BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016C06 646 bp,

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                336   9e-110   Nicotiana sylvestris
ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                335   2e-109   Nicotiana tomentosiformis
ref|XP_006341563.1|  PREDICTED: beta-glucosidase 44-like                335   2e-109   Solanum tuberosum [potatoes]
ref|NP_001234620.1|  beta-mannosidase enzyme precursor                  335   2e-109   
gb|KHN23728.1|  Beta-glucosidase 44                                     332   6e-109   Glycine soja [wild soybean]
ref|XP_003534146.1|  PREDICTED: beta-glucosidase 44                     333   1e-108   Glycine max [soybeans]
ref|XP_006490742.1|  PREDICTED: beta-glucosidase 44-like                332   2e-108   Citrus sinensis [Valencia orange]
gb|KDP41124.1|  hypothetical protein JCGZ_03615                         332   3e-108   Jatropha curcas
gb|KEH16707.1|  glycoside hydrolase family 1 protein                    331   5e-108   Medicago truncatula
ref|XP_007036680.1|  B-S glucosidase 44 isoform 2                       330   6e-108   Theobroma cacao [chocolate]
ref|XP_006451662.1|  hypothetical protein CICLE_v10008010mg             330   1e-107   Citrus clementina
gb|KCW83983.1|  hypothetical protein EUGRSUZ_B00859                     328   1e-107   Eucalyptus grandis [rose gum]
gb|KCW83978.1|  hypothetical protein EUGRSUZ_B00859                     330   2e-107   Eucalyptus grandis [rose gum]
gb|KDO62879.1|  hypothetical protein CISIN_1g010049mg                   326   2e-107   Citrus sinensis [Valencia orange]
gb|KCW83977.1|  hypothetical protein EUGRSUZ_B00859                     330   2e-107   Eucalyptus grandis [rose gum]
gb|KCW83975.1|  hypothetical protein EUGRSUZ_B00859                     330   2e-107   Eucalyptus grandis [rose gum]
ref|XP_007036681.1|  B-S glucosidase 44 isoform 3                       330   2e-107   Theobroma cacao [chocolate]
ref|XP_007036679.1|  B-S glucosidase 44 isoform 1                       330   2e-107   Theobroma cacao [chocolate]
ref|XP_010032608.1|  PREDICTED: beta-glucosidase 44-like                329   3e-107   Eucalyptus grandis [rose gum]
ref|XP_006376723.1|  hypothetical protein POPTR_0012s04670g             330   4e-107   Populus trichocarpa [western balsam poplar]
gb|ACU24532.1|  unknown                                                 329   4e-107   Glycine max [soybeans]
gb|KEH16706.1|  glycoside hydrolase family 1 protein                    328   1e-106   Medicago truncatula
ref|XP_011039106.1|  PREDICTED: beta-glucosidase 44-like                327   1e-106   Populus euphratica
gb|KDO62878.1|  hypothetical protein CISIN_1g010049mg                   327   2e-106   Citrus sinensis [Valencia orange]
ref|XP_004512738.1|  PREDICTED: beta-glucosidase 44-like                327   2e-106   Cicer arietinum [garbanzo]
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                327   2e-106   Nicotiana tomentosiformis
gb|KCW83979.1|  hypothetical protein EUGRSUZ_B00859                     326   4e-106   Eucalyptus grandis [rose gum]
gb|AGV54748.1|  beta-glucosidase 44-like protein                        326   5e-106   Phaseolus vulgaris [French bean]
gb|KHN44611.1|  Beta-glucosidase 44                                     323   5e-106   Glycine soja [wild soybean]
ref|XP_002322085.1|  glycosyl hydrolase family 1 family protein         326   6e-106   Populus trichocarpa [western balsam poplar]
ref|XP_002322086.2|  hypothetical protein POPTR_0015s04280g             326   7e-106   Populus trichocarpa [western balsam poplar]
ref|XP_007152698.1|  hypothetical protein PHAVU_004G151800g             327   7e-106   Phaseolus vulgaris [French bean]
ref|XP_007209912.1|  hypothetical protein PRUPE_ppa004380mg             325   8e-106   Prunus persica
ref|XP_003528968.1|  PREDICTED: beta-glucosidase 44-like                325   8e-106   Glycine max [soybeans]
ref|XP_010314225.1|  PREDICTED: beta-glucosidase 44-like isoform X2     325   1e-105   Solanum lycopersicum
ref|XP_010243804.1|  PREDICTED: beta-glucosidase 44-like                325   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_010032621.1|  PREDICTED: beta-glucosidase 44-like                325   2e-105   Eucalyptus grandis [rose gum]
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                324   3e-105   Solanum tuberosum [potatoes]
ref|XP_008374823.1|  PREDICTED: beta-glucosidase 44-like                324   3e-105   Malus domestica [apple tree]
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     324   3e-105   Solanum lycopersicum
ref|XP_009347765.1|  PREDICTED: beta-glucosidase 44-like                323   5e-105   Pyrus x bretschneideri [bai li]
ref|XP_004137494.1|  PREDICTED: beta-glucosidase 44-like                323   6e-105   Cucumis sativus [cucumbers]
gb|KCW83981.1|  hypothetical protein EUGRSUZ_B00859                     323   6e-105   Eucalyptus grandis [rose gum]
ref|XP_004161840.1|  PREDICTED: beta-glucosidase 44-like                323   7e-105   
ref|XP_010097587.1|  Beta-glucosidase 44                                323   8e-105   Morus notabilis
ref|XP_011000474.1|  PREDICTED: beta-glucosidase 44-like                323   9e-105   Populus euphratica
gb|KDO50113.1|  hypothetical protein CISIN_1g0406882mg                  317   9e-105   Citrus sinensis [Valencia orange]
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                322   3e-104   Nicotiana sylvestris
ref|XP_002533126.1|  beta-glucosidase, putative                         321   7e-104   Ricinus communis
ref|XP_008240180.1|  PREDICTED: beta-glucosidase 44-like                320   7e-104   Prunus mume [ume]
gb|EYU40222.1|  hypothetical protein MIMGU_mgv1a004735mg                320   1e-103   Erythranthe guttata [common monkey flower]
emb|CAN74265.1|  hypothetical protein VITISV_040977                     320   1e-103   Vitis vinifera
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     320   1e-103   Vitis vinifera
ref|XP_008462973.1|  PREDICTED: beta-glucosidase 44-like                320   2e-103   Cucumis melo [Oriental melon]
gb|EPS65829.1|  beta-mannosidase                                        318   3e-103   Genlisea aurea
gb|KCW83982.1|  hypothetical protein EUGRSUZ_B00859                     319   4e-103   Eucalyptus grandis [rose gum]
gb|KCW83987.1|  hypothetical protein EUGRSUZ_B00860                     318   4e-103   Eucalyptus grandis [rose gum]
ref|XP_006471035.1|  PREDICTED: beta-glucosidase 44-like                318   5e-103   
ref|XP_006431835.1|  hypothetical protein CICLE_v10004010mg             318   6e-103   Citrus clementina
ref|XP_010032630.1|  PREDICTED: beta-glucosidase 44-like                318   7e-103   Eucalyptus grandis [rose gum]
emb|CDO98378.1|  unnamed protein product                                315   1e-102   Coffea canephora [robusta coffee]
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                317   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_010686092.1|  PREDICTED: beta-glucosidase 44-like                316   4e-102   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006299658.1|  hypothetical protein CARUB_v10015846mg             315   7e-102   Capsella rubella
ref|XP_011084444.1|  PREDICTED: beta-glucosidase 44-like                315   8e-102   Sesamum indicum [beniseed]
ref|XP_010465882.1|  PREDICTED: beta-glucosidase 44                     315   9e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006644213.1|  PREDICTED: beta-glucosidase 1-like                 315   9e-102   Oryza brachyantha
ref|NP_001078176.1|  beta glucosidase 43                                312   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394432.1|  PREDICTED: beta-glucosidase 1-like                 314   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810053.1|  PREDICTED: beta-glucosidase 1-like                 314   2e-101   Phoenix dactylifera
gb|KFK39133.1|  beta-glucosidase 44                                     313   3e-101   Arabis alpina [alpine rockcress]
gb|KJB34273.1|  hypothetical protein B456_006G057000                    313   4e-101   Gossypium raimondii
ref|XP_010487722.1|  PREDICTED: beta-glucosidase 44-like                313   4e-101   Camelina sativa [gold-of-pleasure]
dbj|BAB02019.1|  beta-glucosidase                                       312   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299545.1|  PREDICTED: beta-glucosidase 44-like                312   1e-100   Fragaria vesca subsp. vesca
ref|NP_188435.2|  beta glucosidase 43                                   311   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883106.1|  beta-glucosidase                                   311   2e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                311   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     311   3e-100   Camelina sativa [gold-of-pleasure]
gb|ABC55716.1|  beta-mannosidase 3                                      311   3e-100   Oncidium hybrid cultivar
gb|EEE54664.1|  hypothetical protein OsJ_01954                          308   4e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004299546.1|  PREDICTED: beta-glucosidase 44-like                311   4e-100   Fragaria vesca subsp. vesca
emb|CDX95558.1|  BnaC01g34500D                                          310   8e-100   Brassica napus [oilseed rape]
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                310   9e-100   Arabidopsis lyrata subsp. lyrata
ref|NP_188436.1|  beta-glucosidase 44                                   310   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297463.1|  hypothetical protein CARUB_v10013483mg             309   2e-99    Capsella rubella
ref|NP_001043156.1|  Os01g0508000                                       309   3e-99    
gb|EAY74244.1|  hypothetical protein OsI_02124                          309   3e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_009113531.1|  PREDICTED: beta-glucosidase 43                     307   6e-99    Brassica rapa
emb|CDY18494.1|  BnaA01g27010D                                          308   7e-99    Brassica napus [oilseed rape]
gb|ABC55718.1|  beta-mannosidase 1                                      307   7e-99    Oncidium hybrid cultivar
ref|XP_007033088.1|  Beta-glucosidase 44                                307   1e-98    Theobroma cacao [chocolate]
ref|XP_006430656.1|  hypothetical protein CICLE_v10013386mg             307   1e-98    Citrus clementina
gb|KJB16857.1|  hypothetical protein B456_002G251100                    300   3e-98    Gossypium raimondii
ref|XP_007033096.1|  B-S glucosidase 44                                 306   3e-98    Theobroma cacao [chocolate]
gb|ABC55717.1|  beta-mannosidase 2                                      305   4e-98    Oncidium hybrid cultivar
gb|KJB16881.1|  hypothetical protein B456_002G252700                    305   6e-98    Gossypium raimondii
gb|KDO63132.1|  hypothetical protein CISIN_1g046891mg                   304   2e-97    Citrus sinensis [Valencia orange]
ref|XP_006495386.1|  PREDICTED: beta-glucosidase 44-like                301   2e-97    Citrus sinensis [Valencia orange]
ref|XP_006482391.1|  PREDICTED: beta-glucosidase 44-like                304   2e-97    
gb|KCW52109.1|  hypothetical protein EUGRSUZ_J01543                     301   3e-97    Eucalyptus grandis [rose gum]
gb|KDO63131.1|  hypothetical protein CISIN_1g036937mg                   303   3e-97    Citrus sinensis [Valencia orange]
emb|CBI33559.3|  unnamed protein product                                301   4e-97    Vitis vinifera
ref|XP_006845279.1|  hypothetical protein AMTR_s00005p00266150          302   4e-97    
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                303   5e-97    Eucalyptus grandis [rose gum]
ref|XP_008811965.1|  PREDICTED: beta-glucosidase 1-like isoform X1      302   8e-97    Phoenix dactylifera
ref|XP_006845277.1|  hypothetical protein AMTR_s00005p00265710          301   1e-96    
ref|XP_007048474.1|  Beta-glucosidase 44                                303   1e-96    Theobroma cacao [chocolate]
gb|KFK39134.1|  beta-glucosidase 44                                     302   1e-96    Arabis alpina [alpine rockcress]
ref|XP_006482390.1|  PREDICTED: beta-glucosidase 44-like                302   1e-96    Citrus sinensis [Valencia orange]
ref|XP_006482389.1|  PREDICTED: beta-glucosidase 44-like                302   1e-96    Citrus sinensis [Valencia orange]
ref|XP_008792825.1|  PREDICTED: beta-glucosidase 1-like                 301   2e-96    Phoenix dactylifera
gb|KJB16855.1|  hypothetical protein B456_002G250900                    301   2e-96    Gossypium raimondii
emb|CDX95557.1|  BnaC01g34490D                                          301   2e-96    Brassica napus [oilseed rape]
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                301   5e-96    Vitis vinifera
gb|ABR17739.1|  unknown                                                 300   5e-96    Picea sitchensis
ref|XP_006845278.1|  hypothetical protein AMTR_s00005p00265850          299   6e-96    
gb|KJB16858.1|  hypothetical protein B456_002G251200                    299   2e-95    Gossypium raimondii
ref|XP_006430653.1|  hypothetical protein CICLE_v10013421mg             299   2e-95    Citrus clementina
ref|XP_006430655.1|  hypothetical protein CICLE_v10013521mg             298   4e-95    Citrus clementina
ref|XP_006406654.1|  hypothetical protein EUTSA_v10020536mg             297   8e-95    Eutrema salsugineum
ref|XP_010922562.1|  PREDICTED: beta-glucosidase 1-like                 296   2e-94    Elaeis guineensis
ref|XP_010906974.1|  PREDICTED: beta-glucosidase 1-like                 296   2e-94    Elaeis guineensis
ref|XP_009113523.1|  PREDICTED: beta-glucosidase 44                     296   2e-94    Brassica rapa
ref|XP_010916341.1|  PREDICTED: beta-glucosidase 1-like                 295   4e-94    Elaeis guineensis
gb|KHG17589.1|  Beta-glucosidase 44 -like protein                       291   6e-94    Gossypium arboreum [tree cotton]
ref|XP_009394053.1|  PREDICTED: beta-glucosidase 26-like                294   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       294   1e-93    Gossypium arboreum [tree cotton]
ref|XP_006832849.1|  hypothetical protein AMTR_s00095p00053110          294   2e-93    
ref|XP_004140826.1|  PREDICTED: beta-glucosidase 44-like                294   2e-93    Cucumis sativus [cucumbers]
ref|XP_004157213.1|  PREDICTED: beta-glucosidase 44-like                293   2e-93    
ref|XP_008811966.1|  PREDICTED: beta-glucosidase 1-like isoform X2      292   8e-93    
ref|XP_008457084.1|  PREDICTED: beta-glucosidase 44-like                292   9e-93    Cucumis melo [Oriental melon]
gb|KJB08522.1|  hypothetical protein B456_001G086300                    290   2e-92    Gossypium raimondii
ref|XP_010257514.1|  PREDICTED: beta-glucosidase 44-like isoform X2     290   8e-92    Nelumbo nucifera [Indian lotus]
gb|AEV76986.1|  beta-glucosidase 4                                      289   8e-92    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010257596.1|  PREDICTED: beta-glucosidase 44-like isoform X3     284   1e-89    Nelumbo nucifera [Indian lotus]
ref|XP_010257433.1|  PREDICTED: beta-glucosidase 44-like isoform X1     284   2e-89    Nelumbo nucifera [Indian lotus]
ref|XP_004149144.1|  PREDICTED: beta-glucosidase 44-like                276   1e-86    Cucumis sativus [cucumbers]
gb|AAA87339.1|  beta-glucosidase                                        275   2e-86    Hordeum vulgare [barley]
gb|ACF07998.1|  beta-glucosidase                                        275   2e-86    Hordeum vulgare subsp. vulgare [barley]
ref|XP_004163493.1|  PREDICTED: beta-glucosidase 44-like                275   3e-86    
ref|XP_008453769.1|  PREDICTED: beta-glucosidase 44-like                275   4e-86    Cucumis melo [Oriental melon]
ref|XP_008655551.1|  PREDICTED: beta-glucosidase 1-like                 276   6e-86    Zea mays [maize]
ref|NP_001060502.1|  Os07g0656200                                       267   3e-85    
gb|EMT08337.1|  Beta-glucosidase 44                                     272   3e-85    Aegilops tauschii
ref|XP_003562544.1|  PREDICTED: beta-glucosidase 26                     271   5e-85    Brachypodium distachyon [annual false brome]
dbj|BAK07108.1|  predicted protein                                      270   6e-85    Hordeum vulgare subsp. vulgare [barley]
ref|XP_009388049.1|  PREDICTED: beta-glucosidase 26-like                261   4e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC76023.1|  hypothetical protein OsI_13187                          270   2e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001051014.1|  Os03g0703100                                       269   3e-83    
pdb|4JIE|A  Chain A, Structural Analysis And Insights Into Glycon...    267   3e-83    Oryza sativa Indica Group [Indian rice]
gb|ACF35791.1|  beta-mannosidase/beta-glucosidase                       266   3e-83    Oryza sativa Indica Group [Indian rice]
gb|AAX95520.1|  Putative Glycosyl hydrolase family 1 protein            269   5e-83    Oryza sativa Japonica Group [Japonica rice]
sp|A3BMZ5.1|BGL26_ORYSJ  RecName: Full=Beta-glucosidase 26; Short...    266   7e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658055.1|  PREDICTED: beta-glucosidase 26-like                266   1e-82    Oryza brachyantha
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 268   1e-82    Oryza brachyantha
gb|AFW79802.1|  hypothetical protein ZEAMMB73_091278                    266   1e-82    Zea mays [maize]
gb|EMS60983.1|  Beta-glucosidase 26                                     265   3e-82    Triticum urartu
ref|XP_002464027.1|  hypothetical protein SORBIDRAFT_01g010830          265   3e-82    Sorghum bicolor [broomcorn]
emb|CDM80087.1|  unnamed protein product                                264   5e-82    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003559508.1|  PREDICTED: beta-glucosidase 7-like                 264   7e-82    Brachypodium distachyon [annual false brome]
ref|XP_003559510.1|  PREDICTED: beta-glucosidase 8-like                 265   9e-82    Brachypodium distachyon [annual false brome]
gb|ABF98424.1|  Glycosyl hydrolase family 1 protein, expressed          260   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982055.1|  PREDICTED: beta-glucosidase 7-like isoform X1      263   2e-81    Setaria italica
ref|XP_008665263.1|  PREDICTED: beta-glucosidase 7-like                 262   3e-81    Zea mays [maize]
gb|EAY86111.1|  hypothetical protein OsI_07481                          261   8e-81    Oryza sativa Indica Group [Indian rice]
pdb|3F4V|A  Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Pl...    260   9e-81    Oryza sativa Japonica Group [Japonica rice]
pdb|2RGL|A  Chain A, Rice Bglu1 Beta-Glucosidase, A Plant Exogluc...    260   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464026.1|  hypothetical protein SORBIDRAFT_01g010825          262   1e-80    Sorghum bicolor [broomcorn]
ref|NP_001051013.1|  Os03g0703000                                       260   2e-80    
ref|XP_006651730.1|  PREDICTED: beta-glucosidase 7-like                 259   2e-80    
gb|AAA84906.3|  beta-glucosidase                                        260   2e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             259   2e-80    Selaginella moellendorffii
ref|XP_003559509.1|  PREDICTED: beta-glucosidase 7-like isoform X1      259   6e-80    Brachypodium distachyon [annual false brome]
pdb|3SCR|A  Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant       258   6e-80    Oryza sativa Japonica Group [Japonica rice]
gb|ACL52625.1|  unknown                                                 259   7e-80    Zea mays [maize]
pdb|3SCP|A  Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant       258   7e-80    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCN|A  Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant       257   1e-79    Oryza sativa Japonica Group [Japonica rice]
pdb|3SCV|A  Chain A, Crystal Structure Of Rice Bglu1 E386gS334A M...    257   2e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982056.1|  PREDICTED: beta-glucosidase 7-like isoform X2      257   2e-79    Setaria italica
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             257   2e-79    Selaginella moellendorffii
pdb|3SCW|A  Chain A, Crystal Structure Of Rice Bglu1 E386gY341A M...    256   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151026.1|  LOC100284659 precursor                             258   7e-79    Zea mays [maize]
ref|NP_001142124.1|  uncharacterized protein LOC100274288 precursor     255   1e-78    Zea mays [maize]
ref|NP_001148821.1|  LOC100282438 precursor                             255   2e-78    Zea mays [maize]
ref|XP_004958541.1|  PREDICTED: beta-glucosidase 26-like                255   2e-78    Setaria italica
ref|XP_002461141.1|  hypothetical protein SORBIDRAFT_02g041550          254   3e-78    Sorghum bicolor [broomcorn]
gb|EMS62097.1|  Beta-glucosidase 7                                      254   4e-78    Triticum urartu
gb|ADP02192.1|  putative non-cyanogenic beta-glucosidase                253   7e-78    Triticum aestivum [Canadian hard winter wheat]
gb|EMT31426.1|  Beta-glucosidase 1                                      252   3e-77    Aegilops tauschii
gb|EMT23872.1|  Beta-glucosidase 44                                     252   4e-77    Aegilops tauschii
ref|XP_006664007.1|  PREDICTED: beta-glucosidase 38-like                251   5e-77    Oryza brachyantha
ref|XP_010237292.1|  PREDICTED: beta-glucosidase 38-like                250   7e-77    Brachypodium distachyon [annual false brome]
gb|EEC69164.1|  hypothetical protein OsI_38122                          248   4e-76    Oryza sativa Indica Group [Indian rice]
emb|CDM83785.1|  unnamed protein product                                248   5e-76    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001066656.1|  Os12g0420100                                       248   9e-76    
dbj|BAJ90056.1|  predicted protein                                      247   2e-75    Hordeum vulgare subsp. vulgare [barley]
gb|EMT00720.1|  Beta-glucosidase 1                                      248   3e-75    Aegilops tauschii
gb|EMS62098.1|  Beta-glucosidase 8                                      247   5e-75    Triticum urartu
ref|XP_004982054.1|  PREDICTED: beta-glucosidase 8-like                 246   2e-74    Setaria italica
gb|ADP02193.1|  Glyco_hydro_1 domain-containing protein                 246   3e-74    Triticum aestivum [Canadian hard winter wheat]
gb|AFW69221.1|  hypothetical protein ZEAMMB73_365784                    243   4e-74    Zea mays [maize]
ref|XP_008644990.1|  PREDICTED: beta-glucosidase 38-like                244   6e-74    Zea mays [maize]
gb|KJB16934.1|  hypothetical protein B456_002G255400                    231   5e-72    Gossypium raimondii
ref|XP_004963948.1|  PREDICTED: beta-glucosidase 38-like                238   7e-72    Setaria italica
gb|EMS63424.1|  Beta-glucosidase 38                                     230   4e-69    Triticum urartu
gb|KDO62881.1|  hypothetical protein CISIN_1g010049mg                   226   2e-68    Citrus sinensis [Valencia orange]
gb|KJB16882.1|  hypothetical protein B456_002G252800                    223   1e-66    Gossypium raimondii
gb|EMS48652.1|  Beta-glucosidase 7                                      222   5e-66    Triticum urartu
gb|ACN26454.1|  unknown                                                 211   1e-64    Zea mays [maize]
gb|EMT02092.1|  Beta-glucosidase 44                                     213   1e-63    Aegilops tauschii
gb|ACG44181.1|  non-cyanogenic beta-glucosidase precursor               213   6e-63    Zea mays [maize]
gb|AFK37966.1|  unknown                                                 203   2e-62    Medicago truncatula
ref|XP_001765414.1|  predicted protein                                  210   2e-61    Physcomitrella patens
ref|XP_007133703.1|  hypothetical protein PHAVU_011G201700g             211   3e-61    Phaseolus vulgaris [French bean]
gb|EAY94510.1|  hypothetical protein OsI_16283                          203   3e-61    Oryza sativa Indica Group [Indian rice]
gb|EAZ31068.1|  hypothetical protein OsJ_15164                          202   4e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007014882.1|  Beta-glucosidase 17                                207   3e-60    Theobroma cacao [chocolate]
ref|XP_002438912.1|  hypothetical protein SORBIDRAFT_10g028060          206   3e-60    Sorghum bicolor [broomcorn]
ref|NP_001053070.1|  Os04g0474800                                       204   4e-60    
dbj|BAG94781.1|  unnamed protein product                                204   4e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002448027.1|  hypothetical protein SORBIDRAFT_06g019840          207   5e-60    Sorghum bicolor [broomcorn]
ref|XP_006850052.1|  hypothetical protein AMTR_s00022p00199830          202   7e-60    
ref|XP_006652406.1|  PREDICTED: beta-glucosidase 13-like                206   7e-60    Oryza brachyantha
pdb|3PTK|A  Chain A, The Crystal Structure Of Rice (Oryza Sativa ...    206   8e-60    Oryza sativa [red rice]
emb|CAH66812.1|  OSIGBa0135C13.7                                        206   1e-59    Oryza sativa Indica Group [Indian rice]
ref|XP_008441738.1|  PREDICTED: beta-glucosidase 42 isoform X3          206   1e-59    Cucumis melo [Oriental melon]
ref|XP_008441736.1|  PREDICTED: beta-glucosidase 42 isoform X2          206   1e-59    
ref|XP_008441735.1|  PREDICTED: beta-glucosidase 42 isoform X1          206   1e-59    
gb|ABI34907.3|  glycoside hydrolase family 1 protein                    202   1e-59    Leucaena leucocephala [cassie]
ref|XP_006386092.1|  hypothetical protein POPTR_0003s22030g             205   2e-59    Populus trichocarpa [western balsam poplar]
ref|XP_002512138.1|  beta-glucosidase, putative                         205   2e-59    Ricinus communis
gb|EAY94514.1|  hypothetical protein OsI_16286                          202   2e-59    Oryza sativa Indica Group [Indian rice]
ref|XP_011025248.1|  PREDICTED: beta-glucosidase 12-like                205   2e-59    Populus euphratica
emb|CAH67305.1|  OSIGBa0106G07.1                                        204   3e-59    Oryza sativa Indica Group [Indian rice]
ref|NP_001053071.1|  Os04g0474900                                       204   3e-59    
ref|XP_002987383.1|  hypothetical protein SELMODRAFT_235275             203   4e-59    Selaginella moellendorffii
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     204   5e-59    Beta vulgaris subsp. vulgaris [Swiss chard]
sp|Q7XKV4.2|BGL12_ORYSJ  RecName: Full=Beta-glucosidase 12; Short...    204   5e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006858818.1|  hypothetical protein AMTR_s00066p00171930          204   5e-59    Amborella trichopoda
ref|XP_002986009.1|  hypothetical protein SELMODRAFT_271823             204   6e-59    Selaginella moellendorffii
ref|XP_010673562.1|  PREDICTED: beta-glucosidase 24-like isoform X2     201   7e-59    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EEE62263.1|  hypothetical protein OsJ_17050                          202   7e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010265850.1|  PREDICTED: beta-glucosidase 12-like                204   7e-59    Nelumbo nucifera [Indian lotus]
ref|XP_008243590.1|  PREDICTED: beta-glucosidase 12-like                204   8e-59    
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                203   9e-59    Cicer arietinum [garbanzo]
gb|KDP25142.1|  hypothetical protein JCGZ_22677                         203   1e-58    Jatropha curcas
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             203   1e-58    Selaginella moellendorffii
gb|ABY48758.1|  glycosylhydrolase 1                                     203   1e-58    Leucaena leucocephala [cassie]
ref|XP_007133707.1|  hypothetical protein PHAVU_011G202000g             203   2e-58    Phaseolus vulgaris [French bean]
ref|XP_008450458.1|  PREDICTED: beta-glucosidase 12-like                202   2e-58    Cucumis melo [Oriental melon]
sp|Q7XKV5.2|BGL11_ORYSJ  RecName: Full=Beta-glucosidase 11; Short...    203   2e-58    Oryza sativa Japonica Group [Japonica rice]
emb|CAH66807.1|  OSIGBa0135C13.2                                        202   2e-58    Oryza sativa Indica Group [Indian rice]
gb|AAL93619.1|  beta-glucosidase                                        203   2e-58    Olea europaea subsp. europaea
emb|CAH66811.1|  OSIGBa0135C13.6                                        203   2e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_002973070.1|  hypothetical protein SELMODRAFT_98083              204   2e-58    Selaginella moellendorffii
ref|XP_010038524.1|  PREDICTED: beta-glucosidase 42                     201   3e-58    Eucalyptus grandis [rose gum]
ref|XP_004975941.1|  PREDICTED: beta-glucosidase 12-like                201   3e-58    
ref|NP_001268161.1|  beta-glucosidase precursor                         202   4e-58    Vitis vinifera
ref|XP_008789190.1|  PREDICTED: putative beta-glucosidase 41 isof...    199   4e-58    Phoenix dactylifera
ref|XP_008243585.1|  PREDICTED: beta-glucosidase 12-like isoform X2     202   4e-58    Prunus mume [ume]
gb|AAL07434.1|AF413213_1  prunasin hydrolase isoform PH C precursor     202   4e-58    Prunus serotina
ref|XP_004138903.1|  PREDICTED: beta-glucosidase 42-like                201   5e-58    Cucumis sativus [cucumbers]
ref|XP_010673561.1|  PREDICTED: beta-glucosidase 24-like isoform X1     202   5e-58    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAL35324.1|AF411131_1  prunasin hydrolase isoform PH C precursor     202   5e-58    Prunus serotina
ref|XP_007207700.1|  hypothetical protein PRUPE_ppa024193mg             201   6e-58    Prunus persica
gb|AHE74129.1|  prunasin hydrolase                                      201   1e-57    Prunus armeniaca
gb|EEC77464.1|  hypothetical protein OsI_16285                          201   1e-57    Oryza sativa Indica Group [Indian rice]
emb|CAH66810.1|  OSIGBa0135C13.5                                        201   1e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_007150405.1|  hypothetical protein PHAVU_005G150600g             200   1e-57    Phaseolus vulgaris [French bean]
emb|CBI27264.3|  unnamed protein product                                201   1e-57    Vitis vinifera
ref|XP_006652405.1|  PREDICTED: beta-glucosidase 12-like                200   2e-57    Oryza brachyantha
gb|KDP20205.1|  hypothetical protein JCGZ_07925                         200   2e-57    Jatropha curcas
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          200   2e-57    Phoenix dactylifera
gb|AFZ78537.1|  beta-glucosidase                                        200   2e-57    Populus tomentosa [Chinese white poplar]
sp|Q7F9K4.1|BGL10_ORYSJ  RecName: Full=Beta-glucosidase 10; Short...    200   2e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008226929.1|  PREDICTED: beta-glucosidase 12-like isoform X2     201   2e-57    Prunus mume [ume]
gb|AHE74130.1|  prunasin hydrolase                                      201   2e-57    Prunus armeniaca
ref|XP_003597481.1|  Beta-glucosidase D4                                200   2e-57    
sp|A3RF67.1|BAGBG_DALNI  RecName: Full=Isoflavonoid 7-O-beta-apio...    201   2e-57    
ref|XP_008243584.1|  PREDICTED: beta-glucosidase 12-like isoform X1     201   2e-57    
ref|XP_008352397.1|  PREDICTED: beta-glucosidase 12-like                197   2e-57    
gb|AES67732.2|  glycoside hydrolase family 1 protein                    200   2e-57    
ref|XP_008218497.1|  PREDICTED: beta-glucosidase 42                     199   2e-57    
ref|XP_010910031.1|  PREDICTED: beta-glucosidase 25 isoform X3          197   3e-57    
ref|XP_002276051.2|  PREDICTED: beta-glucosidase 12-like                199   3e-57    
gb|AHE74131.1|  prunasin hydrolase                                      200   3e-57    
ref|XP_007153535.1|  hypothetical protein PHAVU_003G043600g             198   3e-57    
emb|CBI24820.3|  unnamed protein product                                199   3e-57    
ref|XP_004151231.1|  PREDICTED: beta-glucosidase 12-like                197   3e-57    
ref|XP_008245635.1|  PREDICTED: beta-glucosidase 12-like isoform X2     200   3e-57    
gb|ACN41025.1|  unknown                                                 199   4e-57    
ref|XP_004975939.1|  PREDICTED: beta-glucosidase 12-like                199   4e-57    
ref|XP_002967460.1|  hypothetical protein SELMODRAFT_267120             199   4e-57    
ref|XP_007206410.1|  hypothetical protein PRUPE_ppa016757mg             197   4e-57    
ref|XP_009341389.1|  PREDICTED: beta-glucosidase 24-like                200   5e-57    
gb|ABY84677.1|  coniferrin beta glucosidase                             196   5e-57    
gb|KCW51254.1|  hypothetical protein EUGRSUZ_J00833                     198   6e-57    
ref|XP_007208268.1|  hypothetical protein PRUPE_ppa015721mg             192   6e-57    
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                199   7e-57    
ref|XP_003607795.1|  Beta-glucosidase                                   196   7e-57    
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     199   7e-57    
ref|XP_002277198.1|  PREDICTED: beta-glucosidase 12-like                198   7e-57    
gb|KJB80348.1|  hypothetical protein B456_013G093100                    198   8e-57    
gb|AFH35010.1|  prunasin hydrolase                                      199   8e-57    
ref|XP_008788338.1|  PREDICTED: beta-glucosidase 4                      197   8e-57    
gb|AER62658.1|  hypothetical protein                                    195   8e-57    
gb|AES89992.2|  beta-glucosidase                                        196   8e-57    
ref|XP_010911113.1|  PREDICTED: beta-glucosidase 13-like                193   1e-56    
gb|AAL07491.1|AF414608_1  prunasin hydrolase isoform PH I precursor     198   1e-56    
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          197   1e-56    
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                198   1e-56    
ref|XP_008226920.1|  PREDICTED: beta-glucosidase 12-like isoform X1     199   1e-56    
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             198   1e-56    
gb|EMS61699.1|  Beta-glucosidase 13                                     192   1e-56    
ref|XP_010267847.1|  PREDICTED: putative beta-glucosidase 41 isof...    196   1e-56    
ref|XP_011461905.1|  PREDICTED: beta-glucosidase 12-like                198   1e-56    
ref|XP_009417300.1|  PREDICTED: beta-glucosidase 12-like                197   1e-56    
gb|AFH35015.1|  prunasin hydrolase                                      198   1e-56    
gb|AAA93032.1|  prunasin hydrolase isoform PH I precursor               198   1e-56    
ref|XP_004154675.1|  PREDICTED: beta-glucosidase 12-like                197   1e-56    
gb|KDO81804.1|  hypothetical protein CISIN_1g0105881mg                  195   1e-56    
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          197   1e-56    
sp|Q5N863.1|BGL04_ORYSJ  RecName: Full=Beta-glucosidase 4; Short=...    197   2e-56    
ref|XP_006645170.1|  PREDICTED: beta-glucosidase 4-like                 197   2e-56    
gb|KGN66450.1|  hypothetical protein Csa_1G611270                       197   2e-56    
ref|XP_009415571.1|  PREDICTED: beta-glucosidase 24-like                197   2e-56    
ref|XP_003546991.1|  PREDICTED: beta-glucosidase 12-like                197   2e-56    
ref|XP_010908744.1|  PREDICTED: beta-glucosidase 4 isoform X1           197   2e-56    
ref|XP_008245634.1|  PREDICTED: beta-glucosidase 12-like isoform X1     198   2e-56    
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             196   2e-56    
ref|XP_002960254.1|  hypothetical protein SELMODRAFT_163827             197   2e-56    
ref|XP_007206638.1|  hypothetical protein PRUPE_ppa021137mg             198   2e-56    
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                197   2e-56    
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             197   3e-56    
ref|XP_007206830.1|  hypothetical protein PRUPE_ppa026448mg             197   3e-56    
gb|KCW51256.1|  hypothetical protein EUGRSUZ_J00833                     197   3e-56    
ref|XP_003607794.1|  Beta-glucosidase                                   197   3e-56    
ref|XP_008777215.1|  PREDICTED: beta-glucosidase 12-like isoform X1     194   3e-56    
gb|AHE74128.1|  prunasin hydrolase                                      197   3e-56    
gb|AER62657.1|  hypothetical protein                                    193   3e-56    
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                196   3e-56    
gb|EEC77467.1|  hypothetical protein OsI_16289                          197   3e-56    
ref|XP_010539264.1|  PREDICTED: putative beta-glucosidase 41 isof...    196   3e-56    
gb|AEZ01595.2|  myrosinase                                              197   3e-56    
ref|XP_008243663.1|  PREDICTED: beta-glucosidase 12-like                197   4e-56    
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     196   4e-56    
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    196   4e-56    
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                197   4e-56    
ref|XP_003615724.1|  Beta-glucosidase D7                                197   4e-56    
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  195   4e-56    
ref|XP_006360112.1|  PREDICTED: putative beta-glucosidase 41-like       196   4e-56    
gb|AER62644.1|  hypothetical protein                                    193   5e-56    
pdb|3U57|A  Chain A, Structures Of Alkaloid Biosynthetic Glucosid...    196   5e-56    
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 196   5e-56    
dbj|BAJ53147.1|  JHL23J11.2                                             196   5e-56    
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                197   5e-56    
pdb|4ATD|A  Chain A, Crystal Structure Of Native Raucaffricine Gl...    196   5e-56    
ref|XP_007217246.1|  hypothetical protein PRUPE_ppa003831mg             197   5e-56    
ref|XP_008233161.1|  PREDICTED: beta-glucosidase 12-like                193   5e-56    
sp|Q9SPP9.1|RG1_RAUSE  RecName: Full=Raucaffricine-O-beta-D-gluco...    197   5e-56    
ref|XP_008777216.1|  PREDICTED: beta-glucosidase 12-like isoform X2     194   5e-56    
ref|XP_010539263.1|  PREDICTED: putative beta-glucosidase 41 isof...    196   5e-56    
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                196   6e-56    
ref|XP_006393111.1|  hypothetical protein EUTSA_v10012352mg             196   6e-56    
gb|KHG19061.1|  Beta-glucosidase 40 -like protein                       194   6e-56    
gb|AES76414.2|  glycoside hydrolase family 1 protein                    196   6e-56    
gb|AAL06338.1|AF411928_1  prunasin hydrolase isoform PH B precursor     196   7e-56    
ref|XP_004295228.1|  PREDICTED: beta-glucosidase 12-like                196   7e-56    
ref|XP_011094149.1|  PREDICTED: raucaffricine-O-beta-D-glucosidas...    196   7e-56    
tpg|DAA44054.1|  TPA: hypothetical protein ZEAMMB73_095768              195   8e-56    
ref|XP_007203446.1|  hypothetical protein PRUPE_ppa022045mg             196   8e-56    
gb|AAL39079.1|AF411009_1  prunasin hydrolase isoform PH B precursor     196   8e-56    
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     196   9e-56    
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     196   9e-56    
ref|XP_011037887.1|  PREDICTED: beta-glucosidase 24-like                196   9e-56    
ref|XP_007208191.1|  hypothetical protein PRUPE_ppa020839mg             196   9e-56    
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          195   1e-55    
gb|AER62650.1|  hypothetical protein                                    192   1e-55    
ref|XP_008366162.1|  PREDICTED: beta-glucosidase 24-like                196   1e-55    
ref|XP_008778242.1|  PREDICTED: beta-glucosidase 12-like                193   1e-55    
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     195   1e-55    
dbj|BAP90525.1|  beta-primeverosidase                                   195   1e-55    
gb|AER62666.1|  hypothetical protein                                    192   1e-55    
ref|XP_003597483.1|  Beta-glucosidase D4                                194   1e-55    
gb|KEH26882.1|  glycoside hydrolase family 1 protein                    193   1e-55    
ref|XP_011018314.1|  PREDICTED: beta-glucosidase 40-like isoform X2     194   1e-55    
gb|AES67734.2|  glycoside hydrolase family 1 protein                    194   1e-55    
ref|XP_003579957.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    195   1e-55    
ref|XP_008339477.1|  PREDICTED: beta-glucosidase 13-like                196   1e-55    
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 195   1e-55    
ref|XP_008778226.1|  PREDICTED: beta-glucosidase 12-like isoform X2     193   1e-55    
gb|KEH26883.1|  glycoside hydrolase family 1 protein                    193   1e-55    
gb|AAL07435.1|AF413214_1  prunasin hydrolase isoform PH A precursor     195   1e-55    
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         195   2e-55    
gb|AER62662.1|  hypothetical protein                                    191   2e-55    
ref|XP_002448031.1|  hypothetical protein SORBIDRAFT_06g019880          193   2e-55    
gb|AER62651.1|  hypothetical protein                                    191   2e-55    
gb|AAF34650.1|AF221526_1  prunasin hydrolase isoform PHA precursor      195   2e-55    
ref|XP_001771505.1|  predicted protein                                  195   2e-55    
ref|XP_004244167.1|  PREDICTED: putative beta-glucosidase 41            194   2e-55    
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                194   2e-55    
ref|XP_003597482.1|  Beta-glucosidase D4                                194   2e-55    
ref|XP_010087360.1|  Beta-glucosidase 12                                199   2e-55    
ref|XP_003564837.1|  PREDICTED: beta-glucosidase 4                      194   2e-55    
ref|XP_002299251.1|  Cyanogenic beta-glucosidase precursor family...    194   3e-55    
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      194   3e-55    
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     194   3e-55    
ref|XP_007221103.1|  hypothetical protein PRUPE_ppa017484mg             194   3e-55    
ref|XP_008363403.1|  PREDICTED: beta-glucosidase 13-like                196   3e-55    
ref|XP_003579958.1|  PREDICTED: beta-glucosidase 12-like                194   3e-55    
ref|XP_010448307.1|  PREDICTED: putative beta-glucosidase 41 isof...    192   3e-55    
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                194   3e-55    
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    194   3e-55    
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    194   3e-55    
ref|NP_001049358.1|  Os03g0212800                                       194   4e-55    
ref|XP_002277408.1|  PREDICTED: beta-glucosidase 12                     194   4e-55    
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    193   4e-55    
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           194   4e-55    
ref|XP_004296343.1|  PREDICTED: beta-glucosidase 13-like                194   4e-55    
ref|XP_008241169.1|  PREDICTED: beta-glucosidase 12-like                194   4e-55    
ref|XP_007133712.1|  hypothetical protein PHAVU_011G202500g             194   4e-55    
ref|XP_008390168.1|  PREDICTED: beta-glucosidase 12-like                191   5e-55    
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                194   5e-55    
gb|KJB52661.1|  hypothetical protein B456_008G271500                    193   5e-55    
gb|AER62664.1|  hypothetical protein                                    190   5e-55    
ref|XP_007223153.1|  hypothetical protein PRUPE_ppa004368mg             194   5e-55    
ref|XP_003537946.1|  PREDICTED: beta-glucosidase 12-like                193   5e-55    
ref|XP_008245651.1|  PREDICTED: beta-glucosidase 12-like                194   5e-55    
gb|ACN29297.1|  unknown                                                 186   6e-55    
gb|KHN22076.1|  Beta-glucosidase 42                                     190   6e-55    
gb|EEC74750.1|  hypothetical protein OsI_10506                          194   6e-55    
ref|XP_011025247.1|  PREDICTED: beta-glucosidase 12-like                191   6e-55    
gb|AER62671.1|  hypothetical protein                                    190   6e-55    
ref|XP_009410331.1|  PREDICTED: beta-glucosidase 24-like isoform X3     191   7e-55    
ref|XP_003597509.1|  Beta-glucosidase D2                                193   7e-55    
gb|KJB52655.1|  hypothetical protein B456_008G271500                    190   7e-55    
ref|XP_004515053.1|  PREDICTED: beta-glucosidase 12-like isoform X1     193   7e-55    
emb|CBI24830.3|  unnamed protein product                                198   8e-55    
ref|XP_003599468.1|  Beta-glucosidase G4                                192   8e-55    
ref|XP_009357133.1|  PREDICTED: beta-glucosidase 12-like                193   8e-55    
ref|XP_010109366.1|  Beta-glucosidase 40                                193   8e-55    
gb|KFK33324.1|  hypothetical protein AALP_AA6G360500                    192   9e-55    
gb|AHC04401.1|  beta-glucosidase 1                                      193   9e-55    
gb|EPS70537.1|  hypothetical protein M569_04221                         191   9e-55    
ref|XP_008778225.1|  PREDICTED: beta-glucosidase 12-like isoform X1     193   9e-55    
gb|AFK35893.1|  unknown                                                 193   9e-55    
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40                     192   9e-55    
ref|XP_003620192.1|  Beta-glucosidase                                   192   9e-55    
gb|AER62652.1|  hypothetical protein                                    189   1e-54    
gb|KJB80347.1|  hypothetical protein B456_013G093000                    192   1e-54    
emb|CDP05824.1|  unnamed protein product                                192   1e-54    
gb|EEE58575.1|  hypothetical protein OsJ_09895                          193   1e-54    
emb|CDY20561.1|  BnaC07g12280D                                          192   1e-54    
ref|XP_009347257.1|  PREDICTED: beta-glucosidase 13-like                192   1e-54    
gb|AER62654.1|  hypothetical protein                                    189   1e-54    
ref|XP_010659318.1|  PREDICTED: beta-glucosidase 13-like                192   1e-54    
ref|XP_010448292.1|  PREDICTED: putative beta-glucosidase 41 isof...    193   1e-54    
dbj|BAG13451.1|  beta-glucosidase                                       193   1e-54    
emb|CBI24818.3|  unnamed protein product                                193   1e-54    
ref|XP_010448300.1|  PREDICTED: putative beta-glucosidase 41 isof...    193   1e-54    
gb|AER62656.1|  hypothetical protein                                    189   1e-54    
ref|NP_001146333.1|  hypothetical protein                               190   2e-54    
gb|KFK27066.1|  hypothetical protein AALP_AA8G330000                    192   2e-54    
gb|AER62653.1|  hypothetical protein                                    189   2e-54    
gb|AER62647.1|  hypothetical protein                                    189   2e-54    
ref|XP_010482862.1|  PREDICTED: putative beta-glucosidase 41 isof...    191   2e-54    
ref|XP_006652404.1|  PREDICTED: beta-glucosidase 10-like                192   2e-54    
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      192   2e-54    
ref|XP_002981889.1|  hypothetical protein SELMODRAFT_268527             192   2e-54    
gb|ACD65510.1|  beta-glucosidase D2                                     192   2e-54    
ref|XP_007131973.1|  hypothetical protein PHAVU_011G056000g             192   2e-54    
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                192   2e-54    
gb|AER62670.1|  hypothetical protein                                    189   2e-54    
emb|CBI23349.3|  unnamed protein product                                188   2e-54    
ref|XP_002305150.2|  hypothetical protein POPTR_0004s04080g             189   2e-54    
gb|AER62646.1|  hypothetical protein                                    189   2e-54    
ref|XP_004985214.1|  PREDICTED: beta-glucosidase 6-like                 192   2e-54    
ref|XP_006832850.1|  hypothetical protein AMTR_s00095p00053310          182   2e-54    
gb|AER62665.1|  hypothetical protein                                    188   2e-54    
gb|AER62659.1|  hypothetical protein                                    188   2e-54    
gb|KJB19196.1|  hypothetical protein B456_003G088100                    190   2e-54    
ref|XP_003620203.1|  Beta-glucosidase D4                                192   2e-54    
ref|XP_002964840.1|  hypothetical protein SELMODRAFT_83357              192   2e-54    
ref|XP_009341391.1|  PREDICTED: beta-glucosidase 13-like                192   2e-54    
ref|XP_006851185.1|  hypothetical protein AMTR_s00043p00189470          191   2e-54    
ref|XP_002870490.1|  glycosyl hydrolase family 1 protein                191   2e-54    
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     192   2e-54    
ref|XP_004490615.1|  PREDICTED: beta-glucosidase 12-like                192   3e-54    
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                192   3e-54    
ref|XP_008243664.1|  PREDICTED: beta-glucosidase 12-like                192   3e-54    
ref|XP_004514568.1|  PREDICTED: beta-glucosidase 42-like                191   3e-54    
ref|XP_009604747.1|  PREDICTED: beta-glucosidase 42                     191   3e-54    
ref|XP_002961770.1|  hypothetical protein SELMODRAFT_76748              192   3e-54    
gb|AER62667.1|  hypothetical protein                                    188   3e-54    
gb|AER62649.1|  hypothetical protein                                    188   3e-54    
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 191   3e-54    
ref|XP_008229698.1|  PREDICTED: beta-glucosidase 12-like                191   3e-54    
ref|XP_008218659.1|  PREDICTED: beta-glucosidase 12-like                192   3e-54    



