEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQLYGWGW  196
             ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++Y WG 
Sbjct  48   EVFVFGLNCSNCLGTGDSQSTIVPKKLEALCGKKISSLSYGSGPHVLLCTEDGEVYAWGH  107

Query  197  NKFGQVGVGDNVDHCSP  247
            N + Q+G G      +P
Sbjct  108  NGYSQLGNGATNQGVTP  124



>gb|KEH16774.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=276

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G LY +GW +YG LG GD    L+P K+  + GD I  +S GWRHT+++++ G L
Sbjct  180  AITEDGDLYGWGWGRYGNLGLGDTNDRLIPEKV-NIDGDKIVMVSCGWRHTISISSSGGL  238

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y  GW+K+GQ+G GD  D   P
Sbjct  239  YTHGWSKYGQLGHGDFEDCLVP  260


 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+    + ++G ++ G+LG G  +   VP K+    G  I  +++G  H++A+T DG L
Sbjct  128  AVTMENKVLSWGRNQNGELGLGTTKDSHVPQKILAFEGIRIKMVAAGAEHSVAITEDGDL  187

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            YGWGW ++G +G+GD  D   P
Sbjct  188  YGWGWGRYGNLGLGDTNDRLIP  209


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPI  133
            S+SSSG LYT+GWSKYGQLGHGDFE  LVP K++ L    IS +
Sbjct  231  SISSSGGLYTHGWSKYGQLGHGDFEDCLVPRKVQALSDKLISQV  274


 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLYG  187
             S   +Y++GW  +G+LGHGD     +P  +  L G  I  IS G  H +A+T + ++  
Sbjct  78   KSGKDVYSWGWGDFGRLGHGDPSDLFIPHPIRALQGLRIKQISCGDCHCLAVTMENKVLS  137

Query  188  WGWNKFGQVGVGDNVDHCSP  247
            WG N+ G++G+G   D   P
Sbjct  138  WGRNQNGELGLGTTKDSHVP  157


 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   TYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQ-LYGWGWNKF  205
            ++G  + GQLGHGD +  L+P KL    G  I  ++ G  +T+A +  G+ +Y WGW  F
Sbjct  32   SWGRGEDGQLGHGDTDDRLLPTKLSAFDGQDIVSVTCGADYTVARSKSGKDVYSWGWGDF  91

Query  206  GQVGVGDNVDHCSP  247
            G++G GD  D   P
Sbjct  92   GRLGHGDPSDLFIP  105



>gb|KFV50968.1| RCC1 and BTB domain-containing protein 1 [Gavia stellata]
Length=535

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_008549781.1| PREDICTED: uncharacterized protein LOC103572785 [Microplitis 
demolitor]
 ref|XP_008549782.1| PREDICTED: uncharacterized protein LOC103572785 [Microplitis 
demolitor]
Length=1793

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2     SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
             +++  G ++T+GW  +GQLGHG+     +P  + +L G  I  I++G  HT+AL+ +GQ+
Sbjct  940   ALTMDGRVFTWGWGVHGQLGHGNTLQKNIPTVVSSLLGIIIRGIAAGHAHTLALSAEGQV  999

Query  182   YGWGWNKFGQVGVGDNVDHCSP  247
             Y +G N FGQ+G G+N+    P
Sbjct  1000  YAFGCNIFGQLGTGNNIKSSLP  1021


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V+++G +Y +G S++GQLG G       P  + +L  + I    +G  H++ALT DG++
Sbjct  889  AVTNNG-VYAWGGSQFGQLGLGRLLQTPSPEMIVSLAEEIIVDAVTGQYHSVALTMDGRV  947

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WGW   GQ+G G+ +    P
Sbjct  948  FTWGWGVHGQLGHGNTLQKNIP  969


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = +2

Query  14   SGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDF---ISPISSGWRHTMALTTDGQLY  184
            +GS+YT+G S  G LG G       P +  T+  +    +  +S G  HT+A+T +G +Y
Sbjct  838  NGSVYTWGSSAQGCLGTGPTISRYGPPQAVTVFKNLEMEVLSVSCGRCHTLAVTNNG-VY  896