>ref|XP_009757932.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=515

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG RLP+FT +EVK+VKGSID +GIN
Sbjct  290  KADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGKRLPKFTKEEVKMVKGSIDLLGIN  349

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYT +Y+YDP+  TP    YQ DWNVGFAY R GVPIGPRA+S+WLY+VPWGL+KAV YV
Sbjct  350  QYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAHSDWLYIVPWGLHKAVNYV  409

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP M L+ENGMDY GN+TL ++L DTKRI+YYKSYL ELK+ VD+GAN+ GYFAW
Sbjct  410  KERYGNPTMILAENGMDYAGNITLPKALYDTKRIAYYKSYLKELKKTVDEGANVIGYFAW  469

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SL+DNFEWR+GYTSRFGIVYV
Sbjct  470  SLVDNFEWRLGYTSRFGIVYV  490



>ref|XP_009600118.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=515

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNI+G RLP+FT +EVK+VKGSID +GIN
Sbjct  290  KADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNILGKRLPKFTKEEVKMVKGSIDLLGIN  349

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYT +Y+YDP+  TP    YQ DWNVGFAY R GVPIGPRA+S+WLY+VPWGL+KAV YV
Sbjct  350  QYTAYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAHSDWLYIVPWGLHKAVNYV  409

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP M L+ENGMDY GN+TL ++L DTKRI+YYKSYL ELK+ VD+GAN+ GYFAW
Sbjct  410  KERYGNPTMILAENGMDYAGNITLPKALYDTKRIAYYKSYLQELKKTVDEGANVIGYFAW  469

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SL+DNFEWR+GYTSRFGIVYV
Sbjct  470  SLVDNFEWRLGYTSRFGIVYV  490



>ref|XP_006341563.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=512

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG RLP+F+ +EVK+VKGS DYVGIN
Sbjct  287  KADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRLPKFSKEEVKMVKGSFDYVGIN  346

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYT++Y+YDP+  TP    YQ DWNVGFAY R GVPIGPRA+S WLY+VPWGLYKAV YV
Sbjct  347  QYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAHSYWLYIVPWGLYKAVNYV  406

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KE YGNP + L+ENGMDY GN+TL ++L+DTKRI YYKSYL +LK+ VDDGAN+ GYFAW
Sbjct  407  KEHYGNPTIILAENGMDYAGNITLPKALHDTKRIDYYKSYLQQLKKTVDDGANVIGYFAW  466

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEWR+GYTSRFGIVYV
Sbjct  467  SLLDNFEWRLGYTSRFGIVYV  487



>ref|NP_001234620.1| beta-mannosidase enzyme precursor [Solanum lycopersicum]
 gb|AAL37714.1|AF403444_1 beta-mannosidase enzyme [Solanum lycopersicum]
 gb|AAL37719.1|AF413204_1 beta-mannosidase [Solanum lycopersicum]
Length=514

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KADNYAAQRARDFH+GWFLHP+VYGEYPKTMQNIVG RLP+F+ +EVK+VKGS DYVGIN
Sbjct  289  KADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRLPKFSKEEVKMVKGSFDYVGIN  348

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYT++Y+YDP+  TP    YQ DWNVGFAY R GVPIGPRA+S WLY+VPWGLYKA+ YV
Sbjct  349  QYTSYYMYDPHYTTPQPLGYQQDWNVGFAYDRKGVPIGPRAHSYWLYIVPWGLYKAINYV  408

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KE YGNP + L+ENGMDY GN+TL ++L+DTKRI+YYKSYL +LK+ VDDGAN+ GYFAW
Sbjct  409  KEHYGNPTIILAENGMDYAGNITLPKALHDTKRINYYKSYLQQLKKTVDDGANVIGYFAW  468

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEWR+GYTSRFGIVYV
Sbjct  469  SLLDNFEWRLGYTSRFGIVYV  489



>gb|KHN23728.1| Beta-glucosidase 44 [Glycine soja]
Length=450

 Score =   332 bits (850),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN+AAQRARDFHIGWF+HP+VYGEYPKT+QNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  224  SKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRLPKFTSEEVKIVKGSIDFVGI  283

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTF++YDP+   P +  YQ DWN GFAYA+NGVPIGPRANS WLY VPWG+YK++ Y
Sbjct  284  NQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRANSYWLYNVPWGMYKSLIY  343

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  344  IKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  403

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  404  WSLLDNFEWRLGYTSRFGIVYV  425



>ref|XP_003534146.1| PREDICTED: beta-glucosidase 44 [Glycine max]
Length=506

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN+AAQRARDFHIGWF+HP+VYGEYPKT+QNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  280  SKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRLPKFTSEEVKIVKGSIDFVGI  339

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTF++YDP+   P +  YQ DWN GFAYA+NGVPIGPRANS WLY VPWG+YK++ Y
Sbjct  340  NQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRANSYWLYNVPWGMYKSLMY  399

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  400  IKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  459

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  460  WSLLDNFEWRLGYTSRFGIVYV  481



>ref|XP_006490742.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=519

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  293  SKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDFVGI  352

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPRANS WLY VPWG+YKA+ Y
Sbjct  353  NQYTAYYMYDPHLKKPKQVGYQQDWNAGFAYEKNGVPIGPRANSYWLYNVPWGMYKALMY  412

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  413  IKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  472

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  473  WSLLDNFEWRLGYTSRFGIVYV  494



>gb|KDP41124.1| hypothetical protein JCGZ_03615 [Jatropha curcas]
Length=516

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +E+K+VKGSIDYVGI
Sbjct  290  SKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTQEEIKIVKGSIDYVGI  349

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+   P    YQ DWN GFAY +NGV IGPRANS WLY VPWGLYKA+ Y
Sbjct  350  NQYTTYYMYDPHQSKPKDLGYQQDWNAGFAYEKNGVQIGPRANSYWLYNVPWGLYKALIY  409

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP +FLSENGMD  GN+TL + L+DT RI+YY+SYL +LK+ VDDGAN+ GYFA
Sbjct  410  IKERYGNPTVFLSENGMDDPGNVTLPKGLHDTTRINYYRSYLTQLKKAVDDGANVIGYFA  469

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  470  WSLLDNFEWRSGYTSRFGIVYV  491



>gb|KEH16707.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HP+VYGEYP+TMQNIVG+RLP+FT +EVKLVKGSID+VGI
Sbjct  289  SKADNYAAQRARDFHIGWFIHPLVYGEYPRTMQNIVGNRLPKFTKEEVKLVKGSIDFVGI  348

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+ + P +  YQ+DWN GFAYA+NGVP+GPRA S WLY VPWGLYK++ Y
Sbjct  349  NQYTTYYMYDPHNQKPKVPGYQSDWNAGFAYAKNGVPVGPRAYSYWLYNVPWGLYKSIMY  408

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE Y NP MFLSENGMD  GN+T ++ L+DT RI+YYK YL +LK+ +DDGAN+FGY A
Sbjct  409  IKEHYKNPTMFLSENGMDDPGNVTFSKGLHDTTRINYYKGYLTQLKKAIDDGANVFGYHA  468

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  469  WSLLDNFEWRLGYTSRFGIVYV  490



>ref|XP_007036680.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
 gb|EOY21181.1| B-S glucosidase 44 isoform 2 [Theobroma cacao]
Length=469

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  224  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGNRLPKFTKEEVKMVKGSIDFVGI  283

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+   P +  YQ DWN GFAYA+ GVPIGPRANS WLY VPWGLYKA+ Y
Sbjct  284  NQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPIGPRANSNWLYNVPWGLYKALMY  343

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI+YYK+YL +L++ VD GAN+ GYFA
Sbjct  344  IKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYYKAYLTQLRKAVDGGANVVGYFA  403

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  404  WSLLDNFEWRLGYTSRFGIVYV  425



>ref|XP_006451662.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
 gb|ESR64902.1| hypothetical protein CICLE_v10008010mg [Citrus clementina]
Length=519

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  293  SKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDFVGI  352

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPRANS WLY VPWG+YKA+ Y
Sbjct  353  NQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRANSYWLYNVPWGMYKALMY  412

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  413  IKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  472

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  473  WSLLDNFEWRLGYTSRFGIVYV  494



>gb|KCW83983.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=450

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  224  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGI  283

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT FY+YDP+     +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  284  NQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  343

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  344  IKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  403

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  404  WSLLDNFEWRSGYTSRFGIVYV  425



>gb|KCW83978.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT FY+YDP+     +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  406  IKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  466  WSLLDNFEWRSGYTSRFGIVYV  487



>gb|KDO62879.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
 gb|KDO62880.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=406

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  180  SKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDFVGI  239

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPRANS WLY VPWG+YKA+ Y
Sbjct  240  NQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRANSYWLYNVPWGMYKALMY  299

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K  YGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  300  IKGHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  359

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  360  WSLLDNFEWRLGYTSRFGIVYV  381



>gb|KCW83977.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT FY+YDP+     +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  406  IKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  466  WSLLDNFEWRSGYTSRFGIVYV  487



>gb|KCW83975.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83976.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT FY+YDP+     +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  406  IKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  466  WSLLDNFEWRSGYTSRFGIVYV  487



>ref|XP_007036681.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
 gb|EOY21182.1| B-S glucosidase 44 isoform 3 [Theobroma cacao]
Length=532

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  287  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGNRLPKFTKEEVKMVKGSIDFVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+   P +  YQ DWN GFAYA+ GVPIGPRANS WLY VPWGLYKA+ Y
Sbjct  347  NQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPIGPRANSNWLYNVPWGLYKALMY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI+YYK+YL +L++ VD GAN+ GYFA
Sbjct  407  IKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYYKAYLTQLRKAVDGGANVVGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  467  WSLLDNFEWRLGYTSRFGIVYV  488



>ref|XP_007036679.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
 gb|EOY21180.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
Length=513

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  287  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGNRLPKFTKEEVKMVKGSIDFVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+   P +  YQ DWN GFAYA+ GVPIGPRANS WLY VPWGLYKA+ Y
Sbjct  347  NQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYAKRGVPIGPRANSNWLYNVPWGLYKALMY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI+YYK+YL +L++ VD GAN+ GYFA
Sbjct  407  IKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYYKAYLTQLRKAVDGGANVVGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  467  WSLLDNFEWRLGYTSRFGIVYV  488



>ref|XP_010032608.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT FY+YDP+     +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAFYMYDPHQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  406  IKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  466  WSLLDNFEWRSGYTSRFGIVYV  487



>ref|XP_006376723.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
 gb|ERP54520.1| hypothetical protein POPTR_0012s04670g [Populus trichocarpa]
Length=546

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGS+D+VGI
Sbjct  320  SKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVGNRLPQFTKEEVKMVKGSMDFVGI  379

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFY+YDP+   P    YQ DWNVGFAY +NGVPIGPRANS WLY VPWG+YKAV Y
Sbjct  380  NQYTTFYMYDPHQPKPKYLGYQQDWNVGFAYKKNGVPIGPRANSNWLYNVPWGMYKAVMY  439

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN T +++L+DT R+ Y+K+YL +LK+  D+GANL GYFA
Sbjct  440  IKERYGNPTIILSENGMDDPGNFTRSKALHDTTRVGYFKAYLTQLKKAADEGANLAGYFA  499

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  500  WSLLDNFEWRSGYTSRFGIVYV  521



>gb|ACU24532.1| unknown [Glycine max]
Length=506

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN+AAQRARDFHIGWF+HP+VYGEYPKT+QNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  280  SKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRLPKFTSEEVKIVKGSIDFVGI  339

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTF++YDP+   P +  YQ DWN GFAYA+NGVPIGPRANS WLY V WG+YK++ Y
Sbjct  340  NQYTTFFIYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRANSYWLYNVLWGMYKSLMY  399

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  400  IKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  459

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  460  WSLLDNFEWRLGYTSRFGIVYV  481



>gb|KEH16706.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=514

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHPIVYGEYP+TMQ IVG+RLP+FT +EV LVKGSID+VGI
Sbjct  289  SKADNYAAQRARDFHIGWFLHPIVYGEYPRTMQTIVGNRLPKFTKEEVNLVKGSIDFVGI  348

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFYVYDP  + P +  YQ DWN  FAYA+NGVP+GPR  S WLY VPWGLYK+V Y
Sbjct  349  NQYTTFYVYDPRQQKPKVPGYQKDWNAEFAYAKNGVPVGPREYSSWLYNVPWGLYKSVMY  408

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE Y NP MFLSENGMD  GN+T ++ L+DT RI+YYK YL +LK+ +DDGAN+FGY A
Sbjct  409  IKEHYKNPTMFLSENGMDDPGNVTFSKGLHDTTRINYYKGYLTQLKKAIDDGANVFGYHA  468

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  469  WSLLDNFEWRLGYTSRFGIVYV  490



>ref|XP_011039106.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWF+HPIVYGEYPKTM+NIVG+RLP+FT +EV++VKGS+D+VGI
Sbjct  288  SKADNLAAQRARDFHIGWFIHPIVYGEYPKTMKNIVGNRLPQFTKEEVRMVKGSMDFVGI  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFY+YDP+   P    YQ DWNVGFAY +NGVPIGPRANS WLY VPWG+YKAV Y
Sbjct  348  NQYTTFYMYDPHQPKPKYLGYQQDWNVGFAYKKNGVPIGPRANSNWLYNVPWGMYKAVMY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN T +++L+DT RI Y+K+YL +LK+  D+GANL GYFA
Sbjct  408  IKERYGNPTIILSENGMDDPGNFTRSKALHDTTRIGYFKAYLTQLKKAADEGANLAGYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  468  WSLLDNFEWRSGYTSRFGIVYV  489



>gb|KDO62878.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=519

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  293  SKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDFVGI  352

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPRANS WLY VPWG+YKA+ Y
Sbjct  353  NQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRANSYWLYNVPWGMYKALMY  412

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K  YGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  413  IKGHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  472

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  473  WSLLDNFEWRLGYTSRFGIVYV  494



>ref|XP_004512738.1| PREDICTED: beta-glucosidase 44-like [Cicer arietinum]
Length=512

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HP+VYGEYP+TMQNIVG+RLP+FT +EVKLVKGSID+VGI
Sbjct  287  SKADNYAAQRARDFHVGWFIHPLVYGEYPRTMQNIVGNRLPKFTKEEVKLVKGSIDFVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+   P +  YQ DWNVGFAYA+NGVP+GPRA S WLY VPWGLYK++ Y
Sbjct  347  NQYTTYYMYDPHKSKPKVPGYQMDWNVGFAYAKNGVPVGPRAYSYWLYNVPWGLYKSLIY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN+T ++ L+DT RI+YYK YL++LK+ VDDGAN+ GY+A
Sbjct  407  IKEHYGNPTVILSENGMDDPGNVTFSKGLHDTTRINYYKGYLSQLKKAVDDGANVVGYYA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  467  WSLLDNFEWRLGYTSRFGIVYV  488



>ref|XP_009624185.1| PREDICTED: beta-glucosidase 44-like [Nicotiana tomentosiformis]
Length=513

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDF +GWFLHP++YGEYPKTMQNIVG+RLP+FT +E+K+VKGSIDYVGI
Sbjct  287  SKADNYAAQRARDFELGWFLHPLIYGEYPKTMQNIVGNRLPKFTKEEIKMVKGSIDYVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTTFY YD +   P    Y+ DWN  FAY R G PIGPRA+S+WLY+VPWGLYKAV Y
Sbjct  347  NHYTTFYAYDRHLSKPKALGYRQDWNCAFAYDRKGAPIGPRAHSDWLYIVPWGLYKAVNY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP + LSENGMDY GN++L E+L+DTKRI YY+SYLAELK+ +D GAN+ GYFA
Sbjct  407  VKEHYGNPTIVLSENGMDYAGNISLPEALHDTKRIDYYRSYLAELKKAIDKGANVIGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGI+YV
Sbjct  467  WSLLDNFEWRRGYTSRFGIIYV  488



>gb|KCW83979.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
 gb|KCW83980.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+ DP      +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  406  IKERYGNPTMILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  466  WSLLDNFEWRSGYTSRFGIVYV  487



>gb|AGV54748.1| beta-glucosidase 44-like protein [Phaseolus vulgaris]
Length=518

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HP+VYGEYPKT+Q IVG RLP+FT +EVK+VKGSID+VGI
Sbjct  292  SKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQEIVGQRLPKFTSEEVKIVKGSIDFVGI  351

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGPRANS WLY VPWG+YK++ Y
Sbjct  352  NQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRANSYWLYNVPWGIYKSLMY  411

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN+TL + L+DT RI+YYK YL  LK+ VDDGAN+ GYFA
Sbjct  412  IKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTNLKKAVDDGANVVGYFA  471

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  472  WSLLDNFEWRLGYTSRFGIVYV  493



>gb|KHN44611.1| Beta-glucosidase 44 [Glycine soja]
Length=406

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HP+VYGEYP T+QNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  180  SKADNLAAQRARDFHVGWFIHPLVYGEYPTTIQNIVGNRLPKFTSEEVKIVKGSIDFVGI  239

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGPRA S WLY VPWG+YK++ Y
Sbjct  240  NQYTTYYMYDPHQAKPKVPGYQMDWNAGFAYAKNGVPIGPRAYSYWLYNVPWGMYKSLMY  299

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  300  IKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  359

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  360  WSLLDNFEWRLGYTSRFGIVYV  381



>ref|XP_002322085.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
 gb|EEF06212.1| glycosyl hydrolase family 1 family protein [Populus trichocarpa]
Length=514

 Score =   326 bits (835),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+FT +EVK+VKGS+D+VGI
Sbjct  288  SKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKFTEEEVKMVKGSMDFVGI  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPRANS WLY VPWG+YKAV Y
Sbjct  348  NHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRANSYWLYNVPWGMYKAVMY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GNLT ++++ DT RI YYK+YL++LK+  DDGANL GYFA
Sbjct  408  IKERYGNPTMILSENGMDDPGNLTRSKAMQDTTRIGYYKAYLSQLKKAADDGANLVGYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  468  WSLLDNFEWRLGYTSRFGIVYV  489



>ref|XP_002322086.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
 gb|EEF06213.2| hypothetical protein POPTR_0015s04280g [Populus trichocarpa]
Length=515

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+FT +EVK+VKGS+D+VGI
Sbjct  289  SKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKFTEEEVKMVKGSMDFVGI  348

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPRANS WLY VPWG+YKAV Y
Sbjct  349  NHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRANSYWLYNVPWGMYKAVMY  408

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M LSENGMD  GNLT ++++ DT RI YYK+YL++LK+  DDGANL GYFA
Sbjct  409  IKERYGNPTMILSENGMDDPGNLTRSKAMQDTTRIGYYKAYLSQLKKAADDGANLVGYFA  468

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  469  WSLLDNFEWRLGYTSRFGIVYV  490



>ref|XP_007152698.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
 gb|ESW24692.1| hypothetical protein PHAVU_004G151800g [Phaseolus vulgaris]
Length=540

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HP+VYGEYPKT+Q IVG RLP+FT +EVK+VKGSID+VGI
Sbjct  314  SKADNYAAQRARDFHIGWFIHPLVYGEYPKTVQEIVGQRLPKFTSEEVKIVKGSIDFVGI  373

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGPRANS WLY VPWG+YK++ Y
Sbjct  374  NQYTTYYMYDPHQSKPKVPGYQMDWNAGFAYAKNGVPIGPRANSYWLYNVPWGIYKSLMY  433

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN+TL + L+DT RI+YYK YL  LK+ VDDGAN+ GYFA
Sbjct  434  IKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTNLKKAVDDGANVVGYFA  493

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  494  WSLLDNFEWRLGYTSRFGIVYV  515



>ref|XP_007209912.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
 gb|EMJ11111.1| hypothetical protein PRUPE_ppa004380mg [Prunus persica]
Length=513

 Score =   325 bits (834),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  287  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRLPKFTKEEVKMVKGSMDFVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+   P +  YQ DWN GFAY +NGVPIGPRA S WLY VPWGLYKA+TY
Sbjct  347  NQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNGVPIGPRAYSSWLYQVPWGLYKALTY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN T AE L+DT RI +YKSY+ +LK+ VD+GAN+ GYFA
Sbjct  407  IKEHYGNPPVILSENGMDNPGNWTRAEVLHDTTRIKFYKSYMIQLKKAVDEGANVLGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  467  WSLLDNFEWRLGYTSRFGIVYV  488



>ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine max]
Length=515

 Score =   325 bits (834),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HP+VYGEYP T+QNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  289  SKADNLAAQRARDFHVGWFIHPLVYGEYPTTIQNIVGNRLPKFTSEEVKIVKGSIDFVGI  348

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+   P +  YQ DWN GFAYA+NGVPIGPRA S WLY VPWG+YK++ Y
Sbjct  349  NQYTTYYMYDPHQAKPKVPGYQMDWNAGFAYAKNGVPIGPRAYSYWLYNVPWGMYKSLMY  408

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP +FLSENGMD  GN+TL + L+DT RI+YYK YL +LK+ VDDGAN+ GYFA
Sbjct  409  IKERYGNPTVFLSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAVDDGANVVGYFA  468

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  469  WSLLDNFEWRLGYTSRFGIVYV  490



>ref|XP_010314225.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Solanum lycopersicum]
Length=502

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 175/202 (87%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDF +GWFLHP+V+GEYPKTMQNIVG+RLP+FT +E+K+VKGSIDYVGI
Sbjct  277  SKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNIVGNRLPKFTTEEIKMVKGSIDYVGI  336

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTTFY YD   K   +  YQ D N GFA  RNGVPIGPRA+S WLY+VPWGLYKAV Y
Sbjct  337  NHYTTFYAYDHVSKLKAL-AYQQDQNCGFANDRNGVPIGPRAHSYWLYIVPWGLYKAVNY  395

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP + LSENGMDY GN++++E+L+DTKRI YY+SYLAELK+ +D+GAN+ GYFA
Sbjct  396  VKEHYGNPTILLSENGMDYAGNISISEALHDTKRIDYYRSYLAELKKAIDEGANVIGYFA  455

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  456  WSLLDNFEWRSGYTSRFGIVYV  477



>ref|XP_010243804.1| PREDICTED: beta-glucosidase 44-like [Nelumbo nucifera]
Length=518

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KAD  AAQRARDFH+GWFLHPIVYGEYPKT+QNIVG RLP+FT +EVK+VKGSID+VGIN
Sbjct  293  KADQQAAQRARDFHVGWFLHPIVYGEYPKTVQNIVGKRLPKFTDEEVKMVKGSIDFVGIN  352

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYTT+Y+YDP+        YQNDWN GFAYA+ GVPIGPRANS WLY VPWGLYKA+ Y+
Sbjct  353  QYTTYYMYDPHQTKKQPPGYQNDWNAGFAYAKKGVPIGPRANSYWLYEVPWGLYKALIYI  412

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP + LSENGMD  GN+TL + L+DT RI+YYKSYL ELK+ VD+GAN+ GYFAW
Sbjct  413  KERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKSYLLELKKAVDEGANVIGYFAW  472

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEWR+GYTSRFGIVYV
Sbjct  473  SLLDNFEWRLGYTSRFGIVYV  493



>ref|XP_010032621.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
 gb|KCW83984.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+ DP      +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  406  IKERYGNPPVILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  466  WSLLDNFEWRLGYTSRFGIVYV  487



>ref|XP_006353826.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=502

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDF +GWFLHP+VYGEYPKTMQNIV DRLP+FT DE+K+VKGSIDYVGI
Sbjct  279  SKADNYAAQRARDFELGWFLHPLVYGEYPKTMQNIVRDRLPKFTTDEIKMVKGSIDYVGI  338

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTTFY YD   K   +  YQ D N GFA  RNGVPIGPRA+S WLY+VPWGLYKAV Y
Sbjct  339  NHYTTFYAYDHLSKLKAL-AYQQDQNCGFANDRNGVPIGPRAHSYWLYIVPWGLYKAVNY  397

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP + LSENGMDY GN++L+++L+DTKRI YY+SYLA+LK+ +D+GAN+ GYFA
Sbjct  398  VKEHYGNPTILLSENGMDYAGNISLSDALHDTKRIDYYRSYLAKLKKAIDEGANVIGYFA  457

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  458  WSLLDNFEWRSGYTSRFGIVYV  479



>ref|XP_008374823.1| PREDICTED: beta-glucosidase 44-like [Malus domestica]
Length=513

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVGDRLP+FT +EVK+VKGS+DYVGI
Sbjct  287  SKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRLPKFTKEEVKMVKGSMDYVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+Y P P    +  YQ DWN GFAYA+NGVPIGPRA S WLY VPWGLYKAV Y
Sbjct  347  NQYTTYYMYHPKPSKSNVLGYQQDWNAGFAYAKNGVPIGPRAYSYWLYQVPWGLYKAVMY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN+TLAE L DT R ++Y+SY+ +LK+  DDGAN+ GYFA
Sbjct  407  IKEHYGNPPVILSENGMDDPGNVTLAEGLRDTTRANFYRSYITQLKKAADDGANVMGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  467  WSLLDNFEWRLGYTSRFGIVYV  488



>ref|XP_004252272.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Solanum lycopersicum]
Length=526

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 175/202 (87%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDF +GWFLHP+V+GEYPKTMQNIVG+RLP+FT +E+K+VKGSIDYVGI
Sbjct  301  SKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNIVGNRLPKFTTEEIKMVKGSIDYVGI  360

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTTFY YD   K   +  YQ D N GFA  RNGVPIGPRA+S WLY+VPWGLYKAV Y
Sbjct  361  NHYTTFYAYDHVSKLKAL-AYQQDQNCGFANDRNGVPIGPRAHSYWLYIVPWGLYKAVNY  419

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP + LSENGMDY GN++++E+L+DTKRI YY+SYLAELK+ +D+GAN+ GYFA
Sbjct  420  VKEHYGNPTILLSENGMDYAGNISISEALHDTKRIDYYRSYLAELKKAIDEGANVIGYFA  479

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  480  WSLLDNFEWRSGYTSRFGIVYV  501



>ref|XP_009347765.1| PREDICTED: beta-glucosidase 44-like [Pyrus x bretschneideri]
Length=513

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYPKT+Q IVGDRLP+FT +EVK+VKGS+DYVGI
Sbjct  287  SKADNLAAQRARDFHVGWFIHPIVYGEYPKTVQEIVGDRLPKFTKEEVKMVKGSMDYVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+Y P P       YQ DWN GFAYA+NGVPIGPRA S WLY VPWGLYKAV Y
Sbjct  347  NQYTTYYMYHPKPSKSNDLGYQQDWNAGFAYAKNGVPIGPRAYSYWLYQVPWGLYKAVMY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TLAE L DT R ++Y+SY+ +LK+  DDGAN+ GYFA
Sbjct  407  IKERYGNPPVILSENGMDDPGNVTLAEGLRDTTRANFYRSYITQLKKAADDGANVMGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  467  WSLLDNFEWRLGYTSRFGIVYV  488



>ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN64162.1| hypothetical protein Csa_1G042700 [Cucumis sativus]
Length=503

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHPIVYGEYP+T+QNIVG+RLP+FT +EVK+VKGSID VGI
Sbjct  277  SKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRLPKFTKEEVKMVKGSIDLVGI  336

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+ +   +  YQ DWN GFAY +NGVPIGPRA+S WLY VPWG+YKA+ Y
Sbjct  337  NQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGPRAHSYWLYNVPWGMYKALMY  396

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+ YGNP + LSENGMD  GN+TL + L+DT RI++YK YL +LK+ VDDGAN+ GYFA
Sbjct  397  VKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKGYLTQLKKAVDDGANVIGYFA  456

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  457  WSLLDNFEWRLGYTSRFGIVYV  478



>gb|KCW83981.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=512

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+ DP      +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI++YK YL +LK+ VDDGANL GYFA
Sbjct  406  IKERYGNPPVILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAVDDGANLVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGIVYV
Sbjct  466  WSLLDNFEWRSGYTSRFGIVYV  487



>ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=503

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHPIVYGEYP+T+QNIVG+RLP+FT +EVK+VKGSID VGI
Sbjct  277  SKADNYAAQRARDFHIGWFLHPIVYGEYPRTVQNIVGNRLPKFTKEEVKMVKGSIDLVGI  336

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+ +   +  YQ DWN GFAY +NGVPIGPRA+S WLY VPWG+YKA+ Y
Sbjct  337  NQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKNGVPIGPRAHSYWLYNVPWGMYKALMY  396

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+ YGNP + LSENGMD  GN+TL + L+DT RI++YK YL +LK+ VDDGAN+ GYFA
Sbjct  397  VKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKGYLTQLKKAVDDGANVIGYFA  456

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  457  WSLLDNFEWRLGYTSRFGIVYV  478



>ref|XP_010097587.1| Beta-glucosidase 44 [Morus notabilis]
 gb|EXB69119.1| Beta-glucosidase 44 [Morus notabilis]
Length=512

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHPIVYGEYP+T+Q IVG+RLP+FT ++VK+VKGSID+VGI
Sbjct  287  SKADNYAAQRARDFHIGWFLHPIVYGEYPRTIQEIVGERLPKFTKEQVKMVKGSIDFVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y+YDP+   P +  YQ DWNVGFAYA+NG  IGPRA SEWLY VP GLYK + Y
Sbjct  347  NQYTSYYMYDPHASKPKVLGYQQDWNVGFAYAKNGKLIGPRAYSEWLYQVPSGLYKCLMY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TLA+ L+DT R++YY+SYL +LK+  DDGAN+ GYFA
Sbjct  407  LKERYGNPTVILSENGMDDPGNVTLAQGLHDTTRVNYYRSYLLQLKKAADDGANVIGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFG+VYV
Sbjct  467  WSLLDNFEWRLGYTSRFGMVYV  488



>ref|XP_011000474.1| PREDICTED: beta-glucosidase 44-like [Populus euphratica]
Length=514

 Score =   323 bits (827),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+FT +EVK+VKGS+D+VGI
Sbjct  288  SKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGSRLPKFTEEEVKMVKGSMDFVGI  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y+YDP+   P    YQ DWN GFAY + GV IGPRA S WLY VPWG+YKAV Y
Sbjct  348  NHYTTYYMYDPHQSKPKNLGYQQDWNAGFAYKKKGVEIGPRAYSYWLYNVPWGMYKAVMY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GNLT +++L DT RI YYK+YL++LK+ VDDGANL GYFA
Sbjct  408  IKERYGNPTIILSENGMDDPGNLTRSKALQDTTRIGYYKAYLSQLKKAVDDGANLVGYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  468  WSLLDNFEWRLGYTSRFGIVYV  489



>gb|KDO50113.1| hypothetical protein CISIN_1g0406882mg, partial [Citrus sinensis]
Length=331

 Score =   317 bits (811),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHPI YGEYP+TMQ IVG+RLP+FT  EV++VKGSIDY+G+
Sbjct  106  SKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIVGERLPKFTDAEVEMVKGSIDYLGV  165

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFY++DP    P I  YQNDWNVGFAY R GVP+GPRANS WLY+VPWG+YKA+TY
Sbjct  166  NQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGVPVGPRANSGWLYIVPWGIYKAITY  225

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERY NP M L+ENGMD  GN+T  ++L+D  R++Y++ YL+ LK+ VDDGANL GYFA
Sbjct  226  VKERYQNPTMILAENGMDDPGNVTFPQALHDATRVNYFRDYLSYLKKAVDDGANLIGYFA  285

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTSRFGIVYV
Sbjct  286  WSLLDNFEWLSGYTSRFGIVYV  307



>ref|XP_009799689.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=513

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK DNYAAQRARDF +GWFLHP+VYGEYPKTMQNIVG+RLP+FT +EVK+VKGSIDYVGI
Sbjct  287  SKVDNYAAQRARDFELGWFLHPLVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDYVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTTFY +D +   P    Y+ DWN  FAY R GVPIGPRA+S+WLY+VPWGLYKAV Y
Sbjct  347  NHYTTFYAFDRHLSKPKALGYRQDWNCAFAYDRKGVPIGPRAHSDWLYIVPWGLYKAVNY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP + LSENGMDY GN++L E+L DTKR  YY+SYLAELK+ + +GAN+ GYFA
Sbjct  407  VKENYGNPTIILSENGMDYAGNISLPEALQDTKRTDYYRSYLAELKKAIVEGANVTGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR GYTSRFGI+YV
Sbjct  467  WSLLDNFEWRRGYTSRFGIIYV  488



>ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis]
Length=517

 Score =   321 bits (822),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG RLP+FT  EV++VKGSID+VGI
Sbjct  291  SKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGTRLPKFTKQEVEMVKGSIDFVGI  350

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+ DP+   P    YQ DW+ GFAY +NGVP+GP+ANS WLY VPWG+YKA+TY
Sbjct  351  NQYTTYYISDPHQAKPKYLGYQQDWDAGFAYEKNGVPVGPKANSYWLYNVPWGMYKALTY  410

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN+TL + L+DT RI+YYK YL ++K+ +DDGAN+ GYFA
Sbjct  411  IKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQMKKAIDDGANVVGYFA  470

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSL+DNFEWR GYTSRFGIVYV
Sbjct  471  WSLVDNFEWRSGYTSRFGIVYV  492



>ref|XP_008240180.1| PREDICTED: beta-glucosidase 44-like [Prunus mume]
Length=513

 Score =   320 bits (821),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+T+Q IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  287  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTIQEIVGDRLPKFTKEEVKMVKGSMDFVGI  346

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+   P +  YQ DWN GFAY +N VPIGPRA S WLY VPWGLYKA+TY
Sbjct  347  NQYTAYYMYDPHQSKPKVLGYQQDWNAGFAYKKNEVPIGPRAYSSWLYQVPWGLYKALTY  406

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD  GN T A+ L+DT RI +YKSY+ +LK+ VD+GAN+ GYFA
Sbjct  407  IKEHYGNPPVILSENGMDNPGNWTRAKGLHDTTRIKFYKSYIIQLKKAVDEGANVMGYFA  466

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFG+VYV
Sbjct  467  WSLLDNFEWRLGYTSRFGLVYV  488



>gb|EYU40222.1| hypothetical protein MIMGU_mgv1a004735mg [Erythranthe guttata]
Length=512

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HP+VYGEYPKTMQNIVG RLP+FT DEVK+VKGS D+VGI
Sbjct  286  SKADNYAAQRARDFHIGWFMHPLVYGEYPKTMQNIVGKRLPKFTKDEVKMVKGSFDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YD   + P    YQ DWN GFAY R+GVPIGPRA+S WLY+VPWGLYKAV Y
Sbjct  346  NQYTAYYIYDAKQENPKNLGYQQDWNSGFAYDRHGVPIGPRAHSYWLYIVPWGLYKAVNY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP M L+ENGMD  G LTL   LNDT RI+YYKSYL ELK+ +D+GAN+ GYF 
Sbjct  406  IKEHYGNPTMILAENGMDQPGELTLPAVLNDTIRINYYKSYLVELKKAIDEGANVEGYFQ  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            W+ +DNFEWR+GYTSRFGIVYV
Sbjct  466  WTFVDNFEWRLGYTSRFGIVYV  487



>emb|CAN74265.1| hypothetical protein VITISV_040977 [Vitis vinifera]
Length=506

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQR+RDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT  EVK+VKGS+D+VGI
Sbjct  282  SKADNLAAQRSRDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKAEVKMVKGSMDFVGI  341

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT +Y+YD P PK P    YQ DW+ GFAY ++GVPIGPRA S WLY VPWGLYKAVT
Sbjct  342  NQYTAYYMYDKPKPKVP---GYQEDWHAGFAYEKHGVPIGPRAYSSWLYKVPWGLYKAVT  398

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP + LSENGMD  GN+TL++ L+DTKR+++Y +YL ELK+ +DDGAN+ GYF
Sbjct  399  YIKERYGNPTVILSENGMDDPGNVTLSQGLHDTKRVNFYTNYLTELKKAIDDGANVIGYF  458

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEWR+GYTSRFGIVYV
Sbjct  459  AWSLLDNFEWRLGYTSRFGIVYV  481



>ref|XP_002281407.1| PREDICTED: beta-glucosidase 44 [Vitis vinifera]
 emb|CBI15543.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQR+RDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT  EVK+VKGS+D+VGI
Sbjct  283  SKADNLAAQRSRDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKAEVKMVKGSMDFVGI  342

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT +Y+YD P PK P    YQ DW+ GFAY ++GVPIGPRA S WLY VPWGLYKAVT
Sbjct  343  NQYTAYYMYDKPKPKVP---GYQEDWHAGFAYEKHGVPIGPRAYSSWLYKVPWGLYKAVT  399

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP + LSENGMD  GN+TL++ L+DTKR+++Y +YL ELK+ +DDGAN+ GYF
Sbjct  400  YIKERYGNPTVILSENGMDDPGNVTLSQGLHDTKRVNFYTNYLTELKKAIDDGANVIGYF  459

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEWR+GYTSRFGIVYV
Sbjct  460  AWSLLDNFEWRLGYTSRFGIVYV  482



>ref|XP_008462973.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=507

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWFLHPIVYGEYP+T+Q IVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  281  SKADNYAAQRARDFHVGWFLHPIVYGEYPRTVQEIVGNRLPKFTKEEVKMVKGSIDFVGI  340

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+ +   +  YQ DWN GFAY ++GVPIGPRA+S WLY VPWG+YKA+ Y
Sbjct  341  NQYTTYYMYDPHQRKAKVPGYQQDWNAGFAYEKHGVPIGPRAHSYWLYNVPWGMYKALMY  400

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+ YGNP + LSENGMD  GN+TL + L+DT RI++YK YL +LK+ VDDGAN+ GYFA
Sbjct  401  VKKYYGNPTVILSENGMDDPGNVTLPKGLHDTTRINFYKGYLTQLKKAVDDGANVVGYFA  460

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  461  WSLLDNFEWRLGYTSRFGIVYV  482



>gb|EPS65829.1| beta-mannosidase, partial [Genlisea aurea]
Length=472

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD+YAAQRARDFH+GWFLHP+VYGEYPKTMQNIV +RLP+FT  EVK+VKGS D+VG+
Sbjct  247  SKADSYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVSERLPKFTSREVKMVKGSFDFVGL  306

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y YD     P    YQ DWN GFAY RNG+PIGPRANS WLY+VPWGLYKAV+Y
Sbjct  307  NQYTAYYAYDAGRPNPTNKGYQQDWNCGFAYERNGIPIGPRANSYWLYIVPWGLYKAVSY  366

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GNLTL E+L D +RI YY+ Y+ ELKR VD+GAN+ GYF 
Sbjct  367  IKERYGNPTVILSENGMDQPGNLTLPEALRDRRRIDYYERYIGELKRAVDEGANVIGYFQ  426

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            W+ +DNFEWR+GYTSRFGIVYV
Sbjct  427  WTFVDNFEWRLGYTSRFGIVYV  448



>gb|KCW83982.1| hypothetical protein EUGRSUZ_B00859 [Eucalyptus grandis]
Length=513

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 174/203 (86%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYP+TMQNIVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQNIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+ DP      +  YQ DWN GFAYA+ GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAYYINDPNQPKAKVPGYQQDWNAGFAYAKLGVPIGPRAHSYWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKR-VVDDGANLFGYF  539
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI++YK YL +LK+  VDDGANL GYF
Sbjct  406  IKERYGNPPVILSENGMDDPGNVTLSQGLHDTTRINFYKGYLTQLKKAAVDDGANLVGYF  465

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEWR GYTSRFGIVYV
Sbjct  466  AWSLLDNFEWRSGYTSRFGIVYV  488



>gb|KCW83987.1| hypothetical protein EUGRSUZ_B00860 [Eucalyptus grandis]
Length=490

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  264  SKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGI  323

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+     +  YQ DWN G+A+ ++GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  324  NQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKHGVPIGPRAHSSWLYNVPWGLYKAVMY  383

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI++YK Y+ +LK+ VDDGAN+ GYFA
Sbjct  384  IKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINFYKGYITQLKKAVDDGANVVGYFA  443

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW+ GYTSRFGIVY+
Sbjct  444  WSLLDNFEWKSGYTSRFGIVYI  465



>ref|XP_006471035.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=507

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHPI YGEYP+TMQ IVG+RLP+FT  EV++VKGSIDY+G+
Sbjct  282  SKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIVGERLPKFTDAEVEMVKGSIDYLGV  341

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFY++DP    P I  YQNDWNVGFAY R GVP+GPRANS WLY+VPWG+YKA+TY
Sbjct  342  NQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGVPVGPRANSGWLYIVPWGIYKAITY  401

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERY NP M L+ENGMD  GN+T  ++L+D  R++Y++ YL+ LK+ VDDGANL GYFA
Sbjct  402  VKERYQNPTMILAENGMDDPGNVTFPQALHDATRVNYFRDYLSYLKKAVDDGANLIGYFA  461

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTSRFGIVYV
Sbjct  462  WSLLDNFEWLSGYTSRFGIVYV  483



>ref|XP_006431835.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
 gb|ESR45075.1| hypothetical protein CICLE_v10004010mg [Citrus clementina]
Length=506

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHPI YGEYP+TMQ IVG+RLP+FT  EV++VKGSIDY+G+
Sbjct  281  SKADNLAAQRARDFHIGWFLHPITYGEYPRTMQEIVGERLPKFTDAEVEMVKGSIDYLGV  340

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFY++DP    P I  YQNDWNVGFAY R GVP+GPRANS WLY+VPWG+YKA+TY
Sbjct  341  NQYTTFYMFDPPWPKPNITGYQNDWNVGFAYDRKGVPVGPRANSGWLYIVPWGIYKAITY  400

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERY NP M L+ENGMD  GN+T  ++L+D  R++Y++ YL+ LK+ VDDGANL GYFA
Sbjct  401  VKERYQNPTMILAENGMDDPGNVTFPQALHDATRVNYFRDYLSYLKKAVDDGANLIGYFA  460

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTSRFGIVYV
Sbjct  461  WSLLDNFEWLSGYTSRFGIVYV  482



>ref|XP_010032630.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=512

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYP+TMQ IVGDRLP+FT +EVK+VKGS+D+VGI
Sbjct  286  SKADNDAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKEEVKMVKGSMDFVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+     +  YQ DWN G+A+ ++GVPIGPRA+S WLY VPWGLYKAV Y
Sbjct  346  NQYTAYYMYDPHQPKAKVSGYQQDWNAGYAFEKHGVPIGPRAHSSWLYNVPWGLYKAVMY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI++YK Y+ +LK+ VDDGAN+ GYFA
Sbjct  406  IKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINFYKGYITQLKKAVDDGANVVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW+ GYTSRFGIVY+
Sbjct  466  WSLLDNFEWKSGYTSRFGIVYI  487