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG ++FGQ+G+G  +   SP
Sbjct  897  AWGGSQFGQLGLGRLLQTPSP  917



>ref|XP_009880674.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Charadrius 
vociferus]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPLQVCTNLLVKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQCKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_003203406.1| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X3 
[Meleagris gallopavo]
 ref|XP_010727105.1| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X3 
[Meleagris gallopavo]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQDKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGATNQGVTPVQVCTNLLLKKVIEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQLYGWGW  196
             ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++Y WG 
Sbjct  48   EVFVFGLNCSNCLGTGDSQSTIVPKKLEALCGKKISSLSYGSGPHVLLCTEDGEVYAWGH  107

Query  197  NKFGQVGVGDNVDHCSP  247
            N + Q+G G      +P
Sbjct  108  NGYSQLGNGATNQGVTP  124



>ref|XP_004938772.1| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X12 
[Gallus gallus]
Length=550

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  214  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  273

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  274  YAWGANTYGQLGTGNKSNQLSP  295


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+  +G+
Sbjct  161  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQDKMVVGIACGQTSSMAVVNNGE  220

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  221  VYGWGYNGNGQLGLGNNGNQLTP  243


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  110  TEDGEVYAWGHNGYSQLGNGATNQGVTPVQVCTNLLLKKVIEVACGSHHSMALSFDGDLY  169

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  170  AWGYNNCGQVGSGSTANQPTP  190


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQLYGWGW  196
             ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++Y WG 
Sbjct  61   EVFVFGLNCSNCLGTGDSQSTIVPKKLEALCGKKISSLSYGSGPHVLLCTEDGEVYAWGH  120

Query  197  NKFGQVGVGDNVDHCSP  247
            N + Q+G G      +P
Sbjct  121  NGYSQLGNGATNQGVTP  137



>ref|XP_010015835.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Nestor notabilis]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKVVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLVKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>gb|KFW64288.1| RCC1 and BTB domain-containing protein 1 [Pygoscelis adeliae]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|KFQ77205.1| RCC1 and BTB domain-containing protein 1 [Phaethon lepturus]
 gb|KFW04857.1| RCC1 and BTB domain-containing protein 1 [Fulmarus glacialis]
 gb|KFW93827.1| RCC1 and BTB domain-containing protein 1 [Phalacrocorax carbo]
 gb|KFZ64976.1| RCC1 and BTB domain-containing protein 1 [Podiceps cristatus]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|KFP20928.1| RCC1 and BTB domain-containing protein 1 [Egretta garzetta]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  +S +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKVSSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|KFQ74273.1| RCC1 and BTB domain-containing protein 1 [Phoenicopterus ruber 
ruber]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLMKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_007565402.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like [Poecilia 
formosa]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++  +G +Y +G++  GQLG G+    L PC+L TL G  I  I SG+ H +ALT +G L
Sbjct  195  ALVDNGEIYGWGYNGNGQLGTGNNSNQLSPCRLTTLQGFCIQQIVSGYGHCLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +H SP
Sbjct  255  YAWGANAYGQLGTGNKNNHLSP  276


 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQ  178
            +++  G ++ +G++  GQ+G G       P K+  +L G     I+ G   +MAL  +G+
Sbjct  142  ALTHDGEVFAWGYNNCGQVGSGSTANQPYPRKVCSSLQGKTAVSITCGQASSMALVDNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G G+N +  SP
Sbjct  202  IYGWGYNGNGQLGTGNNSNQLSP  224


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQL  181
             S  G L+ +G + Y QLG+G          +   L    +  ++ G  H++ALT DG++
Sbjct  90   ASEDGQLFAWGHNGYSQLGNGTTNPGFSAVAITANLQNKKVMEVACGSHHSLALTHDGEV  149

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG+N  GQVG G   +   P
Sbjct  150  FAWGYNNCGQVGSGSTANQPYP  171


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            V+    +Y +G +  G LG GD    +VP KL+ L G  I  +S G   H +  + DGQL
Sbjct  37   VTQENDVYVFGLNCSGCLGTGDSVSTIVPKKLDFLQGKKIVSLSYGSGPHVLLASEDGQL  96