>emb|CDO98378.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK D+ AAQRARDFHIGWF+HP+VYGEYPK +QNIV DRLP+FT +EVK+VKGS DYVG+
Sbjct  224  SKEDSDAAQRARDFHIGWFMHPLVYGEYPKNLQNIVADRLPKFTKEEVKIVKGSFDYVGV  283

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+        YQ DWN GFAY RNGVPIGPRA+S+WLY VPWGLYKAV Y
Sbjct  284  NQYTAYYMYDPHRGQQKDLGYQQDWNCGFAYDRNGVPIGPRAHSDWLYKVPWGLYKAVMY  343

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+Y NP + L+ENGMD  GNLTL   L DT RISYYK+YLA+L++ +DDGAN+ GYFA
Sbjct  344  VKEKYQNPTIILAENGMDDPGNLTLPAGLKDTARISYYKAYLAQLRKTMDDGANVIGYFA  403

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  404  WSLLDNFEWRLGYTSRFGIVYV  425



>ref|XP_010533966.1| PREDICTED: beta-glucosidase 44-like [Tarenaya hassleriana]
Length=514

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIVGDRLP+F+ +EVK+VKGS+D+VGIN
Sbjct  288  KADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGDRLPKFSEEEVKMVKGSMDFVGIN  347

Query  186  QYTTFYVYDPY-PKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            QYTT+Y+YDP+    P    YQ DWN GFA+++ G PIGPRANS WLY VPWG+YKA+ Y
Sbjct  348  QYTTYYMYDPHLSNPPKYFGYQQDWNAGFAFSKKGKPIGPRANSYWLYNVPWGMYKALMY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP + LSENGMD  GN+TL++ L+DT RI +Y+ YL +LK+ VDDGAN+ GYFA
Sbjct  408  IKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRIGFYRGYLTQLKKAVDDGANVAGYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW++GYTSRFGIVYV
Sbjct  468  WSLLDNFEWKLGYTSRFGIVYV  489



>ref|XP_010686092.1| PREDICTED: beta-glucosidase 44-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   316 bits (810),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            K DNYAAQRARDFHIGWF+HPIVYGEYPKTMQ+IV DRLP+FT +EVK+VKGS+D+VGIN
Sbjct  291  KKDNYAAQRARDFHIGWFIHPIVYGEYPKTMQDIVKDRLPKFTTEEVKMVKGSMDFVGIN  350

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYTT+Y+Y+    T     YQ DW+ GF +++NGV IGPRANS WLY VPWGLYKA+ Y+
Sbjct  351  QYTTYYMYNQQINTTKPPGYQQDWHAGFNFSKNGVQIGPRANSYWLYEVPWGLYKAINYI  410

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP M LSENGMD  GN+TLAE L+DTKRI YY+SYL  LK+ +D+GAN+ GYFAW
Sbjct  411  KERYGNPTMILSENGMDDPGNVTLAEGLHDTKRIHYYRSYLVALKKTIDEGANVIGYFAW  470

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SL+DNFEWR+GYTSRFGIVYV
Sbjct  471  SLVDNFEWRLGYTSRFGIVYV  491



>ref|XP_006299658.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
 gb|EOA32556.1| hypothetical protein CARUB_v10015846mg [Capsella rubella]
Length=491

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV +RLP+FT +EV+++KGSID+VGI
Sbjct  264  SKADNDAAQRARDFHVGWFIHPIVYGEYPNTMQNIVKERLPKFTEEEVRMMKGSIDFVGI  323

Query  183  NQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ DP   TP  +  YQ DWNV F YA+NG PIGPRA SEWLY VPWG+YKA+ 
Sbjct  324  NQYTTYFMSDPKITTPPKNLGYQQDWNVAFNYAKNGTPIGPRAYSEWLYNVPWGMYKALM  383

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KE YGNP M LSENGMD  GN+TLA+ LNDT RISYY+ YLA+LK+ VDDGAN+ GYF
Sbjct  384  YIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRISYYRDYLAQLKKAVDDGANVTGYF  443

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  444  AWSLLDNFEWLSGYTSRFGIVYV  466



>ref|XP_011084444.1| PREDICTED: beta-glucosidase 44-like [Sesamum indicum]
Length=502

 Score =   315 bits (807),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HP+VYGEYPKTMQNIVG RLP+FT +EVK+VKGS D+VGI
Sbjct  276  SKADNYAAQRARDFHIGWFMHPLVYGEYPKTMQNIVGKRLPKFTKEEVKMVKGSFDFVGI  335

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YD          YQ DW  GFAY R+GVPIGPRA+S WLY+VPWGLYKAV Y
Sbjct  336  NQYTAYYMYDAKQTNSKDLGYQQDWQCGFAYDRHGVPIGPRAHSYWLYIVPWGLYKAVNY  395

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYGNP M L+ENGMD  GNLT+ + L+DT RI+YYKSYL ELK+ + DGAN+ GYF 
Sbjct  396  IKERYGNPTMILAENGMDQPGNLTIPKVLHDTVRINYYKSYLVELKKAIKDGANVVGYFQ  455

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            W+ +DNFEWR+GYTSRFGIVYV
Sbjct  456  WTFVDNFEWRLGYTSRFGIVYV  477



>ref|XP_010465882.1| PREDICTED: beta-glucosidase 44 [Camelina sativa]
Length=513

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HP+VYGEYPKTMQNIV DRLP+FT  EVK+VKGSIDYVGI
Sbjct  286  SKADNYAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKDRLPKFTAKEVKMVKGSIDYVGI  345

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+ +P+P T P    YQ DWNV F +A+ G PIGPRA+S WLY VPWG+YKA+ 
Sbjct  346  NQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGKPIGPRAHSTWLYNVPWGMYKALM  405

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YY+ YL  LK+  DDGAN+ GYF
Sbjct  406  YIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKKATDDGANVVGYF  465

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  466  AWSLLDNFEWLSGYTSRFGIVYV  488



>ref|XP_006644213.1| PREDICTED: beta-glucosidase 1-like [Oryza brachyantha]
Length=511

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLPRFT DE+++VKGSIDYVGI
Sbjct  286  STADQDAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPRFTADEIQMVKGSIDYVGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +YV D  P    I +Y +DW+  FAY RNGVPIGPRANS+WLY+VPWGLYKAVTY
Sbjct  346  NQYTAYYVRDQQPNATTIPSYSSDWHAAFAYERNGVPIGPRANSDWLYIVPWGLYKAVTY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+YGNP M LSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGAN  GYFA
Sbjct  406  VKEKYGNPTMLLSENGMDDPGNVTVAQGVHDTARVAYYRSYITKLKEAIDDGANCVGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WS+LDNFEW++GYTSRFG+VYV
Sbjct  466  WSMLDNFEWKLGYTSRFGLVYV  487



>ref|NP_001078176.1| beta glucosidase 43 [Arabidopsis thaliana]
 gb|ABE65945.1| glycosyl hydrolase family 1 protein [Arabidopsis thaliana]
 gb|AEE76043.1| beta glucosidase 43 [Arabidopsis thaliana]
Length=424

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLP+FT +EVK+VKGSID+VGI
Sbjct  197  SQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLPKFTEEEVKMVKGSIDFVGI  256

Query  183  NQYTTFYVYDP-YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ DP    TP    YQ DWNV F +A+NG PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  257  NQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALM  316

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y++ERYGNP M LSENGMD  GN+TL + LNDT R+ YY+ YL +LK+ VDDGANL GYF
Sbjct  317  YIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYF  376

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  377  AWSLLDNFEWLSGYTSRFGIVYV  399



>ref|XP_009394432.1| PREDICTED: beta-glucosidase 1-like [Musa acuminata subsp. malaccensis]
Length=511

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 173/203 (85%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK D  AAQR+RDFH+GWFLHPI+YGEYPK+MQ IV  RLP+FT +E+K+VKGSIDYVGI
Sbjct  283  SKDDQDAAQRSRDFHLGWFLHPIIYGEYPKSMQEIVQARLPKFTEEEIKMVKGSIDYVGI  342

Query  183  NQYTTFYVYDPY-PKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT +Y++DP+ PK      YQ+DWN GFA+ RNGVPIGPRA+SEWLY+VPWG+YKAVT
Sbjct  343  NQYTAYYMFDPHLPKQEKPTRYQSDWNAGFAFERNGVPIGPRAHSEWLYIVPWGMYKAVT  402

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKE YGNP + LSENGMD  GN+TL + L+DT RI+YY+SY+ ELK+ +DDGA + GYF
Sbjct  403  YVKEHYGNPTVILSENGMDDPGNVTLRQGLHDTTRINYYRSYITELKKAIDDGATVIGYF  462

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW+ GYTSRFGIVYV
Sbjct  463  AWSLLDNFEWKSGYTSRFGIVYV  485



>ref|XP_008810053.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=509

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 174/203 (86%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK D+ AAQRARDFH+GWFLHPI+YGEYPKTMQNIV +RLP+FT +EVK+V GSIDYVGI
Sbjct  283  SKDDHAAAQRARDFHLGWFLHPIIYGEYPKTMQNIVKERLPKFTVEEVKMVNGSIDYVGI  342

Query  183  NQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT +Y+YD +   P   T Y NDW+V FAYARNGVPIGPRA S+WLY+VPWG+YKAV+
Sbjct  343  NQYTAYYMYDSHLSEPQKPTRYANDWHVVFAYARNGVPIGPRAYSDWLYIVPWGMYKAVS  402

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKE Y NP M LSENGMD  GN+TL + L+DT RI+YYKSY+ ELK+ +DDGAN+ GYF
Sbjct  403  YVKEHYRNPTMILSENGMDDPGNMTLPKGLHDTTRINYYKSYITELKKAIDDGANVIGYF  462

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW++GYTSRFGIVYV
Sbjct  463  AWSLLDNFEWKLGYTSRFGIVYV  485



>gb|KFK39133.1| beta-glucosidase 44 [Arabis alpina]
Length=497

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HP+VYGEYPKTMQNIV +RLPRFT +EVK+VKGSID+VGI
Sbjct  270  SEADNDAAQRARDFHVGWFIHPVVYGEYPKTMQNIVKERLPRFTEEEVKMVKGSIDFVGI  329

Query  183  NQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ DP+  TP     YQ DWNV F +A+NG PIG RA+SEWLY VPWG+YKA+ 
Sbjct  330  NQYTTYFMSDPHLSTPPKDLGYQQDWNVAFNFAKNGTPIGSRAHSEWLYNVPWGMYKALM  389

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KE YGNP M LSENGMD  GN+TLA+ LNDT R +YY+ YL +LK+ VDDGANL GYF
Sbjct  390  YIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRTNYYRDYLLQLKKAVDDGANLTGYF  449

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  450  AWSLLDNFEWLSGYTSRFGIVYV  472



>gb|KJB34273.1| hypothetical protein B456_006G057000 [Gossypium raimondii]
 gb|KJB34274.1| hypothetical protein B456_006G057000 [Gossypium raimondii]
Length=506

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD YAAQRA DFH+GWF+HP+VYGEYP+TMQ I G+RLP+FT +EVK+VKGS D+VGI
Sbjct  280  SKADRYAAQRAIDFHVGWFIHPLVYGEYPRTMQVIAGNRLPKFTKEEVKMVKGSFDFVGI  339

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+YDP+   P +  YQ DWN GFAYA+ GV IGPRA S WLY VPWGLYK + Y
Sbjct  340  NQYTTYYIYDPHQSKPKVPGYQQDWNAGFAYAKRGVAIGPRAYSPWLYNVPWGLYKCLMY  399

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+YGNP + LSENGMD  GN+TLA+ L+DT R++YYK+YL +LK+ VD+GAN+ GYFA
Sbjct  400  IKEKYGNPTVILSENGMDDPGNVTLAQGLHDTTRMNYYKAYLTQLKKAVDNGANVIGYFA  459

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIVYV
Sbjct  460  WSLLDNFEWRLGYTSRFGIVYV  481



>ref|XP_010487722.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV DRLP+FT +EVK+VKGSIDYVGI
Sbjct  286  SKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKDRLPKFTAEEVKMVKGSIDYVGI  345

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+ +P+  T P    YQ DWNV F +A+ G PIGPRA+S WLY VPWG+YKA+ 
Sbjct  346  NQYTTYYMSEPHFTTKPKDLGYQQDWNVQFGFAKLGKPIGPRAHSTWLYNVPWGMYKALM  405

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YY+ YL  LK+  DDGAN+ GYF
Sbjct  406  YIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKKATDDGANVVGYF  465

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  466  AWSLLDNFEWLSGYTSRFGIVYV  488



>dbj|BAB02019.1| beta-glucosidase [Arabidopsis thaliana]
Length=495

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLP+FT +EVK+VKGSID+VGI
Sbjct  268  SQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLPKFTEEEVKMVKGSIDFVGI  327

Query  183  NQYTTFYVYDP-YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ DP    TP    YQ DWNV F +A+NG PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  328  NQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALM  387

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y++ERYGNP M LSENGMD  GN+TL + LNDT R+ YY+ YL +LK+ VDDGANL GYF
Sbjct  388  YIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYF  447

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  448  AWSLLDNFEWLSGYTSRFGIVYV  470



>ref|XP_004299545.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 172/204 (84%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD YAAQRARDFH+GWF+HPIVYGEYPKT+QNIVG+RLP+FT +EVK+VKGS+D+VGI
Sbjct  284  SKADRYAAQRARDFHVGWFIHPIVYGEYPKTIQNIVGNRLPKFTKEEVKMVKGSMDFVGI  343

Query  183  NQYTTFYVYDPYPKTPYIHT--YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAV  356
            N+YT +Y+Y P       +   YQNDWN GFAY +NGVPIGPRA S WLY VPWG+YK +
Sbjct  344  NEYTAYYIYAPDKNQTKSNALGYQNDWNAGFAYEKNGVPIGPRAYSSWLYQVPWGMYKCI  403

Query  357  TYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            TY+KE YGNP + LSENGMD  GN TL ++L+DT RI YY+SYL +LK+ VD+GAN+ GY
Sbjct  404  TYIKEHYGNPPVILSENGMDNPGNQTLPKALHDTNRIHYYRSYLEQLKKAVDEGANVVGY  463

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEWR+GYTSRFGIVYV
Sbjct  464  FAWSLLDNFEWRLGYTSRFGIVYV  487



>ref|NP_188435.2| beta glucosidase 43 [Arabidopsis thaliana]
 sp|Q9LV34.2|BGL43_ARATH RecName: Full=Beta-glucosidase 43; Short=AtBGLU43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE76042.1| beta glucosidase 43 [Arabidopsis thaliana]
Length=501

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HPIVYGEYP T+QNIV +RLP+FT +EVK+VKGSID+VGI
Sbjct  274  SQADNDAAQRARDFHVGWFIHPIVYGEYPNTLQNIVKERLPKFTEEEVKMVKGSIDFVGI  333

Query  183  NQYTTFYVYDP-YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ DP    TP    YQ DWNV F +A+NG PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  334  NQYTTYFMSDPKISTTPKDLGYQQDWNVTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALM  393

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y++ERYGNP M LSENGMD  GN+TL + LNDT R+ YY+ YL +LK+ VDDGANL GYF
Sbjct  394  YIEERYGNPTMILSENGMDDPGNITLTQGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYF  453

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  454  AWSLLDNFEWLSGYTSRFGIVYV  476



>ref|XP_002883106.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59365.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFH+GWF+HPIVYGEYP TMQNIV +RLP+F  +EVK+VKGSID+VGI
Sbjct  276  SKADNDAAQRARDFHVGWFIHPIVYGEYPYTMQNIVKERLPKFAEEEVKMVKGSIDFVGI  335

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ DP   T P    YQ DWNV F +A+NG PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  336  NQYTTYFMSDPKISTIPKDLGYQQDWNVTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALM  395

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TL +  NDT RI YY+ YLA+LK+ VDDGANL GYF
Sbjct  396  YIKERYGNPTMILSENGMDDPGNITLTQGQNDTTRIKYYRDYLAQLKKAVDDGANLTGYF  455

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  456  AWSLLDNFEWLSGYTSRFGIVYV  478



>ref|XP_010506359.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV +RLP+FT +EVK+VKGSIDYVGI
Sbjct  286  SKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTAEEVKMVKGSIDYVGI  345

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+ +P+P T P    YQ DWNV F +A+ G  IGPRA+S WLY VPWG+YKA+ 
Sbjct  346  NQYTTYYMSEPHPTTKPKDLGYQQDWNVQFGFAKLGKLIGPRAHSTWLYNVPWGMYKALM  405

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YY+ YL  LK+  DDGAN+ GYF
Sbjct  406  YMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKKATDDGANVVGYF  465

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  466  AWSLLDNFEWLSGYTSRFGIVYV  488



>ref|XP_010487721.1| PREDICTED: beta-glucosidase 43 [Camelina sativa]
Length=504

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HPIVYG+YP TMQNIV +RLP+FT +EVK+VKGSID++GI
Sbjct  277  SEADNDAAQRARDFHVGWFIHPIVYGKYPNTMQNIVKERLPKFTEEEVKMVKGSIDFIGI  336

Query  183  NQYTTFYVYDPYPKTP-YIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ DP   TP     YQ DWNV F +A+NG PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  337  NQYTTYFMSDPKISTPPKALGYQQDWNVAFNFAKNGTPIGPRAHSEWLYNVPWGMYKALM  396

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KE YGNP M LSENGMD  GN+TLA+ LNDT RI+YY+ YLA+LK+ VD+GAN+ GYF
Sbjct  397  YIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRINYYRDYLAQLKKAVDEGANVTGYF  456

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  457  AWSLLDNFEWLSGYTSRFGIVYV  479



>gb|ABC55716.1| beta-mannosidase 3 [Oncidium hybrid cultivar]
Length=491

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWFLHPI+YGEYPK++Q+IV +RLP FT +E+ LVKGS+DY+G+
Sbjct  266  STDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLPTFTAEEISLVKGSVDYLGV  325

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y++DP+  T     YQ DWNVGFAY RNGVPIGPRANSEWLY+VPWG+YKAVTY
Sbjct  326  NQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRANSEWLYIVPWGMYKAVTY  385

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE Y NP + LSENGMD  GN++L   L+DT R++YYKSY++ELKR +DDGA + GYFA
Sbjct  386  VKENYQNPTIILSENGMDDPGNVSLKVGLHDTTRLNYYKSYISELKRAIDDGATVIGYFA  445

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW+ GYTSRFGIVYV
Sbjct  446  WSLLDNFEWKSGYTSRFGIVYV  467



>gb|EEE54664.1| hypothetical protein OsJ_01954 [Oryza sativa Japonica Group]
Length=427

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKGSIDYVGI
Sbjct  202  STADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKGSIDYVGI  261

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +YV D  P    + +Y +DW+    Y R+GVPIGPRANS+WLY+VPWGLYKAVTY
Sbjct  262  NQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANSDWLYIVPWGLYKAVTY  321

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+YGNP MFLSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGAN  GYFA
Sbjct  322  VKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAIDDGANCIGYFA  381

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW++GYTSRFG+VYV
Sbjct  382  WSLLDNFEWKLGYTSRFGLVYV  403



>ref|XP_004299546.1| PREDICTED: beta-glucosidase 44-like [Fragaria vesca subsp. vesca]
Length=513

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 171/204 (84%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK D  AAQRARDFHIGWF+HPIVYGEYPKTMQ+IVGDRLP+FT +EVK+VKGSID+VGI
Sbjct  285  SKDDRDAAQRARDFHIGWFIHPIVYGEYPKTMQHIVGDRLPKFTKEEVKMVKGSIDFVGI  344

Query  183  NQYTTFYVYDPYPKT--PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAV  356
            NQYT +Y+YDP+     P    YQNDWN GFA+ +NGV IGP+A S WLY VPWGLYK V
Sbjct  345  NQYTAYYMYDPHQNKTKPNALGYQNDWNAGFAFEKNGVLIGPQAYSSWLYQVPWGLYKCV  404

Query  357  TYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            TY+K+ YGNP + +SENGMD  GN TL E+L+DT RI +Y+SYL +LK+ VD+GAN+ GY
Sbjct  405  TYIKKNYGNPTVIISENGMDNPGNQTLQEALHDTNRIDFYRSYLEQLKKAVDEGANVVGY  464

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEWR+GYTSRFGIVYV
Sbjct  465  FAWSLLDNFEWRLGYTSRFGIVYV  488



>emb|CDX95558.1| BnaC01g34500D [Brassica napus]
Length=493

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 171/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQ+IV +RLP+FT +EVKLVKGSID+VGI
Sbjct  267  SEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQDIVKERLPKFTEEEVKLVKGSIDFVGI  326

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  327  NQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSEWLYNVPWGMYKAMM  386

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKE YGNP M LSENGMD  GN+T A+ +NDT RI+YY+ YL +LK+ VDDGAN+ GYF
Sbjct  387  YVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKAVDDGANVTGYF  446

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  447  AWSLLDNFEWLSGYTSRFGIVYV  469



>ref|XP_002883107.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59366.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWF+HPIVYGEYPKTMQNIV +RLP+FT +EVK+VKGSID+VGI
Sbjct  286  SKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTKEEVKMVKGSIDFVGI  345

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+ +P+P T P    YQ DWNV F +A+ G PIGPRA S WLY VPWG+YKA+ 
Sbjct  346  NQYTTYYMSEPHPTTKPKALGYQQDWNVDFGFAKLGKPIGPRAYSYWLYNVPWGMYKALM  405

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL  LK+  DDGAN+ GYF
Sbjct  406  YMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTNLKKARDDGANVVGYF  465

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  466  AWSLLDNFEWLSGYTSRFGIVYV  488



>ref|NP_188436.1| beta-glucosidase 44 [Arabidopsis thaliana]
 sp|Q9LV33.1|BGL44_ARATH RecName: Full=Beta-glucosidase 44; Short=AtBGLU44; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02020.1| beta-glucosidase [Arabidopsis thaliana]
 gb|AAM61427.1| beta-glucosidase, putative [Arabidopsis thaliana]
 dbj|BAH19552.1| AT3G18080 [Arabidopsis thaliana]
 dbj|BAH19607.1| AT3G18080 [Arabidopsis thaliana]
 gb|AEE76044.1| beta-glucosidase 44 [Arabidopsis thaliana]
Length=512

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWF+HP+VYGEYPKTMQNIV +RLP+FT  EVK+VKGSID+VGI
Sbjct  285  SKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKERLPKFTEKEVKMVKGSIDFVGI  344

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+ +P+P T P    YQ DWNV F +A+ G PIGPRA S WLY VPWG+YKA+ 
Sbjct  345  NQYTTYYMSEPHPTTKPKDLGYQQDWNVEFGFAKLGKPIGPRAYSSWLYNVPWGMYKALM  404

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL  LK+  DDGAN+ GYF
Sbjct  405  YMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTNLKKARDDGANVVGYF  464

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  465  AWSLLDNFEWLSGYTSRFGIVYV  487



>ref|XP_006297463.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
 gb|EOA30361.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
Length=511

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWF+HPIVYGEYPKTMQNIV +RLP+FT DEVK+VKGSID+VGI
Sbjct  284  SKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTADEVKMVKGSIDFVGI  343

Query  183  NQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+ +P+P T      YQ DWNV F +A+ G PIG RA S+WLY VPWG+YKA+ 
Sbjct  344  NQYTTYYMSEPHPTTKSKDLGYQQDWNVEFGFAKLGKPIGSRAYSKWLYNVPWGMYKALM  403

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YY+ YL  LK+  DDGAN+ GYF
Sbjct  404  YMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKKARDDGANVVGYF  463

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  464  AWSLLDNFEWLSGYTSRFGIVYV  486



>ref|NP_001043156.1| Os01g0508000 [Oryza sativa Japonica Group]
 sp|Q5QMT0.1|BGL01_ORYSJ RecName: Full=Beta-glucosidase 1; Short=Os1bglu1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD73293.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF05070.1| Os01g0508000 [Oryza sativa Japonica Group]
Length=516

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKGSIDYVGI
Sbjct  291  STADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKGSIDYVGI  350

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +YV D  P    + +Y +DW+    Y R+GVPIGPRANS+WLY+VPWGLYKAVTY
Sbjct  351  NQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANSDWLYIVPWGLYKAVTY  410

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+YGNP MFLSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGAN  GYFA
Sbjct  411  VKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAIDDGANCIGYFA  470

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW++GYTSRFG+VYV
Sbjct  471  WSLLDNFEWKLGYTSRFGLVYV  492



>gb|EAY74244.1| hypothetical protein OsI_02124 [Oryza sativa Indica Group]
Length=516

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AAQR+RDFH+GWFLHPI+YGEYPK++Q IV +RLP+FT DEV +VKGSIDYVGI
Sbjct  291  STADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKGSIDYVGI  350

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +YV D  P    + +Y +DW+    Y R+GVPIGPRANS+WLY+VPWGLYKAVTY
Sbjct  351  NQYTAYYVRDQQPNATTLPSYSSDWHAAPIYERDGVPIGPRANSDWLYIVPWGLYKAVTY  410

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+YGNP MFLSENGMD  GN+T+A+ ++DT R++YY+SY+ +LK  +DDGAN  GYFA
Sbjct  411  VKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAIDDGANCIGYFA  470

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW++GYTSRFG+VYV
Sbjct  471  WSLLDNFEWKLGYTSRFGLVYV  492



>ref|XP_009113531.1| PREDICTED: beta-glucosidase 43 [Brassica rapa]
Length=498

 Score =   307 bits (787),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLP FT +EVK+VKGSID+VGI
Sbjct  272  SEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVKMVKGSIDFVGI  331

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  332  NQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSEWLYNVPWGMYKAMM  391

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKE YGNP M LSENGMD  GN+T A+ +NDT RI+YY+ YL +LK+ V+DGAN+ GYF
Sbjct  392  YVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKAVEDGANVTGYF  451

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  452  AWSLLDNFEWLSGYTSRFGIVYV  474



>emb|CDY18494.1| BnaA01g27010D [Brassica napus]
Length=524

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S+ADN AAQRARDFH+GWF+HPIVYGEYPKTMQNIV +RLP FT +EVK+VKGSID+VGI
Sbjct  298  SEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVKMVKGSIDFVGI  357

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+Y+  P+P   P    YQ DWNV F +A++G PIGPRA+SEWLY VPWG+YKA+ 
Sbjct  358  NQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDGKPIGPRAHSEWLYNVPWGMYKAMM  417

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKE YGNP M LSENGMD  GN+T A+ +NDT RI+YY+ YL +LK+ V+DGAN+ GYF
Sbjct  418  YVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKAVEDGANVTGYF  477

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  478  AWSLLDNFEWLSGYTSRFGIVYV  500



>gb|ABC55718.1| beta-mannosidase 1 [Oncidium hybrid cultivar]
Length=491

 Score =   307 bits (786),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWFLHPI+YGEYPK++Q+IV +RL  FT +E+ LVKGS+DY+G+
Sbjct  266  STDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLLTFTAEEISLVKGSVDYLGV  325

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y++DP+  T     YQ DWNVGFAY RNGVPIGPRANSEWLY+VPWG+YKAVTY
Sbjct  326  NQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERNGVPIGPRANSEWLYIVPWGMYKAVTY  385

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE Y NP + LSENGMD  GN++L   L+DT R++YYKSY++ELKR +DDGA + GYFA
Sbjct  386  VKENYQNPTIILSENGMDDPGNVSLKVGLHDTTRLNYYKSYISELKRAIDDGATVIGYFA  445

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW+ GYTSRFGIVYV
Sbjct  446  WSLLDNFEWKSGYTSRFGIVYV  467



>ref|XP_007033088.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOY04014.1| Beta-glucosidase 44 [Theobroma cacao]
Length=511

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KADNYAAQRARDFHIGWFLHP+VYGEYPKTMQNIVG+RLP+F+  +V+ VK S D++GIN
Sbjct  286  KADNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKFSKSDVETVKNSFDFIGIN  345

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
             YT+FY+YDP+   P +  YQ DWNVGFA+ R G PIG RA+S WLY VPWG+YKAVTYV
Sbjct  346  HYTSFYMYDPHQPKPNVTGYQQDWNVGFAFERWGEPIGRRAHSGWLYQVPWGIYKAVTYV  405

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP + L+ENGMD  GN+T  E+L D +R++YY+SYL ELKR +DDGAN+ GYFAW
Sbjct  406  KERYGNPNVILAENGMDNPGNVTFPEALFDRERVNYYRSYLKELKRAMDDGANVTGYFAW  465

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEW +GY+SRFG+VYV
Sbjct  466  SLLDNFEWLLGYSSRFGMVYV  486



>ref|XP_006430656.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
 gb|ESR43896.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
Length=520

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+EV +VKGS DY+G+
Sbjct  295  SKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEEVAMVKGSYDYLGV  354

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG RANSEWLY+VPWGLY A+ Y
Sbjct  355  NQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANSEWLYIVPWGLYNALMY  414

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERYGNP + LSENGMD   N TL   L+DT RI+YY+ Y+++LK+ +DDGAN+ GYFA
Sbjct  415  VKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYISQLKKAIDDGANVTGYFA  474

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW +GYT+RFGI YV
Sbjct  475  WSLLDNFEWLLGYTARFGITYV  496



>gb|KJB16857.1| hypothetical protein B456_002G251100 [Gossypium raimondii]
Length=337

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHP+VYG+YP+TMQ IV +RLP+FT  EV+ VK S D + +
Sbjct  111  SKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVRERLPKFTKSEVEKVKNSFDVLCL  170

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y+Y+P+     +  YQ DWN GFAY RNGVPIG RA+SEWLY VPWG+YKAVTY
Sbjct  171  NHYTSYYIYEPHQPPSNVTGYQQDWNAGFAYERNGVPIGRRAHSEWLYEVPWGMYKAVTY  230

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+RYG+P + LSENGMD  GNLT  ESL D  R+S+Y+SYL ELKR +DDGAN+ GYFA
Sbjct  231  VKKRYGSPNIILSENGMDDPGNLTFPESLYDINRVSFYRSYLKELKRAMDDGANVTGYFA  290

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WS+LDNFEW +GYTSRFG+VYV
Sbjct  291  WSILDNFEWLLGYTSRFGLVYV  312



>ref|XP_007033096.1| B-S glucosidase 44 [Theobroma cacao]
 gb|EOY04022.1| B-S glucosidase 44 [Theobroma cacao]
Length=514

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD YAAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLP+FT DE+K+V GS+DYVGI
Sbjct  289  SKADEYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGERLPKFTKDEIKMVNGSMDYVGI  348

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ Y+YDP    P +  YQ DWN GFA A+NGV IGP+ANS WLY+VPWG+YK VTY
Sbjct  349  NHYTSTYIYDPKQPKPNVTGYQADWNAGFANAKNGVQIGPKANSWWLYIVPWGMYKTVTY  408

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGN  +F+SENGMD  GN TL  +LNDT RI+++K Y+ +LK+ +DDGAN+ GYFA
Sbjct  409  VKEHYGNLNIFISENGMDDPGNGTLPNALNDTTRINFFKDYMTQLKKAIDDGANVTGYFA  468

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTSRFGIVYV
Sbjct  469  WSLLDNFEWLSGYTSRFGIVYV  490



>gb|ABC55717.1| beta-mannosidase 2 [Oncidium hybrid cultivar]
Length=501

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWFLHPI+YGEYPK++Q+IV +RLP FT +E+ +VKGS+DY+G+
Sbjct  276  STDDEAAAQRARDFHIGWFLHPIIYGEYPKSVQDIVKERLPTFTAEEISIVKGSVDYLGV  335

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y++DP+  T     YQ DWNVGFAY R+GVPIGPRANS+WLY+VPWG+YKAVTY
Sbjct  336  NQYTSYYMFDPHLPTQTSTGYQTDWNVGFAYERDGVPIGPRANSDWLYIVPWGMYKAVTY  395

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE Y NP + LSENGMD  GN++L   ++D  R++YYKSY++ELKR +DDGA + GYFA
Sbjct  396  VKENYQNPTIILSENGMDDPGNVSLTVGVHDATRLNYYKSYISELKRAIDDGATVIGYFA  455

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW++GYTSRFGIVYV
Sbjct  456  WSLLDNFEWKLGYTSRFGIVYV  477



>gb|KJB16881.1| hypothetical protein B456_002G252700 [Gossypium raimondii]
Length=512

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHP+VYG+YP+TMQ IVG+RLP+FT  EV+ +K S D + +
Sbjct  286  SKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVGERLPKFTKSEVEKIKNSFDVLCL  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y+YDP+     +  YQ DWN GFAY RNGVPIG RA+SEWLY VPWG+YK VTY
Sbjct  346  NHYTSYYIYDPHRPPSNVTGYQQDWNAGFAYERNGVPIGRRAHSEWLYEVPWGMYKVVTY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERYGNP + LSENGMD  GNLT  ESL D+ R+++Y+SYL ELKR +DDGAN+ GYFA
Sbjct  406  VKERYGNPNIILSENGMDDPGNLTFPESLYDSNRVNFYRSYLKELKRAMDDGANVSGYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WS+LDNFEW +GYTSRFG+VYV
Sbjct  466  WSILDNFEWLLGYTSRFGLVYV  487



>gb|KDO63132.1| hypothetical protein CISIN_1g046891mg [Citrus sinensis]
Length=520

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+EV +VKGS DY+G+
Sbjct  295  SKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEEVAMVKGSYDYLGV  354

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG RANS WLY+VPWGLY A+ Y
Sbjct  355  NQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANSGWLYIVPWGLYNALMY  414

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERYGNP + LSENGMD   N TL   L+DT RI+YY+ Y+++LK+ +DDGAN+ GYFA
Sbjct  415  VKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYISQLKKAIDDGANVTGYFA  474

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW +GYT+RFGI YV
Sbjct  475  WSLLDNFEWLLGYTARFGITYV  496



>ref|XP_006495386.1| PREDICTED: beta-glucosidase 44-like, partial [Citrus sinensis]
Length=422

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+EV +V+GS DY+G+
Sbjct  197  SKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQGSFDYLGV  256

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRANS WLY+VPWGLY A+ 
Sbjct  257  NQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANSGWLYIVPWGLYNALM  315

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK+  DDGAN+ GYF
Sbjct  316  YVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAADDGANVTGYF  375

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW +GY+SRFGI YV
Sbjct  376  AWSLLDNFEWLLGYSSRFGITYV  398



>ref|XP_006482391.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHP+ YGEYP+TMQ  VG+RLP+FTP+EV +VKGS DY+G+
Sbjct  295  SKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEEVAMVKGSYDYLGV  354

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y++DP      I +Y NDW+VG+AY RNGVPIG RANS WLY+VPWGLY A+ Y
Sbjct  355  NQYTSYYMFDPPWPQSNISSYANDWDVGYAYDRNGVPIGRRANSGWLYIVPWGLYNALMY  414

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERYGNP + LSENGMD   N TL   L+DT RI+YY+ Y+++LK+ +DDGAN+ GYFA
Sbjct  415  VKERYGNPTVMLSENGMDDPSNYTLTHLLHDTTRINYYRDYISQLKKAIDDGANVTGYFA  474

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW +GYT+RFGI YV
Sbjct  475  WSLLDNFEWLLGYTARFGITYV  496



>gb|KCW52109.1| hypothetical protein EUGRSUZ_J01543 [Eucalyptus grandis]
Length=448

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  DNYAAQRARDFHIGWFLHP+VYGEYPKTMQNIVG+RLP+FT  EV +VKG  D+VG+
Sbjct  224  SLEDNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKFTKREVNIVKGGFDFVGV  283

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y+Y+P         YQ DWNVGFA+ +NGVPIGPRANS WLY+VPWG+ KAVTY
Sbjct  284  NHYTSYYMYNPNWTETSPPGYQADWNVGFAFEKNGVPIGPRANSGWLYIVPWGVNKAVTY  343

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP MFLSENGMD  GN+T  E L+D+ RI+YY+SYL ELK  +D+GAN+ GYFA
Sbjct  344  VKENYGNPYMFLSENGMDDPGNVTYLEGLHDSTRINYYRSYLQELKAAIDNGANVNGYFA  403

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW +GYT+RFGIVY+
Sbjct  404  WSLLDNFEWLLGYTARFGIVYM  425



>gb|KDO63131.1| hypothetical protein CISIN_1g036937mg, partial [Citrus sinensis]
Length=497

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+EV +V+GS DY+G+
Sbjct  272  SKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQGSFDYLGV  331

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRANS WLY+VPWGLY A+ 
Sbjct  332  NQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANSGWLYIVPWGLYNALM  390

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK+ VDDGAN+ GYF
Sbjct  391  YVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAVDDGANVTGYF  450

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW +GY+SRFGI YV
Sbjct  451  AWSLLDNFEWLLGYSSRFGITYV  473



>emb|CBI33559.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK D  AAQRA DFH+GWFLHPI++G+YPK MQ+IVG+RLP+F+ +E+KLVKGS+D+VGI
Sbjct  224  SKDDQQAAQRAIDFHLGWFLHPIIWGKYPKNMQDIVGERLPKFSEEEIKLVKGSVDFVGI  283

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT+FY++DP+   P +  YQ +WN GFAY RNGVPIGPRANS WLY+VPWG+YK VTY
Sbjct  284  NQYTSFYMFDPHKPKPKVTGYQEEWNAGFAYDRNGVPIGPRANSFWLYIVPWGMYKTVTY  343

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+YGNP + +SENGMD  GN+TL  +L+DT R+ Y++ YL ELK+ +D+GAN+ GYFA
Sbjct  344  VKEQYGNPPIIISENGMDDPGNVTLPMALHDTTRVKYFQDYLIELKKGIDEGANVHGYFA  403

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WS++DNFEW+ GYTSRFG+V++
Sbjct  404  WSIVDNFEWKSGYTSRFGMVFI  425



>ref|XP_006845279.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
 gb|ERN06954.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
Length=482

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +KAD  AAQR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+FT +EV++VKGSID+VGI
Sbjct  256  AKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEMVKGSIDFVGI  315

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y+ D + K   +  YQ DW+ GF Y+R+G  IGP+ANS WLYMVPWG+YKAVTY
Sbjct  316  NQYTSYYITDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQANSYWLYMVPWGMYKAVTY  375

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE Y NP M LSENGMDY  N+TL  +L+DTKRISYY+SYL  LK+ +DDGAN+ GYFA
Sbjct  376  IKENYRNPTMILSENGMDYAANITLPAALHDTKRISYYRSYLINLKKAIDDGANVIGYFA  435

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSL+DNFEWR+GYTSRFG+VYV
Sbjct  436  WSLVDNFEWRLGYTSRFGLVYV  457



>ref|XP_010034459.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=507

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  DNYAAQRARDFHIGWFLHP+VYGEYPKTMQNIVG+RLP+FT  EV +VKG  D+VG+
Sbjct  283  SLEDNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKFTKREVNIVKGGFDFVGV  342

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y+Y+P         YQ DWNVGFA+ +NGVPIGPRANS WLY+VPWG+ KAVTY
Sbjct  343  NHYTSYYMYNPNWTETSPPGYQADWNVGFAFEKNGVPIGPRANSGWLYIVPWGVNKAVTY  402

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP MFLSENGMD  GN+T  E L+D+ RI+YY+SYL ELK  +D+GAN+ GYFA
Sbjct  403  VKENYGNPYMFLSENGMDDPGNVTYLEGLHDSTRINYYRSYLQELKAAIDNGANVNGYFA  462

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW +GYT+RFGIVY+
Sbjct  463  WSLLDNFEWLLGYTARFGIVYM  484



>ref|XP_008811965.1| PREDICTED: beta-glucosidase 1-like isoform X1 [Phoenix dactylifera]
Length=505

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 172/204 (84%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWFLHPI+YGEYPKTMQ IV +RLP+FT +EV++VKGSIDYVGI
Sbjct  277  SIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKFTREEVEMVKGSIDYVGI  336

Query  183  NQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAV  356
            NQYT++Y+ D   Y +TP   +Y  DW+  FAY R+GVPIGPRA+SEWLY+VPWG+YKA 
Sbjct  337  NQYTSYYMEDQPTYSQTPV--SYSADWHTQFAYDRDGVPIGPRAHSEWLYIVPWGMYKAA  394

Query  357  TYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            TYVKE YGNP + L+ENGMD  GN+TL  +L DT+R++YYKSY+ ELK+ +DDGAN+ GY
Sbjct  395  TYVKETYGNPTVILAENGMDQPGNVTLPGALRDTQRVNYYKSYITELKKAIDDGANVMGY  454

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW++GYTSRFG+VYV
Sbjct  455  FAWSLLDNFEWKLGYTSRFGLVYV  478



>ref|XP_006845277.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
 gb|ERN06952.1| hypothetical protein AMTR_s00005p00265710 [Amborella trichopoda]
Length=479

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +KAD  AAQR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+FT +EV++VKGSID+VGI
Sbjct  253  AKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEMVKGSIDFVGI  312

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y+ D + K   +  YQ DW+ GF Y+R+G  IGP+ANS WLYMVPWG+YKAVTY
Sbjct  313  NQYTSYYIKDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQANSYWLYMVPWGMYKAVTY  372

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE Y NP M LSENGMDY  N+TL  +L+DTKRI YY+SYL  LK+ +DDGAN+ GYFA
Sbjct  373  IKENYRNPTMILSENGMDYAANITLPAALHDTKRIGYYRSYLINLKKAIDDGANVIGYFA  432

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSL+DNFEWR+GYTSRFG+VYV
Sbjct  433  WSLVDNFEWRLGYTSRFGLVYV  454



>ref|XP_007048474.1| Beta-glucosidase 44 [Theobroma cacao]
 gb|EOX92631.1| Beta-glucosidase 44 [Theobroma cacao]
Length=562

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KADNYAAQRARDFH+GWFLHP+VYGEYP+TMQ IVG+RLP+F+  +VK VK S D++GIN
Sbjct  337  KADNYAAQRARDFHVGWFLHPLVYGEYPRTMQEIVGERLPKFSKSDVKTVKNSFDFIGIN  396

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYT++Y+YDP    P +  YQ DWNVGFA+ R G PIG RA S WLY VPWG+YKAVTY+
Sbjct  397  QYTSYYMYDPDQPKPNVTGYQQDWNVGFAHERTGNPIGRRAYSPWLYEVPWGMYKAVTYI  456

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP + L+ENGMD  GN+TL ++L D +R++YY+SYL ELKR +DDGAN+ GYFAW
Sbjct  457  KERYGNPNVILAENGMDDPGNVTLPDALYDRERVNYYRSYLKELKRAMDDGANVTGYFAW  516

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEW  GY+SRFGIVYV
Sbjct  517  SLLDNFEWLSGYSSRFGIVYV  537



>gb|KFK39134.1| beta-glucosidase 44 [Arabis alpina]
Length=514

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWF+HP+VYGEYPKTMQ IV +RLP+FT +EVK+VKGSID+VGI
Sbjct  287  SKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQYIVKERLPKFTEEEVKMVKGSIDFVGI  346

Query  183  NQYTTFYVYDPY-PKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ D + P  P    YQ DWN  F++A+ G PIGPRA S WLY VPWG+YKA+ 
Sbjct  347  NQYTTYFMSDTHNPTIPKDLGYQQDWNATFSFAKLGKPIGPRAYSYWLYNVPWGMYKALM  406

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL +LK+ VDDGAN+ GYF
Sbjct  407  YMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTQLKKAVDDGANVTGYF  466

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  467  AWSLLDNFEWLSGYTSRFGIVYV  489



>ref|XP_006482390.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=518

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+EV +V+GS DY+G+
Sbjct  293  SKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQGSFDYLGV  352

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRANS WLY+VPWGLY A+ 
Sbjct  353  NQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANSGWLYIVPWGLYNALM  411

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK+  DDGAN+ GYF
Sbjct  412  YVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAADDGANVTGYF  471

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW +GY+SRFGI YV
Sbjct  472  AWSLLDNFEWLLGYSSRFGITYV  494



>ref|XP_006482389.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+EV +V+GS DY+G+
Sbjct  295  SKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQGSFDYLGV  354

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIGPRANS WLY+VPWGLY A+ 
Sbjct  355  NQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGPRANSGWLYIVPWGLYNALM  413

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK+  DDGAN+ GYF
Sbjct  414  YVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAADDGANVTGYF  473

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW +GY+SRFGI YV
Sbjct  474  AWSLLDNFEWLLGYSSRFGITYV  496



>ref|XP_008792825.1| PREDICTED: beta-glucosidase 1-like [Phoenix dactylifera]
Length=512

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFLHPIVYGEYPKTMQ IV +RLP+FT +E+K+VKGSIDYVGINQYTT+Y+Y P  
Sbjct  299  FHLGWFLHPIVYGEYPKTMQEIVKERLPKFTVEEIKMVKGSIDYVGINQYTTYYMYHPLL  358

Query  222  KTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFL  398
              P   T Y NDWN GFAY RNGVPIGPRA+S+WLY+VPWG+YKAV+YVKE+YGNP + L
Sbjct  359  PAPQKPTRYANDWNCGFAYERNGVPIGPRAHSDWLYIVPWGMYKAVSYVKEQYGNPTVIL  418

Query  399  SENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIG  578
            SENGMD  GN+TL + L+DT RI+YYKSY+ ELKR +DDGAN+ GYFAWSLLDNFEW++G
Sbjct  419  SENGMDDPGNITLPKGLHDTTRINYYKSYITELKRAIDDGANVIGYFAWSLLDNFEWKLG  478

Query  579  YTSRFGIVYV  608
            YTSRFG+VYV
Sbjct  479  YTSRFGVVYV  488



>gb|KJB16855.1| hypothetical protein B456_002G250900 [Gossypium raimondii]
Length=504

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHP+VYG+YP+TMQ IV +RLP+FT  EV+ VK S D + +
Sbjct  278  SKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVRERLPKFTKSEVEKVKNSFDVLCL  337

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y+Y+P+     +  YQ DWN GFAY RNGVPIG RA+SEWLY VPWG+YKAVTY
Sbjct  338  NHYTSYYIYEPHQPPSNVTGYQQDWNAGFAYERNGVPIGRRAHSEWLYEVPWGMYKAVTY  397

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+RYG+P + LSENGMD  GNLT  ESL D  R+S+Y+SYL ELKR +DDGAN+ GYFA
Sbjct  398  VKKRYGSPNIILSENGMDDPGNLTFPESLYDINRVSFYRSYLKELKRAMDDGANVTGYFA  457

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WS+LDNFEW +GYTSRFG+VYV
Sbjct  458  WSILDNFEWLLGYTSRFGLVYV  479



>emb|CDX95557.1| BnaC01g34490D [Brassica napus]
Length=514

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD  AAQRARDFHIGWF+HPIVYGEYP+TMQNIV DRLP+FT +EVK+VKGSID+VGI
Sbjct  287  SKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQNIVKDRLPKFTEEEVKMVKGSIDFVGI  346

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ D +  T P    YQ DWN  F +A+ G PIGPRA S WLY VPWG+YKA+ 
Sbjct  347  NQYTTYFMSDTHNATIPKELGYQQDWNATFGFAKLGKPIGPRAYSYWLYNVPWGMYKALM  406

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL +LK+ VDDGAN+ GYF
Sbjct  407  YMKERYGNPTMILSENGMDDSGNVTLAQGLHDTTRIKYYKDYLTQLKKAVDDGANVKGYF  466

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  467  AWSLLDNFEWLSGYTSRFGIVYV  489



>ref|XP_002272413.2| PREDICTED: beta-glucosidase 44-like [Vitis vinifera]
Length=552

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK D  AAQRA DFH+GWFLHPI++G+YPK MQ+IVG+RLP+F+ +E+KLVKGS+D+VGI
Sbjct  324  SKDDQQAAQRAIDFHLGWFLHPIIWGKYPKNMQDIVGERLPKFSEEEIKLVKGSVDFVGI  383

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT+FY++DP+   P +  YQ +WN GFAY RNGVPIGPRANS WLY+VPWG+YK VTY
Sbjct  384  NQYTSFYMFDPHKPKPKVTGYQEEWNAGFAYDRNGVPIGPRANSFWLYIVPWGMYKTVTY  443

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+YGNP + +SENGMD  GN+TL  +L+DT R+ Y++ YL ELK+ +D+GAN+ GYFA
Sbjct  444  VKEQYGNPPIIISENGMDDPGNVTLPMALHDTTRVKYFQDYLIELKKGIDEGANVHGYFA  503

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WS++DNFEW+ GYTSRFG+V++
Sbjct  504  WSIVDNFEWKSGYTSRFGMVFI  525



>gb|ABR17739.1| unknown [Picea sitchensis]
Length=505

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQR+RDFHIGWFLHPIVYG+YP +M  IVG RLP+FT ++ ++VKGSIDY+G+
Sbjct  281  SSEDQAAAQRSRDFHIGWFLHPIVYGKYPDSMVEIVGKRLPKFTKEQYQMVKGSIDYLGV  340

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP      +  YQ DWNVGFAYARNGVPIGP+ANS WLY+VPWGLYKAVTY
Sbjct  341  NQYTAYYMYDPKQPKQNVTGYQMDWNVGFAYARNGVPIGPKANSYWLYIVPWGLYKAVTY  400

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP M LSENGMD  GN+TL   L+DT R++YYKSYL  L   ++DGAN+ GYFA
Sbjct  401  IKEHYGNPTMILSENGMDDPGNVTLPAGLHDTTRVNYYKSYLQNLIGAMNDGANVVGYFA  460

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW+ GYTSRFG+VYV
Sbjct  461  WSLLDNFEWKSGYTSRFGVVYV  482



>ref|XP_006845278.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
 gb|ERN06953.1| hypothetical protein AMTR_s00005p00265850 [Amborella trichopoda]
Length=479

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +KAD  AAQR+RDFHIGWFLHPIV+G YP++M  +VGDRLP+FT +EV++VKGSID+VGI
Sbjct  253  AKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEMVKGSIDFVGI  312

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y+ D + K   +  YQ DW+ GF Y+R+G  IGP+ANS WLYMVPWG+YKAVTY
Sbjct  313  NHYTSYYIKDQHIKNGTVTDYQMDWHAGFEYSRDGKLIGPQANSYWLYMVPWGMYKAVTY  372

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE Y NP M LSENGMDY  N+TL  +L+DTKRI YY+SYL  LK+ +DDGAN+ GYFA
Sbjct  373  IKENYRNPTMILSENGMDYAANITLPAALHDTKRIGYYRSYLINLKKAIDDGANVIGYFA  432

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSL+DNFEWR+GYTSRFG+VYV
Sbjct  433  WSLVDNFEWRLGYTSRFGLVYV  454



>gb|KJB16858.1| hypothetical protein B456_002G251200 [Gossypium raimondii]
Length=504

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFHIGWFLHP+VYG+YP+TMQ IV +RLP+FT  EV+ VK S D + +
Sbjct  278  SKADNYAAQRARDFHIGWFLHPLVYGKYPRTMQKIVRERLPKFTKSEVEKVKNSFDVLCL  337

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y+Y+P+     +  YQ DWN GFAY RNGVPIG RA+SEWLY VPWG+YKAVTY
Sbjct  338  NHYTSYYIYEPHQPPSNVTGYQQDWNAGFAYERNGVPIGHRAHSEWLYEVPWGMYKAVTY  397

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+ YG+P + LSENGMD  GNLT  ESL D  R+S+Y+SYL ELKR +DDGAN+ GYFA
Sbjct  398  VKKHYGSPNIILSENGMDDPGNLTFPESLYDINRVSFYRSYLKELKRAMDDGANVTGYFA  457

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WS+LDNFEW +GYTSRFG+VYV
Sbjct  458  WSILDNFEWLLGYTSRFGLVYV  479



>ref|XP_006430653.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
 gb|ESR43893.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
Length=528

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+EV +V+GS DY+G+
Sbjct  303  SKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQGSFDYLGV  362

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIG RANS WLY+VPWGLY A+ 
Sbjct  363  NQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGQRANSGWLYIVPWGLYNALM  421

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKERYGNP++ LSENGMD   N T+   L+DT R++YY+ Y+++LK+ VDDGAN+ GYF
Sbjct  422  YVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAVDDGANVTGYF  481

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSL+DNFEW +GY+SRFGI YV
Sbjct  482  AWSLVDNFEWLLGYSSRFGITYV  504



>ref|XP_006430655.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
 gb|ESR43895.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
Length=520

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADN AAQRARDFHIGWFLHP+ YGEYP+TMQ  VGDRLP+FTP+EV +V+GS DY+G+
Sbjct  295  SKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQGSFDYLGV  354

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT++Y++D P+PK+  I +Y NDW+ G+AY RNGVPIG RANS WLY+VPWGLY A+ 
Sbjct  355  NQYTSYYMFDPPWPKSN-ISSYANDWDAGYAYDRNGVPIGQRANSGWLYIVPWGLYNALM  413

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKERYGNP + LSENGMD   N T+   L+DT R++YY+ Y+++LK+ VDDGAN+ GYF
Sbjct  414  YVKERYGNPTVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAVDDGANVTGYF  473

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW +GY++RFGI YV
Sbjct  474  AWSLLDNFEWLLGYSARFGITYV  496



>ref|XP_006406654.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 ref|XP_006406658.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
 gb|ESQ48107.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 gb|ESQ48111.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
Length=512

 Score =   297 bits (761),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD  AAQRARDFHIGWF+HP+VYGEYPKTMQ IV +RLP+FT +EVK+VKGSID+VGI
Sbjct  285  SKADYLAAQRARDFHIGWFIHPLVYGEYPKTMQLIVKERLPKFTEEEVKMVKGSIDFVGI  344

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ D +  T P    YQ DWNV F +++ G PIGPRANS WLY VPWG+YKA+ 
Sbjct  345  NQYTTYFMSDTHNSTIPKDLGYQQDWNVTFGFSKLGKPIGPRANSYWLYNVPWGMYKALM  404

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KE YGNP M LSENGMD  GN TLA+ L+DT RI YY+ YL +LK+ VDDGAN+ GYF
Sbjct  405  YMKEHYGNPTMILSENGMDDPGNFTLAQGLHDTTRIKYYRDYLTQLKKAVDDGANVKGYF  464

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  465  AWSLLDNFEWLSGYTSRFGIVYV  487



>ref|XP_010922562.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=509

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFLHPI+YGEYPKT+Q IV +RLP+FT +EVK+VKGSIDYVGINQYTT+Y+YDP+ 
Sbjct  296  FHVGWFLHPIIYGEYPKTIQEIVKERLPKFTEEEVKMVKGSIDYVGINQYTTYYMYDPHQ  355

Query  222  KTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFL  398
              P   T Y NDW+VG+AY R+GVPIGPRA+S WLY+VPWG+YKAV+YVKE Y NP + L
Sbjct  356  PEPQKPTSYANDWHVGYAYERDGVPIGPRAHSNWLYIVPWGMYKAVSYVKEHYCNPTVIL  415

Query  399  SENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIG  578
            SENGMD  GN+TL + L+DT RI+YYKSY+ ELK+ +DDGAN+ GYFAWSLLDNFEW+ G
Sbjct  416  SENGMDDPGNITLPKGLHDTTRINYYKSYITELKKAIDDGANVIGYFAWSLLDNFEWKSG  475

Query  579  YTSRFGIVYV  608
            YTSRFGIVYV
Sbjct  476  YTSRFGIVYV  485



>ref|XP_010906974.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=510

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFLHPIVYGEYPKT+Q+IV DRLP+FT +E+K+VKGSIDYVGIN YT++Y+YDP+ 
Sbjct  297  FHLGWFLHPIVYGEYPKTLQDIVKDRLPKFTVEEIKMVKGSIDYVGINHYTSYYMYDPHL  356

Query  222  KTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFL  398
              P   T Y NDWN GFA+ RNGVPIGPRA S WLY+VPWG+YKAVTYVKE+YGNP + L
Sbjct  357  PEPQKPTRYANDWNCGFAFERNGVPIGPRAYSYWLYIVPWGMYKAVTYVKEQYGNPTVIL  416

Query  399  SENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIG  578
            SENGMD  GN+TL   L+DT RI+YYKSY+ ELK+ +DDGAN+ GYFAWSLLDNFEW++G
Sbjct  417  SENGMDDPGNVTLPNGLHDTTRINYYKSYITELKKAIDDGANVIGYFAWSLLDNFEWKLG  476

Query  579  YTSRFGIVYV  608
            YTSRFG+VYV
Sbjct  477  YTSRFGLVYV  486



>ref|XP_009113523.1| PREDICTED: beta-glucosidase 44 [Brassica rapa]
 emb|CDY18495.1| BnaA01g27000D [Brassica napus]
Length=514

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD  AAQRARDFHIGWF+HPIVYGEYP+TMQ IV DRLP+FT +EVK+VKGSID+VGI
Sbjct  287  SKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQYIVKDRLPKFTEEEVKMVKGSIDFVGI  346

Query  183  NQYTTFYVYDPYPKT-PYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT+++ D +  T P    YQ DWN  F YA+ G PIGPRA S WLY VPWG+YKA+ 
Sbjct  347  NQYTTYFMSDTHNATIPKELGYQQDWNATFGYAKLGKPIGPRAYSYWLYNVPWGMYKALM  406

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KE YGNP M LSENGMD  GN+TLA+ L+DT RI YYK YL +LK+ VDDGAN+ GYF
Sbjct  407  YMKEHYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTQLKKAVDDGANVKGYF  466

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTSRFGIVYV
Sbjct  467  AWSLLDNFEWLSGYTSRFGIVYV  489



>ref|XP_010916341.1| PREDICTED: beta-glucosidase 1-like [Elaeis guineensis]
Length=503

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S +D  AA R+RDFHIGWFLHPI YGEYPKTMQ IV +RLP+FT +EV++VKGSIDYVG+
Sbjct  277  SISDQEAAHRSRDFHIGWFLHPITYGEYPKTMQEIVKERLPKFTREEVEMVKGSIDYVGV  336

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y+ D    +    +Y  DW+V FAY R+GVPIGPRA+S+WLY+VPWG+YKAVTY
Sbjct  337  NQYTSYYIKDHPTTSQTPVSYSADWHVTFAYDRDGVPIGPRAHSDWLYIVPWGMYKAVTY  396

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YGNP + LSENGMD  GN+TL  +L DT RI+YY+SY+A+LK  +DDGAN+ GYFA
Sbjct  397  VKETYGNPTIILSENGMDQPGNVTLPGALWDTVRINYYRSYIAKLKEAIDDGANVVGYFA  456

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW++GYTSRFG+VYV
Sbjct  457  WSLLDNFEWKLGYTSRFGLVYV  478



>gb|KHG17589.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=381

 Score =   291 bits (744),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 164/203 (81%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVG+RLP+FT +EVK+V GS DYVGI
Sbjct  157  SKIDNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGERLPKFTEEEVKMVNGSFDYVGI  216

Query  183  NQYTTFYVYDPYPKTPY-IHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT Y+  P  +TP  I +YQ DWN  FA  +NGV IG RANS WLY+VPWG+YKAVT
Sbjct  217  NQYTTRYISSP--ETPSNITSYQIDWNATFATTKNGVQIGLRANSGWLYIVPWGMYKAVT  274

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKERYGN  + +SENGMD  GN TL   L DT RI ++K Y+ +LK+ +D+GAN+ GYF
Sbjct  275  YVKERYGNLNIIISENGMDNPGNATLPNGLKDTTRIKFFKDYMTQLKKAIDEGANVTGYF  334

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSL+DNFEW +GYTSRFGI+YV
Sbjct  335  AWSLVDNFEWSLGYTSRFGIIYV  357



>ref|XP_009394053.1| PREDICTED: beta-glucosidase 26-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWFLHP+ YG YPK++Q IV DRLP+FT D+VK+VKGS DYVG+
Sbjct  277  SANDEAAAQRARDFHLGWFLHPLTYGYYPKSIQEIVKDRLPKFTDDQVKMVKGSYDYVGV  336