Query  182  YGWGWNKFGQVGVG  223
            + WG N + Q+G G
Sbjct  97   FAWGHNGYSQLGNG  110



>ref|XP_009806771.1| PREDICTED: LOW QUALITY PROTEIN: RCC1 and BTB domain-containing 
protein 1 [Gavia stellata]
Length=539

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_009461353.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Nipponia 
nippon]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITDNDEVFVFGLNCNNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>gb|KGL91146.1| RCC1 and BTB domain-containing protein 1 [Charadrius vociferus]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPLQVCTNLLVKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKL-ETLHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQCKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>gb|KFM06068.1| RCC1 and BTB domain-containing protein 1 [Aptenodytes forsteri]
 gb|KFQ11450.1| RCC1 and BTB domain-containing protein 1 [Haliaeetus albicilla]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_009508178.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Phalacrocorax 
carbo]
 ref|XP_009575994.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Fulmarus 
glacialis]
 ref|XP_010287664.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Phaethon 
lepturus]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_004359988.1| regulator of chromosome condensation domain-containing protein 
[Dictyostelium fasciculatum]
 gb|EGG22137.1| regulator of chromosome condensation domain-containing protein 
[Dictyostelium fasciculatum]
Length=1859

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            ++ S+G L T+G  + GQLGHGD     +P  ++T+   +++ +  G +HT+ LT +G++
Sbjct  693  ALKSNGELLTWGCGEDGQLGHGDVLNQTIPKVVQTMTSHWVTQVQCGEKHTICLTKNGKV  752

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            + WG +++GQ+G+GD   +C+P
Sbjct  753  FTWGTSEYGQLGLGDTQKNCTP  774


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 7/87 (8%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSK-----YGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALT  166
            +++ +G +Y +G           LG+G  E  L+P K+E+L    +  +S G+ H+ AL 
Sbjct  638  ALTENGDVYMWGRGSVKNPPLSTLGNGSLEDQLLPTKVESLSE--VVLVSIGYYHSAALK  695

Query  167  TDGQLYGWGWNKFGQVGVGDNVDHCSP  247
            ++G+L  WG  + GQ+G GD ++   P
Sbjct  696  SNGELLTWGCGEDGQLGHGDVLNQTIP  722


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 38/72 (53%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +++  G +YT  W    +LGHG  +  L P  ++ L    I  IS G RH   LT  G++
Sbjct  845  ALTECGDVYT--WGSGQELGHGTNQSELHPKLVDGLRSQSIRQISCGGRHMAFLTDSGKI  902

Query  182  YGWGWNKFGQVG  217
            Y  G + FGQ+G
Sbjct  903  YTCGKDPFGQLG  914



>ref|XP_009643091.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Egretta 
garzetta]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  +S +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKVSSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_009318226.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Pygoscelis 
adeliae]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>gb|KFQ52338.1| RCC1 and BTB domain-containing protein 1 [Nestor notabilis]
Length=531

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  195  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  254

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  255  YAWGANTYGQLGTGNKSNQLSP  276


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  142  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKVVVGIACGQTSSMAVVNNGE  201

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  202  VYGWGYNGNGQLGLGNNGNQLTP  224


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  91   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLVKKVVEVACGSHHSMALSFDGDLY  150

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  151  AWGYNNCGQVGSGSTANQPTP  171


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  37   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  96

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  97   YAWGHNGYSQLGNGTTNQGITP  118



>ref|XP_008448203.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Cucumis 
melo]
Length=482

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET--LHGDFISPISSGWRHTMALTTDGQ  178
            +++ G +Y +G +++GQLG G  +   +P  L+   L G   + +S G RH + LT DGQ
Sbjct  370  ITAEGLVYAFGGNQFGQLGTGTDQGETIPRLLDAPILEGKRANRVSCGARHNVILTDDGQ  429

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            L+ WGWNK+GQ+G+GD++D   P
Sbjct  430  LFSWGWNKYGQLGLGDSIDRNIP  452