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+ D     P   +YQ+DW+V F Y ++GVPIGPRANS WLY+VPWG+YKAVTY
Sbjct  337  NQYTAYYMKDNGVTNPKPVSYQDDWHVEFKYDQDGVPIGPRANSYWLYIVPWGMYKAVTY  396

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE YG+P++ L+ENGMD  GN+TL E L D +RI+Y+KSY+ ELKR +DDGA + GYFA
Sbjct  397  VKENYGDPIIILAENGMDQPGNVTLPEGLRDAERINYFKSYITELKRAIDDGATVIGYFA  456

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWRIGYTSRFG+VYV
Sbjct  457  WSLLDNFEWRIGYTSRFGLVYV  478



>gb|KHG12317.1| Beta-glucosidase 44 -like protein [Gossypium arboreum]
Length=497

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVG RLP+FT +EVK+V GS DYVGI
Sbjct  273  SKADNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGKRLPKFTEEEVKMVNGSFDYVGI  332

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT Y+ +P   +  + +YQ+DWN  FA A+NGV IGPRANS WLY+VPWG+YK VTY
Sbjct  333  NQYTTSYISNPTSPSN-VTSYQSDWNAAFANAKNGVQIGPRANSWWLYIVPWGMYKTVTY  391

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KERYG+  + +SENGMD  GN TL   L DT RI ++K Y+ +LK+ +D+GAN+ GYFA
Sbjct  392  IKERYGDMNVIISENGMDDPGNATLPNGLKDTTRIKFFKDYMTQLKKAIDEGANVTGYFA  451

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW +GYTSRFGIVYV
Sbjct  452  WSLLDNFEWLLGYTSRFGIVYV  473



>ref|XP_006832849.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
 gb|ERM98127.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
Length=509

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +KAD  AAQR+RDFH+GWFLHPIVYG YP++M  IVGDRLP+FT +EV++VKGSID+VGI
Sbjct  283  AKADVRAAQRSRDFHVGWFLHPIVYGTYPRSMVRIVGDRLPKFTNEEVEMVKGSIDFVGI  342

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y+YD + +   +  YQ +W+ GFA+AR+G PIGPRA S  LYMVPWG+YKAVT 
Sbjct  343  NHYTTYYMYDQHIRKGTVMDYQMEWHAGFAFARDGKPIGPRAYSPGLYMVPWGIYKAVTC  402

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE Y NP + LSENGMDY GN+TL  S++DTKRI YY+SYL  LK+ +DDGAN+ GYFA
Sbjct  403  IKENYKNPTIILSENGMDYPGNVTLLASVHDTKRIDYYRSYLINLKKAIDDGANVVGYFA  462

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTSRFG+VYV
Sbjct  463  WSLLDNFEWLSGYTSRFGLVYV  484



>ref|XP_004140826.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN57432.1| hypothetical protein Csa_3G185120 [Cucumis sativus]
Length=515

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            K DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IV +RLP+F+ +EV LVKGSID++GIN
Sbjct  291  KQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKFSEEEVSLVKGSIDFLGIN  350

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYTTFY+++P         YQNDWNVGFA+ +NGVPIGPRA+S WLY VPWG+YKA+ YV
Sbjct  351  QYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAHSTWLYQVPWGMYKALMYV  410

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP + LSENG D   ++ L E+L D +RI Y+K Y+  +KR +DDGAN+ GYFAW
Sbjct  411  KERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQNMKRAIDDGANVSGYFAW  469

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEW  GYTSRFGIVYV
Sbjct  470  SLLDNFEWLSGYTSRFGIVYV  490



>ref|XP_004157213.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=515

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            K DNYAAQRARDFH+GWFLHPI YGEYP+TMQ IV +RLP+F+ +EV LVKGSID++GIN
Sbjct  291  KQDNYAAQRARDFHLGWFLHPITYGEYPRTMQEIVKERLPKFSEEEVSLVKGSIDFLGIN  350

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYTTFY+++P         YQNDWNVGFA+ +NGVPIGPRA+S WLY VPWG+YKA+ YV
Sbjct  351  QYTTFYMFNPKSTQLDAPGYQNDWNVGFAFEKNGVPIGPRAHSTWLYQVPWGMYKALMYV  410

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP + LSENG D   ++ L E+L D +RI Y+K Y+  +KR +DDGAN+ GYFAW
Sbjct  411  KERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQNMKRAIDDGANVSGYFAW  469

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEW  GYTSRFGIVYV
Sbjct  470  SLLDNFEWLSGYTSRFGIVYV  490



>ref|XP_008811966.1| PREDICTED: beta-glucosidase 1-like isoform X2 [Phoenix dactylifera]
Length=525

 Score =   292 bits (748),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 172/224 (77%), Gaps = 24/224 (11%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWFLHPI+YGEYPKTMQ IV +RLP+FT +EV++VKGSIDYVGI
Sbjct  277  SIRDQEAAQRARDFHIGWFLHPIIYGEYPKTMQEIVKERLPKFTREEVEMVKGSIDYVGI  336

Query  183  NQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPIGPRAN---------------  311
            NQYT++Y+ D   Y +TP   +Y  DW+  FAY R+GVPIGPR N               
Sbjct  337  NQYTSYYMEDQPTYSQTPV--SYSADWHTQFAYDRDGVPIGPRVNFCIFSVEELILDCFS  394

Query  312  -----SEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYY  476
                 SEWLY+VPWG+YKAVTYVKE YGNP + L+ENGMD  GN+TL  +L DT+R++YY
Sbjct  395  CMQAHSEWLYIVPWGMYKAVTYVKETYGNPTVILAENGMDQPGNVTLPGALRDTQRVNYY  454

Query  477  KSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYV  608
            KSY+ ELK+ +DDGAN+ GYFAWSLLDNFEW++GYTSRFG+VYV
Sbjct  455  KSYITELKKAIDDGANVMGYFAWSLLDNFEWKLGYTSRFGLVYV  498



>ref|XP_008457084.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=517

 Score =   292 bits (747),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 163/201 (81%), Gaps = 1/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            K DNYAAQRARDFHIGWFLHPI YGEYP+TMQ IV +RLP+F+ +E+ LVKGSID++GIN
Sbjct  293  KQDNYAAQRARDFHIGWFLHPITYGEYPRTMQEIVKERLPKFSEEEISLVKGSIDFLGIN  352

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYTTFY+++P         YQNDWNVGFA+ + GVPIGPRA+S WLY VPWG+YKA+ YV
Sbjct  353  QYTTFYMFNPQSTQLDAPGYQNDWNVGFAFEKKGVPIGPRAHSAWLYQVPWGMYKALMYV  412

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KERYGNP + LSENG D   ++ L E+L D +RI Y+K Y+  +KR +DDGAN+ GYFAW
Sbjct  413  KERYGNPNVILSENGRD-TPDIQLPEALFDLERIEYFKLYIQSMKRAIDDGANVSGYFAW  471

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEW  GYTSRFGIVYV
Sbjct  472  SLLDNFEWLSGYTSRFGIVYV  492



>gb|KJB08522.1| hypothetical protein B456_001G086300 [Gossypium raimondii]
Length=497

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 165/203 (81%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWFLHPI YGEYP+TMQ IVG RLP+FT +EVK+V GS DYVGI
Sbjct  273  SKADNYAAQRARDFHVGWFLHPIRYGEYPRTMQEIVGKRLPKFTEEEVKMVNGSFDYVGI  332

Query  183  NQYTTFYVYDPYPKTPY-IHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYTT Y+ +P   TP  + +YQ+DWN  FA A+ GV IGPRANS WLY+VPWG+YK VT
Sbjct  333  NQYTTSYISNP--TTPSNVTSYQSDWNAAFANAKYGVQIGPRANSWWLYIVPWGMYKTVT  390

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y+KERYG+  + +SENGMD  GN TL   L DT RI ++K Y+ +LK+ +D+GAN+ GYF
Sbjct  391  YIKERYGDMNVIISENGMDDPGNATLPNGLKDTTRIKFFKDYMTQLKKAIDEGANVTGYF  450

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW +GYTSRFGIVYV
Sbjct  451  AWSLLDNFEWLLGYTSRFGIVYV  473



>ref|XP_010257514.1| PREDICTED: beta-glucosidase 44-like isoform X2 [Nelumbo nucifera]
Length=534

 Score =   290 bits (743),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 164/201 (82%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG RLP+FT + +K+VKGSID++GIN
Sbjct  309  KADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKRLPKFTKENIKMVKGSIDFLGIN  368

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYT  Y Y  +    +   Y+ D NVGFA+A++GVPIGPRANS WLY VPW LYK +TY+
Sbjct  369  QYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIGPRANSAWLYDVPWSLYKVLTYI  428

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KE YGNP + ++ENGMD  GN+TL + L+DT+RI++Y+ YL +LK+ +DDG N+ GYFAW
Sbjct  429  KEYYGNPTVIITENGMDEPGNVTLPKGLHDTRRINFYRGYLTQLKKAIDDGVNVVGYFAW  488

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SL+D FEWR+GYT+RFGIVY+
Sbjct  489  SLIDTFEWRLGYTTRFGIVYI  509



>gb|AEV76986.1| beta-glucosidase 4, partial [Triticum aestivum]
Length=501

 Score =   289 bits (740),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AAQRARDFHIGWFL PI  G YP +M  IVG+RLP F+ +E ++VKGSIDYVGI
Sbjct  274  SNADQGAAQRARDFHIGWFLDPITNGRYPSSMLKIVGNRLPGFSTNESRMVKGSIDYVGI  333

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT++Y+ DP        +YQ+DW+VGF Y RNGVPIGPRANS+WLY+VPWG+ KAVTY
Sbjct  334  NQYTSYYMKDPGAWNLTPVSYQDDWHVGFVYERNGVPIGPRANSDWLYIVPWGMNKAVTY  393

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERYGNP M LSENGMD  GN+++A+ ++DT RI YY+ Y+ ELK+ +D+GA + GYFA
Sbjct  394  VKERYGNPTMILSENGMDQPGNVSIADGVHDTIRIRYYRDYITELKKAIDNGARVVGYFA  453

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYT+RFGI YV
Sbjct  454  WSLLDNFEWRLGYTARFGIAYV  475



>ref|XP_010257596.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
 ref|XP_010257682.1| PREDICTED: beta-glucosidase 44-like isoform X3 [Nelumbo nucifera]
Length=518

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG RLP+FT + +K+VKGSID++GIN
Sbjct  288  KADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKRLPKFTKENIKMVKGSIDFLGIN  347

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPR-----ANSEWLYMVPWGLYK  350
            QYT  Y Y  +    +   Y+ D NVGFA+A++GVPIGPR     ANS WLY VPW LYK
Sbjct  348  QYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIGPRVIKITANSAWLYDVPWSLYK  407

Query  351  AVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLF  530
             +TY+KE YGNP + ++ENGMD  GN+TL + L+DT+RI++Y+ YL +LK+ +DDG N+ 
Sbjct  408  VLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRRINFYRGYLTQLKKAIDDGVNVV  467

Query  531  GYFAWSLLDNFEWRIGYTSRFGIVYV  608
            GYFAWSL+D FEWR+GYT+RFGIVY+
Sbjct  468  GYFAWSLIDTFEWRLGYTTRFGIVYI  493



>ref|XP_010257433.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Nelumbo nucifera]
Length=539

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KAD YAAQRA DF++GWFLHPIVYGEYPKTMQN VG RLP+FT + +K+VKGSID++GIN
Sbjct  309  KADQYAAQRAIDFYLGWFLHPIVYGEYPKTMQNTVGKRLPKFTKENIKMVKGSIDFLGIN  368

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPR-----ANSEWLYMVPWGLYK  350
            QYT  Y Y  +    +   Y+ D NVGFA+A++GVPIGPR     ANS WLY VPW LYK
Sbjct  369  QYTAHYAYALHQTKKHAPGYEKDLNVGFAFAKSGVPIGPRVIKITANSAWLYDVPWSLYK  428

Query  351  AVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLF  530
             +TY+KE YGNP + ++ENGMD  GN+TL + L+DT+RI++Y+ YL +LK+ +DDG N+ 
Sbjct  429  VLTYIKEYYGNPTVIITENGMDEPGNVTLPKGLHDTRRINFYRGYLTQLKKAIDDGVNVV  488

Query  531  GYFAWSLLDNFEWRIGYTSRFGIVYV  608
            GYFAWSL+D FEWR+GYT+RFGIVY+
Sbjct  489  GYFAWSLIDTFEWRLGYTTRFGIVYI  514



>ref|XP_004149144.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
 gb|KGN53236.1| hypothetical protein Csa_4G031070 [Cucumis sativus]
Length=506

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 160/202 (79%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
             K D  AAQRARDFHIGWFLHP  YGEYP+ MQ IV +RLP+F+ +EVK VKGS+D+VGI
Sbjct  282  EKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKFSEEEVKKVKGSVDFVGI  341

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFY+++P    P    YQ+DW+VG+AY +NG PIG RA++ WLY VPWG+YKA+ Y
Sbjct  342  NQYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGQRAHTGWLYEVPWGMYKALMY  401

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+ Y NP + +SENGMD   ++ L E LND +RI+YYK+YL  +K+ +DDGAN+ GYFA
Sbjct  402  VKQHYRNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQNMKKAIDDGANVSGYFA  460

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTSRFGI+YV
Sbjct  461  WSLLDNFEWLSGYTSRFGIIYV  482



>gb|AAA87339.1| beta-glucosidase [Hordeum vulgare]
Length=509

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 159/191 (83%), Gaps = 4/191 (2%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--  215
            FHIGWFL PI  G YP +M  IVG+RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  
Sbjct  295  FHIGWFLDPITNGRYPSSMLKIVGNRLPGFSADESRMVKGSIDYVGINQYTSYYMKDPGA  354

Query  216  YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMF  395
            + +TP   +YQ+DW+VGF Y RNGVPIGPRANS+WLY+VPWG+ KAVTYVKERYGNP M 
Sbjct  355  WNQTPV--SYQDDWHVGFVYERNGVPIGPRANSDWLYIVPWGMNKAVTYVKERYGNPTMI  412

Query  396  LSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRI  575
            LSENGMD  GN+++A+ ++DT RI YY+ Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+
Sbjct  413  LSENGMDQPGNVSIADGVHDTVRIRYYRDYITELKKAIDNGARVAGYFAWSLLDNFEWRL  472

Query  576  GYTSRFGIVYV  608
            GYT+RFGIVYV
Sbjct  473  GYTARFGIVYV  483



>gb|ACF07998.1| beta-glucosidase [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 159/191 (83%), Gaps = 4/191 (2%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--  215
            FHIGWFL PI  G YP +M  IVG+RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  
Sbjct  295  FHIGWFLDPITNGRYPSSMLKIVGNRLPGFSADESRMVKGSIDYVGINQYTSYYMKDPGA  354

Query  216  YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMF  395
            + +TP   +YQ+DW+VGF Y RNGVPIGPRANS+WLY+VPWG+ KAVTYVKERYGNP M 
Sbjct  355  WNQTPV--SYQDDWHVGFVYERNGVPIGPRANSDWLYIVPWGMNKAVTYVKERYGNPTMI  412

Query  396  LSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRI  575
            LSENGMD  GN+++A+ ++DT RI YY+ Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+
Sbjct  413  LSENGMDQPGNVSIADGVHDTVRIRYYRDYITELKKAIDNGARVAGYFAWSLLDNFEWRL  472

Query  576  GYTSRFGIVYV  608
            GYT+RFGIVYV
Sbjct  473  GYTARFGIVYV  483



>ref|XP_004163493.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus]
Length=506

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 159/202 (79%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
             K D  AAQRARDFHIGWFLHP  YGEYP+ MQ IV +RLP+F+ +EVK VKGS+D+VGI
Sbjct  282  EKEDRDAAQRARDFHIGWFLHPFTYGEYPRRMQEIVKERLPKFSEEEVKKVKGSVDFVGI  341

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTTFY+ +P    P    YQ+DW+VG+AY +NG PIG RA++ WLY VPWG+YKA+ Y
Sbjct  342  NQYTTFYMLNPTWPKPTTPDYQSDWHVGYAYEKNGKPIGQRAHTGWLYEVPWGMYKALMY  401

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK+ Y NP + +SENGMD   ++ L E LND +RI+YYK+YL  +K+ +DDGAN+ GYFA
Sbjct  402  VKQHYRNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQNMKKAIDDGANVSGYFA  460

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTSRFGI+YV
Sbjct  461  WSLLDNFEWLSGYTSRFGIIYV  482



>ref|XP_008453769.1| PREDICTED: beta-glucosidase 44-like [Cucumis melo]
Length=506

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            K D  AAQRARDF IGWFLHP  YGEYP+ MQ IV +RLP+F+ +EV +VKGS+D+VGIN
Sbjct  283  KEDRDAAQRARDFTIGWFLHPFTYGEYPRRMQEIVKERLPKFSEEEVTMVKGSVDFVGIN  342

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
            QYTTFY+++P    P    YQ+DW+VG+AY +NG PIG RA++ WLY VPWG++KA+ YV
Sbjct  343  QYTTFYMFNPTWPKPTTPGYQSDWHVGYAYEKNGKPIGKRAHTGWLYEVPWGMHKALMYV  402

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KE YGNP + +SENGMD   ++ L E LND +RI+YYK+YL  +K+ +DDGAN+ GYFAW
Sbjct  403  KEHYGNPNVIVSENGMD-TSDIPLPEGLNDRERINYYKTYLQNMKKAIDDGANVSGYFAW  461

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEW  GYTSRFGI+YV
Sbjct  462  SLLDNFEWLSGYTSRFGIIYV  482



>ref|XP_008655551.1| PREDICTED: beta-glucosidase 1-like [Zea mays]
Length=570

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 155/191 (81%), Gaps = 1/191 (1%)
 Frame = +3

Query  39   DFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPY  218
            DFH+GWFLHPIVYGEYPK+++  V  RLP+FT +E  LV+GSIDYVG+NQYT +YV D  
Sbjct  356  DFHVGWFLHPIVYGEYPKSVRRSVKGRLPKFTAEEAGLVRGSIDYVGVNQYTAYYVRDRR  415

Query  219  PK-TPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMF  395
            P  T    +Y +DW+  F Y R+GVPIGPRANS+WLY+VPWGLYKAVTYVKE+YGNP M 
Sbjct  416  PNATAAPPSYSSDWHAEFVYERDGVPIGPRANSDWLYIVPWGLYKAVTYVKEKYGNPTML  475

Query  396  LSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRI  575
            LSENGMD  GN+T+ + + D  R++YY+SY+AELK  +D GAN  GYFAWSLLDNFEW++
Sbjct  476  LSENGMDDPGNVTVGQGVRDAARVAYYRSYVAELKAAIDGGANCVGYFAWSLLDNFEWKL  535

Query  576  GYTSRFGIVYV  608
            GYTSRFG+VYV
Sbjct  536  GYTSRFGLVYV  546



>ref|NP_001060502.1| Os07g0656200 [Oryza sativa Japonica Group]
 dbj|BAF22416.1| Os07g0656200, partial [Oryza sativa Japonica Group]
Length=331

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PI++G YP +M  IV DR+P F+ +E ++VK SIDYVGIN YT+FY+ DP P
Sbjct  117  FHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRMVKDSIDYVGINHYTSFYMKDPGP  176

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGFAY RNGVPIG +ANS WLY+VPWG+ KAVTYVKE YGNP M LS
Sbjct  177  WNLTPTSYQDDWHVGFAYERNGVPIGAQANSYWLYIVPWGINKAVTYVKETYGNPTMILS  236

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GN+++ + ++DT RI YY++Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  237  ENGMDQPGNVSITQGVHDTVRIRYYRNYITELKKAIDDGAKVIGYFAWSLLDNFEWRLGY  296

Query  582  TSRFGIVYV  608
            TSRFGIVYV
Sbjct  297  TSRFGIVYV  305



>gb|EMT08337.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=507

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 158/191 (83%), Gaps = 4/191 (2%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--  215
            FHIGWFL PI  G YP +M  IV +RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  
Sbjct  293  FHIGWFLDPITNGRYPSSMLKIVSNRLPGFSADESRMVKGSIDYVGINQYTSYYMKDPGA  352

Query  216  YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMF  395
            + +TP   +YQ+DW+VGF Y RNGVPIGPRANS+WLY+VPWG+ KAVTYVKERYGNP M 
Sbjct  353  WNQTPV--SYQDDWHVGFVYERNGVPIGPRANSDWLYIVPWGMNKAVTYVKERYGNPTMI  410

Query  396  LSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRI  575
            LSENGMD  GN+++A+ ++DT RI +Y+ Y+ ELK+ +D+GA + GYFAWSLLDNFEWR+
Sbjct  411  LSENGMDQPGNVSIADGVHDTVRIRFYRDYITELKKAIDNGARVVGYFAWSLLDNFEWRL  470

Query  576  GYTSRFGIVYV  608
            GYT+RFGIVYV
Sbjct  471  GYTARFGIVYV  481



>ref|XP_003562544.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
 ref|XP_010234616.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
Length=500

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PIV+G+YP++M  IV  RLP F+ +E ++VKGS+DYVGIN YT++Y+ DP  
Sbjct  287  FHLGWFLDPIVHGQYPESMLKIVEGRLPTFSHEESRMVKGSMDYVGINHYTSYYMKDPGA  346

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGF Y RNGVPIG RANS WLY+VPWG+ KAVTYVKERYGNP MFLS
Sbjct  347  WNLTPVSYQDDWHVGFVYERNGVPIGARANSYWLYIVPWGINKAVTYVKERYGNPTMFLS  406

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GN+++ E ++DT R+ YY+ Y+ ELK+V+DDGA + GYFAWSLLDNFEWR+GY
Sbjct  407  ENGMDQPGNVSITEGVHDTVRVRYYREYITELKKVIDDGARVIGYFAWSLLDNFEWRLGY  466

Query  582  TSRFGIVYV  608
            TSRFGIVYV
Sbjct  467  TSRFGIVYV  475



>dbj|BAK07108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 159/203 (78%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AAQRARDFH+GWFL P++ G+YPKTMQ+IV +RLP FTP++ KLVKGS+DY+GI
Sbjct  184  SPADKAAAQRARDFHVGWFLDPLLNGQYPKTMQDIVKERLPSFTPEQSKLVKGSVDYIGI  243

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            NQYT  Y+ D P  + P   +Y +DW+V + + RNGVPIG +ANS WLY+VP G+Y  V 
Sbjct  244  NQYTATYMADQPTLQQPPT-SYSSDWHVQYIFQRNGVPIGQKANSNWLYIVPTGMYGCVN  302

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            Y++E+Y NP + +SENGMD   NLT  E L+D  R+ +YK+YLAELK+ +DDGAN+ GYF
Sbjct  303  YIREKYNNPTIIISENGMDQPANLTREEFLHDASRVEFYKTYLAELKKAIDDGANVVGYF  362

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYTS+FGIVYV
Sbjct  363  AWSLLDNFEWLSGYTSKFGIVYV  385



>ref|XP_009388049.1| PREDICTED: beta-glucosidase 26-like [Musa acuminata subsp. malaccensis]
Length=256

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 156/195 (80%), Gaps = 0/195 (0%)
 Frame = +3

Query  24   AQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFY  203
            A   R + +  FLHP+ YG YPK+++ IV DRLP+FT D+VK+VKGS DYVG+NQYT++Y
Sbjct  36   ATEDRAYGLHSFLHPLTYGYYPKSIREIVKDRLPKFTADQVKMVKGSYDYVGVNQYTSYY  95

Query  204  VYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGN  383
            + D     P   +YQ+DW+V F + R+GVPIGP+A S WLY+VPWG+YKAVTYVK  YG+
Sbjct  96   MKDNGVTNPKPVSYQDDWHVEFKFDRDGVPIGPQAYSGWLYIVPWGMYKAVTYVKVNYGD  155

Query  384  PLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNF  563
            P++ L+ENGMD  GN+TL E L DTKRI++YKSY+ ELKR +DDGA + GYFAWSLLDNF
Sbjct  156  PVIILAENGMDQPGNVTLPEGLRDTKRINFYKSYITELKRAMDDGATVIGYFAWSLLDNF  215

Query  564  EWRIGYTSRFGIVYV  608
            EWR+GYTSRFG+VYV
Sbjct  216  EWRLGYTSRFGLVYV  230



>gb|EEC76023.1| hypothetical protein OsI_13187 [Oryza sativa Indica Group]
Length=568

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLVKGS DY GI
Sbjct  288  STEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLVKGSADYFGI  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+ D         +Y +DW+V F + RNGVPIG +ANS WLY+VP G+Y AV Y
Sbjct  348  NQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQANSNWLYIVPTGMYGAVNY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+Y NP + +SENGMD  GNLT  E L+DT+RI +YK+YL ELK+ +DDGAN+  YFA
Sbjct  408  IKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLTELKKAIDDGANVVAYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  468  WSLLDNFEWLSGYTSKFGIVYV  489



>ref|NP_001051014.1| Os03g0703100 [Oryza sativa Japonica Group]
 sp|Q75I94.1|BGL08_ORYSJ RecName: Full=Beta-glucosidase 8; Short=Os3bglu8; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07251.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF98427.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12928.1| Os03g0703100 [Oryza sativa Japonica Group]
 dbj|BAH00173.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59768.1| hypothetical protein OsJ_12263 [Oryza sativa Japonica Group]
Length=568

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLVKGS DY GI
Sbjct  288  STEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLVKGSADYFGI  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+ D         +Y +DW+V F + RNGVPIG +ANS WLY+VP G+Y AV Y
Sbjct  348  NQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQANSNWLYIVPTGMYGAVNY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+Y NP + +SENGMD  GNLT  E L+DT+RI +YK+YL ELK+ +DDGAN+  YFA
Sbjct  408  IKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLTELKKAIDDGANVVAYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  468  WSLLDNFEWLSGYTSKFGIVYV  489



>pdb|4JIE|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
 pdb|4JHO|A Chain A, Structural Analysis And Insights Into Glycon Specificity 
Of The Rice Gh1 Os7bglu26 Beta-d-mannosidase
Length=503

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PI++G YP +M  IV DR+P F+ +E ++VK SIDYVGIN YT+FY+ DP P
Sbjct  289  FHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRMVKDSIDYVGINHYTSFYMKDPGP  348

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGFAY RNGVPIG +ANS WLY+VPWG+ KAVTYVKE YGNP M LS
Sbjct  349  WNLTPTSYQDDWHVGFAYERNGVPIGAQANSYWLYIVPWGINKAVTYVKETYGNPTMILS  408

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GN+++ + ++DT RI YY++Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  409  ENGMDQPGNVSITQGVHDTVRIRYYRNYITELKKAIDDGAKVIGYFAWSLLDNFEWRLGY  468

Query  582  TSRFGIVYV  608
            TSRFGIVYV
Sbjct  469  TSRFGIVYV  477



>gb|ACF35791.1| beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group]
Length=483

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PI++G YP +M  IV DR+P F+ +E ++VK SIDYVGIN YT+FY+ DP P
Sbjct  269  FHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRMVKDSIDYVGINHYTSFYMKDPGP  328

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGFAY RNGVPIG +ANS WLY+VPWG+ KAVTYVKE YGNP M LS
Sbjct  329  WNLTPTSYQDDWHVGFAYERNGVPIGAQANSYWLYIVPWGINKAVTYVKETYGNPTMILS  388

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GN+++ + ++DT RI YY++Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  389  ENGMDQPGNVSITQGVHDTVRIRYYRNYITELKKAIDDGAKVIGYFAWSLLDNFEWRLGY  448

Query  582  TSRFGIVYV  608
            TSRFGIVYV
Sbjct  449  TSRFGIVYV  457



>gb|AAX95520.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
Length=603

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLVKGS DY GI
Sbjct  323  STEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLVKGSADYFGI  382

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+ D         +Y +DW+V F + RNGVPIG +ANS WLY+VP G+Y AV Y
Sbjct  383  NQYTANYMADQPAPQQAATSYSSDWHVSFIFQRNGVPIGQQANSNWLYIVPTGMYGAVNY  442

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+Y NP + +SENGMD  GNLT  E L+DT+RI +YK+YL ELK+ +DDGAN+  YFA
Sbjct  443  IKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLTELKKAIDDGANVVAYFA  502

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  503  WSLLDNFEWLSGYTSKFGIVYV  524



>sp|A3BMZ5.1|BGL26_ORYSJ RecName: Full=Beta-glucosidase 26; Short=Os7bglu26; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|EAZ04982.1| hypothetical protein OsI_27163 [Oryza sativa Indica Group]
 gb|EAZ40934.1| hypothetical protein OsJ_25416 [Oryza sativa Japonica Group]
Length=510

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PI++G YP +M  IV DR+P F+ +E ++VK SIDYVGIN YT+FY+ DP P
Sbjct  296  FHLGWFLDPIIHGRYPYSMLEIVKDRMPTFSDEESRMVKDSIDYVGINHYTSFYMKDPGP  355

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGFAY RNGVPIG +ANS WLY+VPWG+ KAVTYVKE YGNP M LS
Sbjct  356  WNLTPTSYQDDWHVGFAYERNGVPIGAQANSYWLYIVPWGINKAVTYVKETYGNPTMILS  415

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GN+++ + ++DT RI YY++Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  416  ENGMDQPGNVSITQGVHDTVRIRYYRNYITELKKAIDDGAKVIGYFAWSLLDNFEWRLGY  475

Query  582  TSRFGIVYV  608
            TSRFGIVYV
Sbjct  476  TSRFGIVYV  484



>ref|XP_006658055.1| PREDICTED: beta-glucosidase 26-like [Oryza brachyantha]
Length=511

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PI++G YP +M  IV DRLP F+ +E ++VKGSIDYVGIN YT+FY+ DP P
Sbjct  297  FHLGWFLDPIIHGRYPYSMLEIVKDRLPTFSDEESRMVKGSIDYVGINHYTSFYMKDPGP  356

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGF Y RNGVPIG  ANS WLY+VPWG+ KAVTYVKE YGNP M LS
Sbjct  357  WNLTPVSYQDDWHVGFVYERNGVPIGAHANSYWLYIVPWGINKAVTYVKETYGNPTMILS  416

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GN+++ + ++DT R+ YY+ Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  417  ENGMDQPGNVSITQGVHDTVRVRYYRDYITELKKAIDDGAKVIGYFAWSLLDNFEWRLGY  476

Query  582  TSRFGIVYV  608
            TSRFGI+YV
Sbjct  477  TSRFGIIYV  485



>ref|XP_006650460.1| PREDICTED: beta-glucosidase 8-like [Oryza brachyantha]
Length=568

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWFL P++ G+YPK M++IV +RLP FTP++ KLVKGS DY GI
Sbjct  288  STEDQAAAQRARDFHVGWFLDPLINGQYPKNMRDIVKERLPTFTPEQAKLVKGSADYFGI  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+ D         +Y +DW+V F + RNG+PIG +ANS WLY+VP G+Y  V Y
Sbjct  348  NQYTASYMSDQPAPQQAPTSYSSDWHVSFIFQRNGIPIGQQANSNWLYIVPTGMYGCVNY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+Y NP + +SENGMD  GNLT  E L+DT+RI +YK+YL ELK+ +DDGAN+  YFA
Sbjct  408  LKEKYNNPTIIISENGMDQSGNLTREEFLHDTERIEFYKNYLTELKKAIDDGANVVAYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  468  WSLLDNFEWLSGYTSKFGIVYV  489



>gb|AFW79802.1| hypothetical protein ZEAMMB73_091278 [Zea mays]
Length=539

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 155/203 (76%), Gaps = 13/203 (6%)
 Frame = +3

Query  39   DFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPY  218
            DFH+GWFLHPIVYGEYPK+++  V  RLP+FT +E  LV+GSIDYVG+NQYT +YV D  
Sbjct  313  DFHVGWFLHPIVYGEYPKSVRRSVKGRLPKFTAEEAGLVRGSIDYVGVNQYTAYYVRDRR  372

Query  219  PK-TPYIHTYQNDWNVGF------------AYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            P  T    +Y +DW+  F            A  R+GVPIGPRANS+WLY+VPWGLYKAVT
Sbjct  373  PNATAAPPSYSSDWHAEFVSSLTPIHATLHADERDGVPIGPRANSDWLYIVPWGLYKAVT  432

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            YVKE+YGNP M LSENGMD  GN+T+ + + D  R++YY+SY+AELK  +D GAN  GYF
Sbjct  433  YVKEKYGNPTMLLSENGMDDPGNVTVGQGVRDAARVAYYRSYVAELKAAIDGGANCVGYF  492

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW++GYTSRFG+VYV
Sbjct  493  AWSLLDNFEWKLGYTSRFGLVYV  515



>gb|EMS60983.1| Beta-glucosidase 26 [Triticum urartu]
Length=525

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 159/207 (77%), Gaps = 20/207 (10%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDP--  215
            FHIGWFL PI  G YP +M  IVG+RLP F+ DE ++VKGSIDYVGINQYT++Y+ DP  
Sbjct  295  FHIGWFLDPITNGCYPSSMLKIVGNRLPGFSADEARMVKGSIDYVGINQYTSYYMKDPGA  354

Query  216  YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMF  395
            + +TP   +YQ+DW+VGF Y RNGVPIGPRANS+WLY+VPWG+ KAVTYVKERYGNP M 
Sbjct  355  WNQTPV--SYQDDWHVGFVYERNGVPIGPRANSDWLYIVPWGMNKAVTYVKERYGNPTMI  412

Query  396  LSEN----------------GMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  527
            LSEN                GMD  GN+++A+ ++DT RI YY+ Y+ ELK+ +D+GA +
Sbjct  413  LSENGVLTDKETNDQCYDLTGMDQPGNVSIADGVHDTIRIRYYRDYITELKKAIDNGARV  472

Query  528  FGYFAWSLLDNFEWRIGYTSRFGIVYV  608
             GYFAWSLLDNFEWR+GYT+RFGIVYV
Sbjct  473  VGYFAWSLLDNFEWRLGYTARFGIVYV  499



>ref|XP_002464027.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
 gb|EER91025.1| hypothetical protein SORBIDRAFT_01g010830 [Sorghum bicolor]
Length=514

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF+ P++ G YP+ MQ+IV +RLP+FTP + KLVKGS DY+GI
Sbjct  288  STEDQAAAQRARDFHVGWFVDPLINGHYPQMMQDIVKERLPKFTPGQAKLVKGSADYIGI  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V +A  RNG PIGP+ANS WLY+VP G+Y  V Y
Sbjct  348  NQYTASYIKGQKLLQQKPTSYSADWQVQYALERNGKPIGPQANSNWLYIVPSGMYGCVNY  407

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP +F++ENGMD  GNLT  + L+DT R+ +YK YLAELK+ +DDGAN+ GYFA
Sbjct  408  LKQKYGNPTVFITENGMDQPGNLTREQYLHDTTRVQFYKGYLAELKKAIDDGANVAGYFA  467

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW+ GYTS+FGIVYV
Sbjct  468  WSLLDNFEWQSGYTSKFGIVYV  489



>emb|CDM80087.1| unnamed protein product [Triticum aestivum]
Length=507

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 153/191 (80%), Gaps = 4/191 (2%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD--P  215
            FH+GWFL PI++G YP TM  IV DRLPRF+ DE  +VKGSIDYVGINQYT+FY+ D   
Sbjct  293  FHLGWFLDPIIHGRYPFTMLEIVKDRLPRFSADESTMVKGSIDYVGINQYTSFYMKDNGT  352

Query  216  YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMF  395
            +  TP   +YQ+DW+V F Y RNGVPIG  ANS WLY+VPWG+ KAVTYVKERYGNP M 
Sbjct  353  WNLTPI--SYQDDWHVEFVYERNGVPIGAHANSYWLYIVPWGINKAVTYVKERYGNPTMI  410

Query  396  LSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRI  575
            L+ENGMD  GN+++A+ + DT RI YY+ Y+ ELK+ ++DGA + GYFAWSLLDNFEWR+
Sbjct  411  LAENGMDQPGNVSIADGVRDTVRIRYYRDYITELKKAINDGAQVIGYFAWSLLDNFEWRL  470

Query  576  GYTSRFGIVYV  608
            GYT+RFGIVYV
Sbjct  471  GYTARFGIVYV  481



>ref|XP_003559508.1| PREDICTED: beta-glucosidase 7-like [Brachypodium distachyon]
Length=511

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 154/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFTPDE KLV GS DY+GI
Sbjct  286  STDDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTPDETKLVNGSADYIGI  345

Query  183  NQYTTFYVYDP--YPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAV  356
            NQYT  Y+      P+ P   +Y  DW V +A  RNG+PIGP+ANS WLY+VP G+Y  V
Sbjct  346  NQYTANYIKGQKLVPQKP--TSYSADWQVTYASDRNGIPIGPKANSNWLYIVPTGMYGCV  403

Query  357  TYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
             Y++E+YGNP + ++ENGMD  GNLT  E L+D  RI YY+SYLAELKR +D GAN+ GY
Sbjct  404  NYLREKYGNPAVVITENGMDQPGNLTRDEYLHDITRIRYYRSYLAELKRAIDGGANVLGY  463

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYTS+FGIVYV
Sbjct  464  FAWSLLDNFEWISGYTSKFGIVYV  487



>ref|XP_003559510.1| PREDICTED: beta-glucosidase 8-like [Brachypodium distachyon]
Length=570

 Score =   265 bits (677),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWFL P+V G+YPKTMQ+IV +RLP FT ++ KLVKGS DY GI
Sbjct  286  STEDQAAAQRARDFHVGWFLDPLVNGQYPKTMQDIVKERLPSFTSEQSKLVKGSADYFGI  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+ D         +Y +DW+V F + RNG PIGP ANS WLY+VP G+Y  V Y
Sbjct  346  NQYTASYMADQPTPQQAPTSYSSDWHVSFIFQRNGKPIGPLANSNWLYIVPTGMYGCVNY  405

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+Y NP + +SENGMD  GNLT  E L+DT R+ +YK+YL+ELK+ +DDGAN+  YFA
Sbjct  406  IKEKYKNPTIIISENGMDQPGNLTREEFLHDTVRVEFYKNYLSELKKAIDDGANVVAYFA  465

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  466  WSLLDNFEWLSGYTSKFGIVYV  487



>gb|ABF98424.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
Length=400

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  177  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  236

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  237  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  296

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  297  IKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  356

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  357  WSLLDNFEWLSGYTSKFGIVYV  378



>ref|XP_004982055.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Setaria italica]
Length=503

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKGS DY+GI
Sbjct  278  STDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKGSADYIGI  337

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V +  ARNG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  338  NQYTASYMKGQKLLQQTPTSYSADWQVQYVLARNGKPIGPQANSNWLYIVPWGMYGCVNY  397

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+YGNP ++++ENGMD  GNLT  + L D  R+ +YKSYLA+LK+ +D GAN+ GYFA
Sbjct  398  LKEKYGNPTVYITENGMDQPGNLTRDQYLRDVTRVRFYKSYLAQLKKAIDQGANVAGYFA  457

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY+S+FGIVYV
Sbjct  458  WSLLDNFEWLSGYSSKFGIVYV  479



>ref|XP_008665263.1| PREDICTED: beta-glucosidase 7-like [Zea mays]
 tpg|DAA50883.1| TPA: hypothetical protein ZEAMMB73_196159 [Zea mays]
Length=506

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLP+FTP++ KLVKGS DY+GI
Sbjct  279  STEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKFTPEQAKLVKGSADYIGI  338

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  YV           +Y  DW V +   RNG PIGP+ANS+WLY+VP G+Y  V Y
Sbjct  339  NQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQANSKWLYIVPEGMYGCVNY  398

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K +YGNP +F++ENGMD  GNLT  + L+DT R+ +YK YLAEL++ +DDGA++ GYFA
Sbjct  399  LKHKYGNPTVFITENGMDQPGNLTRGQYLHDTTRVQFYKGYLAELRKAIDDGADVAGYFA  458

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW+ GYTS+FGIVYV
Sbjct  459  WSLLDNFEWQSGYTSKFGIVYV  480



>gb|EAY86111.1| hypothetical protein OsI_07481 [Oryza sativa Indica Group]
Length=527

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  304  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  363

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  364  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  423

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  424  IKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  483

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  484  WSLLDNFEWLSGYTSKFGIVYV  505



>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F4V|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5J|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5K|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3F5L|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- 
Glucosidase
 pdb|3AHT|A Chain A, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHT|B Chain B, Crystal Structure Of Rice Bglu1 E176q Mutant In Complex 
With Laminaribiose
 pdb|3AHV|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
 pdb|3AHV|B Chain B, Semi-Active E176q Mutant Of Rice Bglu1 Covalent Complex 
With 2-Deoxy- 2-Fluoroglucoside
Length=481

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  258  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  317

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  318  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  377

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  378  IKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  437

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  438  WSLLDNFEWLSGYTSKFGIVYV  459



>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGL|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
 pdb|2RGM|B Chain B, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
Length=481

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  258  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  317

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  318  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  377

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  378  IKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  437

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  438  WSLLDNFEWLSGYTSKFGIVYV  459



>ref|XP_002464026.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
 gb|EER91024.1| hypothetical protein SORBIDRAFT_01g010825 [Sorghum bicolor]
Length=567

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWFL P++ G+YPKTMQ+IV DRLP FTP++ KLVKGS DY GI
Sbjct  293  STEDQAAAQRARDFHIGWFLDPLINGQYPKTMQDIVKDRLPSFTPEQAKLVKGSSDYFGI  352

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT Y+ +         +Y +DW V + + RNGV IG  A+S WLY+VP G+Y  VTY
Sbjct  353  NQYTTNYISNQQTTQQGPPSYSSDWGVQYNFERNGVQIGQLAHSVWLYIVPTGMYGVVTY  412

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+Y NP + +SENGMD  G+LT  E L+DT RI +YK+YL ELK+ +DDGAN+ GYFA
Sbjct  413  LKEKYQNPTIIISENGMDQPGDLTREEYLHDTVRIDFYKNYLTELKKGIDDGANVVGYFA  472

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  473  WSLLDNFEWLSGYTSKFGIVYV  494



>ref|NP_001051013.1| Os03g0703000 [Oryza sativa Japonica Group]
 sp|Q75I93.1|BGL07_ORYSJ RecName: Full=Beta-glucosidase 7; Short=Os3bglu7; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAS07254.1| beta-glucosidase (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|AAX95519.1| Putative Glycosyl hydrolase family 1 protein [Oryza sativa Japonica 
Group]
 gb|ABF98423.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12927.1| Os03g0703000 [Oryza sativa Japonica Group]
 dbj|BAG94472.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30396.1| beta-glucosidase [Oryza sativa]
Length=504

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  281  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  340

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  341  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  400

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  401  IKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  460

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  461  WSLLDNFEWLSGYTSKFGIVYV  482



>ref|XP_006651730.1| PREDICTED: beta-glucosidase 7-like, partial [Oryza brachyantha]
Length=467

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  244  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  303

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  304  NQYTASYMKGQQLIQQTPTSYSADWQVSYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  363

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL++LK+ +D+GAN+ GYFA
Sbjct  364  IKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLSQLKKAIDEGANVAGYFA  423

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY S+FGIVYV
Sbjct  424  WSLLDNFEWLSGYNSKFGIVYV  445



>gb|AAA84906.3| beta-glucosidase [Oryza sativa Japonica Group]
Length=504

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  281  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  340

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  341  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  400

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ENGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  401  IKQKYGNPTVVITENGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  460

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  461  WSLLDNFEWLSGYTSKFGIVYV  482



>ref|XP_002974513.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
 gb|EFJ24735.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
Length=494

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLP+F+ D++++VKGS+D+VGI
Sbjct  268  STEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVKGSVDFVGI  327

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y  D   +      Y  D N+   + R+GV IGPRA+S WLY+VPWG+YKA++Y
Sbjct  328  NHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHSTWLYIVPWGMYKALSY  387

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE YGNP + LSENGMD   NLTL++SL+DT RI+YY+SY+  L   + DGAN+ GYFA
Sbjct  388  IKEHYGNPKVVLSENGMDDPANLTLSQSLHDTTRINYYQSYIENLVAAMRDGANVHGYFA  447

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSL+DNFEW  GYTSRFG+VY+
Sbjct  448  WSLVDNFEWLSGYTSRFGLVYI  469



>ref|XP_003559509.1| PREDICTED: beta-glucosidase 7-like isoform X1 [Brachypodium distachyon]
 ref|XP_010230912.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Brachypodium distachyon]
Length=510

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 150/202 (74%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFT DEVK+VKGS DY+GI
Sbjct  285  SAEDEAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTSDEVKIVKGSADYIGI  344

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V +A  RNG PIGP+ANS+WLY+VP G+Y  V Y
Sbjct  345  NQYTASYIKGQKLVQQAPTSYSADWQVTYASLRNGKPIGPKANSDWLYIVPTGMYGCVNY  404

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            ++ +YGNP + ++ENGMD  GNLT  E L D  R+ +Y+SYLAELK+ +D GAN+ GYFA
Sbjct  405  LRVKYGNPAIVITENGMDQPGNLTRDEYLRDVTRVRFYRSYLAELKKAIDGGANVLGYFA  464

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  465  WSLLDNFEWGSGYTSKFGIVYV  486



>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCR|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant
 pdb|3SCS|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCS|B Chain B, Crystal Structure Of Rice Bglu1 E386s Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  258  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  317

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  318  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  377

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  378  IKQKYGNPTVVITSNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  437

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  438  WSLLDNFEWLSGYTSKFGIVYV  459



>gb|ACL52625.1| unknown [Zea mays]
 tpg|DAA63940.1| TPA: non-cyanogenic beta-glucosidase [Zea mays]
Length=512

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PIV+G YP +MQ I  DRLP F+ +E ++VKGSIDYVGIN YT+FY+ DP  
Sbjct  299  FHLGWFLDPIVHGRYPYSMQEIAKDRLPLFSDEEARMVKGSIDYVGINHYTSFYMKDPGT  358

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGF Y RNGVPIG  ANS WLY+VPWG+ KAV+YVKE Y NP M L+
Sbjct  359  WNLTPVSYQDDWHVGFVYERNGVPIGAHANSYWLYIVPWGINKAVSYVKETYKNPTMILA  418

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  G++++ + ++DT RI YY+ Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  419  ENGMDQPGDVSITQGVHDTVRIRYYRDYITELKKAIDDGARVIGYFAWSLLDNFEWRLGY  478

Query  582  TSRFGIVYV  608
            TSRFG+VYV
Sbjct  479  TSRFGLVYV  487



>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCP|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant
 pdb|3SCQ|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCQ|B Chain B, Crystal Structure Of Rice Bglu1 E386a Mutant Complexed 
With Alpha- Glucosyl Fluoride
Length=481

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  258  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  317

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  318  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  377

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  378  IKQKYGNPTVVITANGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  437

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  438  WSLLDNFEWLSGYTSKFGIVYV  459



>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCN|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant
 pdb|3SCO|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCO|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Alpha- Glucosyl Fluoride
 pdb|3SCT|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCT|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellotetraose
 pdb|3SCU|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
 pdb|3SCU|B Chain B, Crystal Structure Of Rice Bglu1 E386g Mutant Complexed 
With Cellopentaose
Length=481

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  258  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  317

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  318  NQYTASYMKGQQLMQQTPTSYSADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  377

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  378  IKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  437

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  438  WSLLDNFEWLSGYTSKFGIVYV  459



>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCV|B Chain B, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  258  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  317

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V + +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  318  NQYTASYMKGQQLMQQTPTSYAADWQVTYVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  377

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  378  IKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  437

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  438  WSLLDNFEWLSGYTSKFGIVYV  459



>ref|XP_004982056.1| PREDICTED: beta-glucosidase 7-like isoform X2 [Setaria italica]
Length=502

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 152/202 (75%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKGS DY+GI
Sbjct  278  STDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKGSADYIGI  337

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V +  +RNG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  338  NQYTASYMKGQKLLQQTPTSYSADWQVQYV-SRNGKPIGPQANSNWLYIVPWGMYGCVNY  396

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+YGNP ++++ENGMD  GNLT  + L D  R+ +YKSYLA+LK+ +D GAN+ GYFA
Sbjct  397  LKEKYGNPTVYITENGMDQPGNLTRDQYLRDVTRVRFYKSYLAQLKKAIDQGANVAGYFA  456

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY+S+FGIVYV
Sbjct  457  WSLLDNFEWLSGYSSKFGIVYV  478



>ref|XP_002990785.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
 gb|EFJ08058.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
Length=495

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQR RDFH+GWFL PI+ G YPKTMQ  VG RLP+F+ D++++VKGS+D+VGI
Sbjct  269  STEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVKGSVDFVGI  328

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y  D   +      Y  D N+   + R+GV IGPRA+S WLY+VPWG+YKA++Y
Sbjct  329  NHYTTYYAKDAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHSTWLYIVPWGMYKALSY  388

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K+ YGNP + LSENGMD   NLTL +SL+DT RI+YY+SY+  L   + DGAN+ GYFA
Sbjct  389  IKDHYGNPKVVLSENGMDDPANLTLFQSLHDTTRINYYQSYIENLVAAMKDGANVHGYFA  448

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSL+DNFEW  GYTSRFG+VY+
Sbjct  449  WSLVDNFEWLSGYTSRFGLVYI  470



>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
 pdb|3SCW|B Chain B, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED 
WITH Cellotetraose
Length=481

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 150/202 (74%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGW+L P++ G YP+ MQ++V DRLP+FTP++ +LVKGS DY+GI
Sbjct  258  STEDQAAAQRARDFHIGWYLDPLINGHYPQIMQDLVKDRLPKFTPEQARLVKGSADYIGI  317

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  Y+           +Y  DW V   +A+NG PIGP+ANS WLY+VPWG+Y  V Y
Sbjct  318  NQYTASYMKGQQLMQQTPTSYSADWQVTAVFAKNGKPIGPQANSNWLYIVPWGMYGCVNY  377

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +K++YGNP + ++ NGMD   NL+  + L DT R+ +Y+SYL +LK+ +D+GAN+ GYFA
Sbjct  378  IKQKYGNPTVVITGNGMDQPANLSRDQYLRDTTRVHFYRSYLTQLKKAIDEGANVAGYFA  437

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  438  WSLLDNFEWLSGYTSKFGIVYV  459



>ref|NP_001151026.1| LOC100284659 precursor [Zea mays]
 gb|ACG41348.1| beta-glucosidase precursor [Zea mays]
 tpg|DAA50884.1| TPA: hypothetical protein ZEAMMB73_397657 [Zea mays]
Length=564

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWFL P++ G+YPK MQ+IV DRLP FTP++ KLVKGS DY GI
Sbjct  291  STEDQKAAQRARDFHIGWFLDPLINGQYPKIMQDIVKDRLPSFTPEQAKLVKGSSDYFGI  350

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT+Y+ D         +Y +DW V + + RNGV IG  A+S WLY+VP G+Y  V Y
Sbjct  351  NQYTTYYIADQQTPPQGPPSYSSDWGVQYYFQRNGVQIGQMAHSIWLYIVPSGMYGVVNY  410

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+Y NP++ +SENGMD  GNLT  E ++D  RI +YK+YL ELKR +D GAN+ GYFA
Sbjct  411  LKEKYHNPIIIISENGMDQPGNLTREEYVHDAVRIDFYKNYLTELKRGIDGGANVIGYFA  470

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  471  WSLLDNFEWLSGYTSKFGIVYV  492



>ref|NP_001142124.1| uncharacterized protein LOC100274288 precursor [Zea mays]
 gb|ACF87697.1| unknown [Zea mays]
 gb|ACF87698.1| unknown [Zea mays]
 gb|ACR38603.1| unknown [Zea mays]
 tpg|DAA50881.1| TPA: hypothetical protein ZEAMMB73_806821 [Zea mays]
Length=502

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFHIGWF+ P++ G YP+ MQ++V +RLPRFTP++ KLVKGS DY+GI
Sbjct  278  SPDDQAAAQRARDFHIGWFVDPLINGHYPQIMQDLVKERLPRFTPEQAKLVKGSADYIGI  337

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N+YT+ Y+           +Y  DW V + +ARNG PIGP+ANS+WLY+ P G+Y  V Y
Sbjct  338  NEYTSSYMKGQKLVQLAPSSYSADWQVQYVFARNGKPIGPQANSKWLYIAPTGMYGCVNY  397

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            +KE+YGNP ++++ENGMD  GNLT  + L D  R+ +Y+SY+ +LK+ +D GAN+ GYFA
Sbjct  398  LKEKYGNPTIYITENGMDQPGNLTRDQYLRDATRVRFYRSYIGQLKKAIDQGANVAGYFA  457

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY+S+FGIVYV
Sbjct  458  WSLLDNFEWLAGYSSKFGIVYV  479



>ref|NP_001148821.1| LOC100282438 precursor [Zea mays]
 gb|ACG33023.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=512

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PIV+G YP +MQ I  DRLP F+ +E ++VKGSIDYVGIN YT+FY+ DP  
Sbjct  299  FHLGWFLDPIVHGRYPYSMQEIAKDRLPLFSDEEARMVKGSIDYVGINHYTSFYMKDPGT  358

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGF Y RNGVPIG  ANS WLY+VPWG+ KAV+YVKE Y N  M L+
Sbjct  359  WNLTPVSYQDDWHVGFVYERNGVPIGAHANSYWLYIVPWGINKAVSYVKETYKNLTMILA  418

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  G++++ + ++DT RI YY+ Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  419  ENGMDQPGDVSITQGVHDTVRIRYYRDYITELKKAIDDGARVIGYFAWSLLDNFEWRLGY  478

Query  582  TSRFGIVYV  608
            TSRFG+VYV
Sbjct  479  TSRFGLVYV  487



>ref|XP_004958541.1| PREDICTED: beta-glucosidase 26-like [Setaria italica]
Length=539

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PIV G YP +MQ IV DRLP F+ +E ++VKGSIDYVGIN YT+FY+ DP  
Sbjct  326  FHLGWFLDPIVNGRYPYSMQEIVEDRLPLFSDEESRMVKGSIDYVGINHYTSFYMKDPGT  385

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ DW+  F Y RNGVPIG  ANS WLY+VPWG+ KAV YVKE Y NP+M L+
Sbjct  386  WNLMPISYQYDWHASFVYERNGVPIGAHANSYWLYIVPWGINKAVNYVKETYENPIMILA  445

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GN+++++ ++DT RI YY+ Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  446  ENGMDQPGNISISQGVHDTIRIRYYRDYITELKKAIDDGARVIGYFAWSLLDNFEWRLGY  505

Query  582  TSRFGIVYV  608
            TSRFG+VYV
Sbjct  506  TSRFGLVYV  514



>ref|XP_002461141.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
 gb|EER97662.1| hypothetical protein SORBIDRAFT_02g041550 [Sorghum bicolor]
Length=512

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWFL PI+ G YP +MQ IV DRLP F+ +E ++VKGSIDYVGIN YT+FY+ DP  
Sbjct  299  FHLGWFLDPIINGRYPYSMQEIVKDRLPLFSDEESRMVKGSIDYVGINHYTSFYMKDPGT  358

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +YQ+DW+VGF Y RN +PIG  ANS WLY+VPWG+ KAV YVKE Y NP M L+
Sbjct  359  WNLTPVSYQDDWHVGFVYERNSIPIGAHANSYWLYIVPWGINKAVNYVKETYENPTMILA  418

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  G++++ + ++DT RI YY+ Y+ ELK+ +DDGA + GYFAWSLLDNFEWR+GY
Sbjct  419  ENGMDQPGDISITQGVHDTIRIRYYRDYITELKKAIDDGARVIGYFAWSLLDNFEWRLGY  478

Query  582  TSRFGIVYV  608
            TSRFG+VYV
Sbjct  479  TSRFGLVYV  487



>gb|EMS62097.1| Beta-glucosidase 7 [Triticum urartu]
Length=531

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFTPDE KLVKGS DY+GI
Sbjct  306  STEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTPDEAKLVKGSADYIGI  365

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT   +           +Y  DW V +A+ RNG PIGP+ANS WLY+VP G+Y  V Y
Sbjct  366  NQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKANSNWLYIVPSGMYGCVHY  425

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            + ++YGNP + ++ENGMD  G LT  + L D  R+ YY+SYL ELK+ +D GAN+ GYFA
Sbjct  426  LSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRYYRSYLGELKKAIDGGANVLGYFA  485

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY+S+FGIVYV
Sbjct  486  WSLLDNFEWISGYSSKFGIVYV  507



>gb|ADP02192.1| putative non-cyanogenic beta-glucosidase [Triticum aestivum]
Length=507

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFTPDE KLVKGS DY+GI
Sbjct  282  STEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTPDEAKLVKGSADYIGI  341

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT   +           +Y  DW V +A+ RNG PIGP+ANS WLY+VP G+Y  V Y
Sbjct  342  NQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKANSNWLYIVPSGMYGCVHY  401

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            + ++YGNP + ++ENGMD  G LT  + L D  R+ +Y+SYL+ELK+ +D GAN+ GYFA
Sbjct  402  LSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRFYRSYLSELKKAIDGGANVLGYFA  461

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY+S+FGIVYV
Sbjct  462  WSLLDNFEWISGYSSKFGIVYV  483



>gb|EMT31426.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=509

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLPRFTP E KLVKGS DY+GI
Sbjct  284  STEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPRFTPSEAKLVKGSADYIGI  343

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT   +           +Y  DW V +A+ RNG PIGP+ANS WLY+VP G+Y  V Y
Sbjct  344  NQYTASLMKGQKLTQQTPTSYSADWQVTYAFERNGKPIGPKANSNWLYIVPSGMYGCVHY  403

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            + ++YGNP + ++ENGMD  G LT  + L D  R+ +Y+SYL+ELK+ +D GAN+ GYFA
Sbjct  404  LSQKYGNPAIVITENGMDQPGGLTRDQYLRDATRVRFYRSYLSELKKAIDGGANVLGYFA  463

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY+S+FGIVYV
Sbjct  464  WSLLDNFEWISGYSSKFGIVYV  485



>gb|EMT23872.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=537

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 155/211 (73%), Gaps = 24/211 (11%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD--P  215
            FH+GWFL PI++G YP TM  IV DRLPRF+ DE ++VKGSIDYVGINQYT+FY+ D   
Sbjct  303  FHLGWFLDPIIHGHYPFTMLEIVKDRLPRFSDDESRMVKGSIDYVGINQYTSFYMKDNGT  362

Query  216  YPKTPYIHTYQNDWNVGFAYARNGVPIGP--------------------RANSEWLYMVP  335
            +  TP   +YQ+DW+V F + RNGV IG                     +ANS WLY+VP
Sbjct  363  WNLTPV--SYQDDWHVEFVFKRNGVLIGAHMDKCRFSVEHCNCKLVEFMQANSYWLYIVP  420

Query  336  WGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDD  515
            WG+ KAVTYVKERYGNP+M L+ENGMD  GN+++A+ + DT RI YY+ Y+ ELK+ +DD
Sbjct  421  WGINKAVTYVKERYGNPIMILAENGMDQPGNISIADGVRDTVRIRYYRDYITELKKAIDD  480

Query  516  GANLFGYFAWSLLDNFEWRIGYTSRFGIVYV  608
            GA + GYFAWSLLDNFEWR+GYT+RFGIVYV
Sbjct  481  GARVIGYFAWSLLDNFEWRLGYTARFGIVYV  511



>ref|XP_006664007.1| PREDICTED: beta-glucosidase 38-like [Oryza brachyantha]
Length=498

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 152/201 (76%), Gaps = 2/201 (1%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            + D  AA RAR+F +GWFLHPI YG YP+TMQNIV  RLP FT ++ +++KGS DY+GIN
Sbjct  276  EEDRAAAHRAREFTLGWFLHPITYGHYPETMQNIVMRRLPNFTREQSEMIKGSADYIGIN  335

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
             YTT+YV     KT    +Y NDW+V  +Y R+GVPIG +A S WLY+VPWG+YKAV +V
Sbjct  336  HYTTYYVSHHVNKT--FMSYLNDWDVKISYERDGVPIGKQAYSNWLYVVPWGIYKAVMHV  393

Query  366  KERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            KE+Y +P++ + ENG+D  GN TL  +L D+ RI Y+  YL ELKR + DGA + GYFAW
Sbjct  394  KEKYKDPIIIIGENGIDQPGNDTLPGALYDSFRIEYFDQYLHELKRAITDGAKVIGYFAW  453