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQLY  184
            V+ +G+L T+GW  YGQ G G+    L P  + +L    +  IS+G  HT+ +T +G +Y
Sbjct  318  VTDTGALLTFGWGLYGQCGQGNTNDLLRPTCVSSLSSTQVESISAGLWHTVCITAEGLVY  377

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             +G N+FGQ+G G +     P
Sbjct  378  AFGGNQFGQLGTGTDQGETIP  398



>ref|XP_010581667.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Haliaeetus 
leucocephalus]
Length=537

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



>ref|XP_010727104.1| PREDICTED: RCC1 and BTB domain-containing protein 1 isoform X2 
[Meleagris gallopavo]
Length=556

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  220  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  279

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  280  YAWGANTYGQLGTGNKSNQLSP  301


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L    +  I+ G   +MA+  +G+
Sbjct  167  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQDKMVVGIACGQTSSMAVVNNGE  226

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  227  VYGWGYNGNGQLGLGNNGNQLTP  249


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  116  TEDGEVYAWGHNGYSQLGNGATNQGVTPVQVCTNLLLKKVIEVACGSHHSMALSFDGDLY  175

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  176  AWGYNNCGQVGSGSTANQPTP  196


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +2

Query  20   SLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQLYGWGW  196
             ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++Y WG 
Sbjct  67   EVFVFGLNCSNCLGTGDSQSTIVPKKLEALCGKKISSLSYGSGPHVLLCTEDGEVYAWGH  126

Query  197  NKFGQVGVGDNVDHCSP  247
            N + Q+G G      +P
Sbjct  127  NGYSQLGNGATNQGVTP  143



>ref|XP_009275420.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Aptenodytes 
forsteri]
 ref|XP_009926523.1| PREDICTED: RCC1 and BTB domain-containing protein 1 [Haliaeetus 
albicilla]
Length=537

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGWRHTMALTTDGQL  181
            +V ++G +Y +G++  GQLG G+    L PC++  LHG  I  I+ G+ HT+ALT +G L
Sbjct  201  AVVNNGEVYGWGYNGNGQLGLGNNGNQLTPCRVAALHGVCILQIACGYAHTLALTDEGLL  260

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N +GQ+G G+  +  SP
Sbjct  261  YAWGANTYGQLGTGNKSNQLSP  282


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    SVSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQ  178
            ++S  G LY +G++  GQ+G G       P ++   L G  +  I+ G   +MA+  +G+
Sbjct  148  ALSFDGDLYAWGYNNCGQVGSGSTANQPTPRRVSNCLQGKMVVGIACGQTSSMAVVNNGE  207

Query  179  LYGWGWNKFGQVGVGDNVDHCSP  247
            +YGWG+N  GQ+G+G+N +  +P
Sbjct  208  VYGWGYNGNGQLGLGNNGNQLTP  230


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  8    SSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLET-LHGDFISPISSGWRHTMALTTDGQLY  184
            +  G +Y +G + Y QLG+G     + P ++ T L    +  ++ G  H+MAL+ DG LY
Sbjct  97   TEDGEVYAWGHNGYSQLGNGTTNQGITPVQVCTNLLIKKVVEVACGSHHSMALSFDGDLY  156

Query  185  GWGWNKFGQVGVGDNVDHCSP  247
             WG+N  GQVG G   +  +P
Sbjct  157  AWGYNNCGQVGSGSTANQPTP  177


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  5    VSSSGSLYTYGWSKYGQLGHGDFEYHLVPCKLETLHGDFISPISSGW-RHTMALTTDGQL  181
            ++ +  ++ +G +    LG GD +  +VP KLE L G  IS +S G   H +  T DG++
Sbjct  43   ITHNDEVFVFGLNCSNCLGTGDNQSTIVPKKLEALCGKKISSLSYGSGPHVVLCTEDGEV  102

Query  182  YGWGWNKFGQVGVGDNVDHCSP  247
            Y WG N + Q+G G      +P
Sbjct  103  YAWGHNGYSQLGNGTTNQGITP  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557676237175