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SLLDNFEWR+G+TS+FGIVYV
Sbjct  454  SLLDNFEWRLGFTSKFGIVYV  474



>ref|XP_010237292.1| PREDICTED: beta-glucosidase 38-like [Brachypodium distachyon]
Length=494

 Score =   250 bits (639),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = +3

Query  12   DNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQY  191
            D YAA RAR+F +GWFLHPI YG YP+TMQ IVGDRLP F+P++  LV+GS DY+GIN Y
Sbjct  274  DEYAAHRAREFTLGWFLHPITYGHYPETMQKIVGDRLPSFSPEQTALVQGSADYIGINHY  333

Query  192  TTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKE  371
            T++YV   Y    ++ +Y NDW    +Y RNGV IG +A S WLY+VPWG YKAV +VK+
Sbjct  334  TSYYV-KHYVNLTHM-SYANDWQAKISYDRNGVLIGKQAFSNWLYVVPWGFYKAVMHVKD  391

Query  372  RYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSL  551
            ++ NP++ + ENG+D  GN TL  +L D  RI Y+  YL ELKR +DDGA + GYFAWSL
Sbjct  392  KFRNPVIVIGENGIDQAGNDTLPHALYDHFRIDYFDQYLHELKRAIDDGARVVGYFAWSL  451

Query  552  LDNFEWRIGYTSRFGIVYV  608
            LDNFEWR+G+TS+FG+VYV
Sbjct  452  LDNFEWRMGFTSKFGLVYV  470



>gb|EEC69164.1| hypothetical protein OsI_38122 [Oryza sativa Indica Group]
Length=492

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
             + D+ AA RAR+F +GW+LHPI+YG YP+TMQN V +RLP FT ++ +++KGS DY+ I
Sbjct  269  KEEDHAAAHRAREFTLGWYLHPIIYGHYPETMQNAVKERLPNFTREQSEMIKGSADYIAI  328

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+YV     KT    +Y NDW+V  +Y RNGVPIG +A S WLY+VPWG+YKAV +
Sbjct  329  NHYTTYYVSHHVNKTSI--SYLNDWDVKISYERNGVPIGKQAYSNWLYVVPWGIYKAVMH  386

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+Y +P++ + ENG+D  GN TL  +L D  RI Y+  YL ELKR + DGA + GYFA
Sbjct  387  VKEKYKDPIIIIGENGIDQPGNETLPGALYDFFRIQYFDQYLHELKRAIKDGARVTGYFA  446

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+G+TS+FGIVYV
Sbjct  447  WSLLDNFEWRLGFTSKFGIVYV  468



>emb|CDM83785.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V +RLPRFTPDE K+VKGS D++G+
Sbjct  278  STEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVKERLPRFTPDEAKVVKGSADWIGV  337

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT +V           +Y  D  V +++ RNG PIGPRA+S+WLY+VP G+Y  V Y
Sbjct  338  NQYTTEFVKGQKLVLQRPTSYSADLQVTYSFERNGKPIGPRASSKWLYIVPRGMYGCVHY  397

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            + ++YGNP M +++NGMD  GNLT  + L D  R+ YY+SYL ELK+ +D GAN+ GYFA
Sbjct  398  ISQKYGNPPMLITKNGMDQPGNLTRDQYLRDATRVRYYRSYLCELKKAIDGGANVLGYFA  457

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  458  WSLLDNFEWMYGYTSKFGIVYV  479



>ref|NP_001066656.1| Os12g0420100 [Oryza sativa Japonica Group]
 sp|Q2QSR8.2|BGL38_ORYSJ RecName: Full=Beta-glucosidase 38; Short=Os12bglu38; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA97621.2| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29675.1| Os12g0420100 [Oryza sativa Japonica Group]
 dbj|BAG92285.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53109.1| hypothetical protein OsJ_35886 [Oryza sativa Japonica Group]
Length=492

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
             + D+ AA RAR+F +GW+LHPI YG YP+TMQN V +RLP FT ++ +++KGS DY+ I
Sbjct  269  KEEDHAAAHRAREFTLGWYLHPITYGHYPETMQNAVKERLPNFTREQSEMIKGSADYIAI  328

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+YV     KT    +Y NDW+V  +Y RNGVPIG +A S WLY+VPWG+YKAV +
Sbjct  329  NHYTTYYVSHHVNKTSI--SYLNDWDVKISYERNGVPIGKQAYSNWLYVVPWGIYKAVMH  386

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKE+Y +P++ + ENG+D  GN TL  +L D  RI Y+  YL ELKR + DGA + GYFA
Sbjct  387  VKEKYKDPIIIIGENGIDQPGNETLPGALYDFFRIQYFDQYLHELKRAIKDGARVTGYFA  446

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+G+TS+FGIVYV
Sbjct  447  WSLLDNFEWRLGFTSKFGIVYV  468



>dbj|BAJ90056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF+ P++ G YP+ MQ++V +RLP+FTP E K+V GS DY+GI
Sbjct  276  STEDQAAAQRARDFHVGWFVDPLINGHYPQIMQDLVKERLPKFTPAEAKMVMGSADYIGI  335

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT   +           +Y  DW V +A+ RNG PIGP+ANS WLY+VP G+Y  V Y
Sbjct  336  NQYTASLMKGQKLLQQTPTSYSADWQVTYAFERNGKPIGPKANSNWLYIVPSGMYGCVHY  395

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            + ++YGNP + ++ENGMD  G LT  + L DT R+ +Y+SYL+ELK+ +D GAN+ GYFA
Sbjct  396  LSQKYGNPPIVITENGMDQPGGLTRDQYLRDTTRVRFYRSYLSELKKAIDGGANVLGYFA  455

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GY+S+FGIVYV
Sbjct  456  WSLLDNFEWMSGYSSKFGIVYV  477



>gb|EMT00720.1| Beta-glucosidase 1 [Aegilops tauschii]
Length=545

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 150/205 (73%), Gaps = 17/205 (8%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PY  218
            FH+GWFL P++ G+YPKTMQ+IV +RLP FTP++ KLVKGS+DY+GINQYT  Y+ D P 
Sbjct  260  FHVGWFLDPLLNGQYPKTMQDIVKERLPSFTPEQSKLVKGSVDYIGINQYTATYMADQPT  319

Query  219  PKTPYIHTYQNDWNVGF---------------AYARNGVPIGPRANSEWLYMVPWGLYKA  353
            P+ P   +Y +DW+V +               A  RNGVPIG +ANS WLY+VP G+Y  
Sbjct  320  PQQPPT-SYSSDWHVQYIFTQDTSLLTLSFKRAVQRNGVPIGQKANSNWLYIVPTGMYGC  378

Query  354  VTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFG  533
            V Y++E+Y NP + +SENGMD   NLT  E L+D  R+ +YK+YLAELK+ +DDGAN+ G
Sbjct  379  VNYIREKYNNPTIIISENGMDQPANLTREEFLHDASRVEFYKTYLAELKKAIDDGANVVG  438

Query  534  YFAWSLLDNFEWRIGYTSRFGIVYV  608
            YFAWSLLDNFEW  GYTS+FGIVYV
Sbjct  439  YFAWSLLDNFEWLSGYTSKFGIVYV  463



>gb|EMS62098.1| Beta-glucosidase 8 [Triticum urartu]
Length=554

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 150/205 (73%), Gaps = 17/205 (8%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PY  218
            FH+GWFL P++ G+YPKTMQ+IV +RLP FTP++ KLVKGS+DY+GINQYT  Y+ D P 
Sbjct  268  FHVGWFLDPLLNGQYPKTMQDIVKERLPSFTPEQSKLVKGSVDYIGINQYTATYMADQPT  327

Query  219  PKTPYIHTYQNDWNVGF---------------AYARNGVPIGPRANSEWLYMVPWGLYKA  353
            P+ P   +Y +DW+V +               A  RNGVPIG +ANS WLY+VP G+Y  
Sbjct  328  PQQPPT-SYSSDWHVQYIFTQDTSLLTLSFTHAVQRNGVPIGQKANSNWLYIVPTGMYGC  386

Query  354  VTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFG  533
            V Y++E+Y NP + +SENGMD   NLT  E L+D  R+ +YK+YLAELK+ +DDGAN+ G
Sbjct  387  VNYIREKYNNPTIIISENGMDQPANLTREEFLHDASRVEFYKTYLAELKKAIDDGANVVG  446

Query  534  YFAWSLLDNFEWRIGYTSRFGIVYV  608
            YFAWSLLDNFEW  GYTS+FGIVYV
Sbjct  447  YFAWSLLDNFEWLSGYTSKFGIVYV  471



>ref|XP_004982054.1| PREDICTED: beta-glucosidase 8-like [Setaria italica]
Length=566

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYP  221
            FH+GWF+ P++ G+YPKTMQ+IV DRLP FTP++ KLVKGS D  GINQYTT+Y+ D   
Sbjct  303  FHVGWFMDPLINGQYPKTMQDIVKDRLPSFTPEQAKLVKGSSDCFGINQYTTYYISDEQT  362

Query  222  KTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLS  401
                  +Y +DW V + + RNG+PIG  ANS WLY+VP G+Y  V Y+KE+Y NP + +S
Sbjct  363  PQQATPSYSSDWGVQYNFERNGLPIGQLANSVWLYIVPTGMYGVVNYLKEKYQNPTIIIS  422

Query  402  ENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGY  581
            ENGMD  GNLT  E L+DT R+ +YK+YL ELK+ +D+GAN+  YFAWSLLDNFEW  GY
Sbjct  423  ENGMDQSGNLTRDEYLHDTVRVEFYKNYLTELKKGIDEGANVVAYFAWSLLDNFEWLSGY  482

Query  582  TSRFGIVYV  608
            TS+FGIVYV
Sbjct  483  TSKFGIVYV  491



>gb|ADP02193.1| Glyco_hydro_1 domain-containing protein [Triticum aestivum]
Length=587

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 150/205 (73%), Gaps = 17/205 (8%)
 Frame = +3

Query  42   FHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYD-PY  218
            FH+GWFL P++ G+YPKTMQ+IV +RLP FTP++ KLVKGS+DY+GINQYT  Y+ D P 
Sbjct  302  FHVGWFLDPLLNGQYPKTMQDIVKERLPSFTPEQSKLVKGSVDYIGINQYTATYMADQPT  361

Query  219  PKTPYIHTYQNDWNVGF---------------AYARNGVPIGPRANSEWLYMVPWGLYKA  353
            P+ P   +Y +DW+V +               A  RNGVPIG +ANS WLY+VP G+Y  
Sbjct  362  PQQPPT-SYSSDWHVQYIFTQDTSLLTLSFKRAVQRNGVPIGQKANSNWLYIVPTGMYGC  420

Query  354  VTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFG  533
            V Y++E+Y NP + +SENGMD   NLT  E L+D  R+ +Y++YLAELK+ +DDGAN+ G
Sbjct  421  VNYIREKYNNPTIIISENGMDQPANLTREEFLHDASRVEFYETYLAELKKAIDDGANVVG  480

Query  534  YFAWSLLDNFEWRIGYTSRFGIVYV  608
            YFAWSLLDNFEW  GYTS+FGIVYV
Sbjct  481  YFAWSLLDNFEWLSGYTSKFGIVYV  505



>gb|AFW69221.1| hypothetical protein ZEAMMB73_365784 [Zea mays]
Length=502

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D YAA RAR F +GWFLHPI YG YP+TMQ IV  RLP FT ++  +VKGS DYV I
Sbjct  279  SVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNFTFEQSAMVKGSADYVAI  338

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y  +    T     Y+NDWN   +Y R+GVPIG RA S+WLY+VPWGLYKA+ +
Sbjct  339  NHYTTYYASNFVNATE--TNYRNDWNAKISYERDGVPIGKRAYSDWLYVVPWGLYKALIW  396

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
             KE++ +P+M + ENG+D  GN TL  +L D  RI Y++ YL EL+  + DGAN+FGYFA
Sbjct  397  TKEKFNSPVMLIGENGIDQPGNETLPFALYDKFRIDYFEKYLYELQCAIRDGANVFGYFA  456

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+G+TS+FGIVYV
Sbjct  457  WSLLDNFEWRLGFTSKFGIVYV  478



>ref|XP_008644990.1| PREDICTED: beta-glucosidase 38-like [Zea mays]
Length=552

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 148/202 (73%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D YAA RAR F +GWFLHPI YG YP+TMQ IV  RLP FT ++  +VKGS DYV I
Sbjct  329  SVEDEYAAHRARMFTLGWFLHPITYGHYPETMQKIVMGRLPNFTFEQSAMVKGSADYVAI  388

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y  +    T     Y+NDWN   +Y R+GVPIG RA S+WLY+VPWGLYKA+ +
Sbjct  389  NHYTTYYASNFVNATE--TNYRNDWNAKISYERDGVPIGKRAYSDWLYVVPWGLYKALIW  446

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
             KE++ +P+M + ENG+D  GN TL  +L D  RI Y++ YL EL+  + DGAN+FGYFA
Sbjct  447  TKEKFNSPVMLIGENGIDQPGNETLPFALYDKFRIDYFEKYLYELQCAIRDGANVFGYFA  506

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+G+TS+FGIVYV
Sbjct  507  WSLLDNFEWRLGFTSKFGIVYV  528



>gb|KJB16934.1| hypothetical protein B456_002G255400 [Gossypium raimondii]
Length=282

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 142/188 (76%), Gaps = 10/188 (5%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKAD YAAQRA+DFH+GWF HP+VYG+YP+TMQ IV +RL +FT  EV+ VK S D + +
Sbjct  105  SKADYYAAQRAKDFHVGWFWHPLVYGKYPRTMQKIVRERLSKFTKSEVEKVKNSFDILCL  164

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++++YDP+     +  YQ DWNVGF Y RNGVPI  +A+S+WLY VPWG+YKAVTY
Sbjct  165  NHYTSYHIYDPHRPPSNVTDYQQDWNVGFVYERNGVPID-QAHSKWLYEVPWGMYKAVTY  223

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VKERYG          MD   NLT  +SL+D+ R+++YKSYL +LKR +DDGAN+ GYFA
Sbjct  224  VKERYGR---------MDDPDNLTFPKSLHDSNRVNFYKSYLKDLKRAMDDGANITGYFA  274

Query  543  WSLLDNFE  566
            WS+L NFE
Sbjct  275  WSILVNFE  282



>ref|XP_004963948.1| PREDICTED: beta-glucosidase 38-like [Setaria italica]
Length=499

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D +AA RAR F +GWFLHPI +G YP+TM+ IV  RLP FT ++  +VKGS DY+ I
Sbjct  277  SMDDEFAAHRARMFTLGWFLHPITFGHYPETMEKIVMGRLPNFTFEQSAMVKGSADYIAI  336

Query  183  NQYTTFYVYDPYPKTPYIHT-YQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            N YTT+Y  +   +T   HT Y NDW+V  +Y RNGVPIG +  S+WLY+VPWGLYKA+ 
Sbjct  337  NHYTTYYASNFANET---HTSYVNDWHVKLSYERNGVPIGKKGYSDWLYVVPWGLYKALL  393

Query  360  YVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            + KE++ NP+M + ENG+D  GN +L  +L D  RI Y++ YL EL+  + DGAN+ GYF
Sbjct  394  WTKEKFNNPVMLIGENGIDQSGNDSLPGALYDKFRIDYFEKYLYELQCAIHDGANVIGYF  453

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEWR+G+TS+FGIVYV
Sbjct  454  AWSLLDNFEWRLGFTSKFGIVYV  476



>gb|EMS63424.1| Beta-glucosidase 38 [Triticum urartu]
Length=490

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 146/202 (72%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            ++ D YAA RAR+F +GW++HPI +G YP+TMQ +VG RLP FT ++ KL++GS D +GI
Sbjct  266  TEEDEYAAHRAREFTLGWYMHPITFGHYPETMQKLVGTRLPNFTAEQSKLLQGSADIIGI  325

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+YV   + +     +   DW     + RNGVP+  +A S+WLY+VPWG YKAV +
Sbjct  326  NHYTTYYV--RHQENLTRMSSATDWQAELLFERNGVPLRRQAFSKWLYVVPWGFYKAVMH  383

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            VK ++ +PL+ + ENG+D  G+ TL  +L DT RI Y+  YL ELKR + DGA + GYFA
Sbjct  384  VKNKFRDPLILIGENGIDQSGSDTLPHALYDTFRIDYFDQYLHELKRAIADGARVTGYFA  443

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+G+TS+FG+VYV
Sbjct  444  WSLLDNFEWRMGFTSKFGLVYV  465



>gb|KDO62881.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=430

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SKADNYAAQRARDFH+GWF+HPIVYGEYPKTMQNIVG+RLP+FT +EVK+VKGSID+VGI
Sbjct  293  SKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKGSIDFVGI  352

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT +Y+YDP+ K P    YQ DWN GFAY +NGVPIGPRANS WLY VPWG+YKA+ Y
Sbjct  353  NQYTAYYMYDPHLKQPKQVGYQQDWNAGFAYEKNGVPIGPRANSYWLYNVPWGMYKALMY  412

Query  363  VKERYGNPLMFLSENG  410
            +K  YGNP + LSENG
Sbjct  413  IKGHYGNPTVILSENG  428



>gb|KJB16882.1| hypothetical protein B456_002G252800, partial [Gossypium raimondii]
Length=457

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 145/217 (67%), Gaps = 19/217 (9%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSI-----  167
            SKADNYAAQRARDFHIGWFLHP+VYG++ +TMQ IVG+RLP+FT  EV            
Sbjct  220  SKADNYAAQRARDFHIGWFLHPLVYGKHSRTMQKIVGERLPKFTKSEVFTFYYIYFYFLL  279

Query  168  -----DYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGP-----RANSE  317
                 D + +N YT +Y+YDP+ + P I+   +   +  +   N   +       R +SE
Sbjct  280  LLFTFDVLCLNHYTFYYIYDPH-RPPSINAIMS---ITLSTFLNPTSVNTNAQEMRTHSE  335

Query  318  WLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAEL  497
            WLY VPW +YK VTYVKE Y NP + L ENG+D  GNLT  ESL D+ R+  Y+SYL  L
Sbjct  336  WLYEVPWDMYKVVTYVKECYDNPNIVLFENGIDDPGNLTFPESLYDSNRVIIYRSYLKGL  395

Query  498  KRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYV  608
            KR +DDGAN  GYFAWS+LDNFEW +GYTSRFG+VYV
Sbjct  396  KRAMDDGANASGYFAWSVLDNFEWLLGYTSRFGLVYV  432



>gb|EMS48652.1| Beta-glucosidase 7 [Triticum urartu]
Length=498

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 138/202 (68%), Gaps = 15/202 (7%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRA DF +GWFL P++ G+YP+ MQ++V +RLPRFTPDE K+VKGS D++G+
Sbjct  288  STEDQAAAQRAMDFLVGWFLDPLINGQYPQIMQDLVKERLPRFTPDEAKVVKGSADWIGV  347

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYTT +V           +Y  D                +ANS+WLY+VP G+Y  V Y
Sbjct  348  NQYTTEFVKGQKLVQQRPTSYSADL---------------QANSKWLYVVPRGMYGCVHY  392

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
            + ++YGNP M ++ENGMD  GNLT  + L D  R+ YY+SYL ELK+ +D GAN+ GYFA
Sbjct  393  ISQKYGNPAMLITENGMDQPGNLTRDQYLRDATRVRYYRSYLRELKKAIDGGANVLGYFA  452

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEW  GYTS+FGIVYV
Sbjct  453  WSLLDNFEWMYGYTSKFGIVYV  474



>gb|ACN26454.1| unknown [Zea mays]
Length=243

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = +3

Query  96   MQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYIHTYQNDWNVGFAY  275
            MQ+IV DRLP FTP++ KLVKGS DY GINQYTT+Y+ D         +Y +DW V + +
Sbjct  1    MQDIVKDRLPSFTPEQAKLVKGSSDYFGINQYTTYYIADQQTPPQGPPSYSSDWGVQYYF  60

Query  276  ARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMDYVGNLTLAESLND  455
             RNGV IG  A+S WLY+VP G+Y  V Y+KE+Y NP++ +SENGMD  GNLT  E ++D
Sbjct  61   QRNGVQIGQMAHSIWLYIVPSGMYGVVNYLKEKYHNPIIIISENGMDQPGNLTREEYVHD  120

Query  456  TKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFGIVYV  608
              RI +YK+YL ELKR +D GAN+ GYFAWSLLDNFEW  GYTS+FGIVYV
Sbjct  121  AVRIDFYKNYLTELKRGIDGGANVIGYFAWSLLDNFEWLSGYTSKFGIVYV  171



>gb|EMT02092.1| Beta-glucosidase 44 [Aegilops tauschii]
Length=370

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = +3

Query  57   FLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQYTTFYVYDPYPKTPYI  236
            ++HPI +G YP+TM+ +VG RLP FT ++ KLV+GS D +G+N YTT+YV      T   
Sbjct  164  YMHPITFGHYPETMRKLVGSRLPNFTAEQSKLVQGSADIIGVNHYTTYYVRHHENLTHM-  222

Query  237  HTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGNPLMFLSENGMD  416
             +Y  DW     + RNGVPIG +A S+WLY+VPWG YKAV +VK ++ +PL+ + ENG+D
Sbjct  223  -SYATDWQAELLFERNGVPIGRQAFSKWLYVVPWGFYKAVMHVKNKFRDPLILIGENGID  281

Query  417  YVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNFEWRIGYTSRFG  596
              G+ TL  +L DT RI Y+  YL ELKR + DGA + GYFAWSLLDNFEWR+G+TS+FG
Sbjct  282  QSGSDTLPHALYDTFRIDYFDQYLHELKRAIADGARVTGYFAWSLLDNFEWRMGFTSKFG  341

Query  597  IVYV  608
            +VYV
Sbjct  342  LVYV  345



>gb|ACG44181.1| non-cyanogenic beta-glucosidase precursor [Zea mays]
Length=466

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQRARDFH+GWF  P++ G YP+ MQ+IV +RLP+FTP++ KLVKGS DY+GI
Sbjct  279  STEDQAAAQRARDFHVGWFADPLINGHYPQIMQDIVKERLPKFTPEQAKLVKGSADYIGI  338

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            NQYT  YV           +Y  DW V +   RNG PIGP+ANS+WLY+VP G+Y  V Y
Sbjct  339  NQYTASYVKGQKLLQQKPTSYSADWQVQYVLERNGKPIGPQANSKWLYIVPEGMYGCVNY  398

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  527
            +K +YGNP +F++ENGMD  GNLT  + L+DT R+ +YK YLAEL++ +DDGA++
Sbjct  399  LKHKYGNPTVFITENGMDQPGNLTRGQYLHDTTRVQFYKGYLAELRKAIDDGADV  453



>gb|AFK37966.1| unknown [Medicago truncatula]
Length=159

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  204  VYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKERYGN  383
            +YDP+ + P +  YQ+DWN GFAYA+NGVP+GPRA S WLY VPWGLYK++ Y+KE Y N
Sbjct  1    MYDPHNQKPKVPGYQSDWNAGFAYAKNGVPVGPRAYSYWLYNVPWGLYKSIMYIKEHYKN  60

Query  384  PLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAWSLLDNF  563
            P MFLSENGMD  GN+T ++ L+DT RI+YYK YL +L++ +DDGAN+FGY AWSLLDNF
Sbjct  61   PTMFLSENGMDDPGNVTFSKGLHDTARINYYKGYLTQLEKAIDDGANVFGYHAWSLLDNF  120

Query  564  EWRIGYTSRFGIVYV  608
            EWR+GYTSRFGIVYV
Sbjct  121  EWRLGYTSRFGIVYV  135



>ref|XP_001765414.1| predicted protein [Physcomitrella patens]
 gb|EDQ69675.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 142/207 (69%), Gaps = 5/207 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AA+R   F +GWFL PI YG+YP  M+  VGDRLP FTPDE+ L+KGS+D++G+
Sbjct  261  SPADKEAAERHVLFQLGWFLDPIYYGDYPAVMRKYVGDRLPLFTPDEITLLKGSLDFIGL  320

Query  183  NQYTT-FYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            N YT+ F      P      +Y  D  +  +  RNG  IG RA SEWLY+VPWG+ K + 
Sbjct  321  NHYTSRFVAAGTPPANALASSYWEDQAMVSSVTRNGELIGNRAASEWLYIVPWGIGKTLL  380

Query  360  YVKERYGNPLMFLSENGM---DYVGNLTLAES-LNDTKRISYYKSYLAELKRVVDDGANL  527
            ++ ERY  PL++++ENGM   D +GN  LA   LND+ RI+YY++YL+ +   + +GAN+
Sbjct  381  WLTERYQKPLLYITENGMDDSDDLGNTKLATDFLNDSNRIAYYENYLSSVLESIRNGANV  440

Query  528  FGYFAWSLLDNFEWRIGYTSRFGIVYV  608
             GYFAWSL+DNFEW +GYT RFG+V+V
Sbjct  441  RGYFAWSLMDNFEWAMGYTRRFGLVFV  467



>ref|XP_007133703.1| hypothetical protein PHAVU_011G201700g [Phaseolus vulgaris]
 gb|ESW05697.1| hypothetical protein PHAVU_011G201700g [Phaseolus vulgaris]
Length=530

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 142/204 (70%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +++D +AA+RA DF  GWF+ P+  GEYPK+MQ++VG RLP+F+ DE+KLV+GS D++GI
Sbjct  298  TESDQFAAERALDFMFGWFMEPLTIGEYPKSMQSLVGSRLPKFSADEIKLVRGSFDFIGI  357

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT++Y  D    +    +Y  D  V     RNG+PIG    S+WLY+ P G++  + Y
Sbjct  358  NYYTSYYASDTPELSEARPSYLTDSLVILTSERNGIPIGKMTTSKWLYVCPKGIHDLLLY  417

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            +K +Y NPL++++ENG+D   +  L+L E+L DT RI Y+  +L  L+  +++G N+ GY
Sbjct  418  IKTKYNNPLIYITENGIDEFNDHTLSLEEALADTSRIDYFYDHLYYLQSAIENGVNVKGY  477

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSL D+FEW +GY SRFG ++V
Sbjct  478  FAWSLTDSFEWNLGYISRFGTIFV  501



>gb|EAY94510.1| hypothetical protein OsI_16283 [Oryza sativa Indica Group]
Length=254

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 139/204 (68%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK +  AA+R  DF +GW + P++ G+YP  M+ +VG+RLP+FT ++ ++VKG+ D++G+
Sbjct  24   SKTNKDAARRVLDFVLGWLMDPLIRGDYPLNMRELVGNRLPKFTKEQSEMVKGAFDFIGL  83

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N Y++ Y  +  P     ++Y  D++     +RNG  IGP+A S WL++ P GL + + Y
Sbjct  84   NYYSSSYAENVLPSYGLKNSYNTDFHARITGSRNGTLIGPQAASSWLHIYPQGLRELLLY  143

Query  363  VKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            +KE YGNP +F++ENG+D V N T  L E+LND  RI YY  +L  L+  + DGAN+ GY
Sbjct  144  IKENYGNPTIFITENGVDEVNNKTMPLKEALNDNTRIEYYHKHLLALRNAMRDGANVKGY  203

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFG+ +V
Sbjct  204  FAWSLLDNFEWADGYTLRFGLNFV  227



>gb|EAZ31068.1| hypothetical protein OsJ_15164 [Oryza sativa Japonica Group]
Length=254

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 139/204 (68%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK +  AA+R  DF +GW + P++ G+YP  M+ +VG+RLP+FT ++ ++VKG+ D++G+
Sbjct  24   SKTNKDAARRVLDFVLGWLMDPLIRGDYPLNMRELVGNRLPKFTKEQSEMVKGAFDFIGL  83

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N Y++ Y  +  P     ++Y  D++     +RNG  IGP+A S WL++ P GL + + Y
Sbjct  84   NYYSSSYAENVLPSYGLKNSYNTDFHARITGSRNGTLIGPQAASSWLHIYPQGLRELLLY  143

Query  363  VKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            +KE YGNP +F++ENG+D V N T  L E+LND  RI YY  +L  L+  + DGAN+ GY
Sbjct  144  IKENYGNPTIFITENGVDEVNNKTMPLKEALNDNTRIEYYHKHLLALRNAMRDGANVKGY  203

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFG+ +V
Sbjct  204  FAWSLLDNFEWADGYTLRFGLNFV  227



>ref|XP_007014882.1| Beta-glucosidase 17 [Theobroma cacao]
 gb|EOY32501.1| Beta-glucosidase 17 [Theobroma cacao]
Length=517

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 136/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            + D  AAQRA DF  GWF+ PI  GEYPK+MQ++VGDRLPRF+ +E K++KGS D++G+N
Sbjct  285  RNDKDAAQRALDFMFGWFMDPITSGEYPKSMQSLVGDRLPRFSKEESKMLKGSFDFLGLN  344

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
             YT  Y  D     P   +Y  D +   +  R+GVPIGP   S+WLY+ P G Y+ + Y 
Sbjct  345  YYTANYAADAPKHGPGKPSYLTDASAKLSTERDGVPIGPTTASDWLYVYPKGFYELLLYT  404

Query  366  KERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            K +Y NP+++++ENG+D   N  L+L E+L D  RI YY  +L+ L+  +  G ++ GYF
Sbjct  405  KSKYNNPIIYITENGVDEASNATLSLEEALVDNMRIEYYDQHLSFLRNAIGVGVDVKGYF  464

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYT RFGI YV
Sbjct  465  AWSLLDNFEWANGYTVRFGINYV  487



>ref|XP_002438912.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
 gb|EER90279.1| hypothetical protein SORBIDRAFT_10g028060 [Sorghum bicolor]
Length=480

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 131/202 (65%), Gaps = 30/202 (15%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D +AA RAR F +GWFLHPI YG YP+TM+ IV  RLP FT ++  +VKGS DY+ I
Sbjct  285  SIEDEFAAHRARMFTLGWFLHPITYGHYPETMEKIVMGRLPNFTFEQSAMVKGSADYIAI  344

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT+Y                  N G+              S+WLY+VPWGLYKA+ +
Sbjct  345  NHYTTYYAS----------------NFGY--------------SDWLYVVPWGLYKALIW  374

Query  363  VKERYGNPLMFLSENGMDYVGNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFA  542
             KE++ NP+M + ENG+D  GN TL  +L D  RI Y++ YL EL+  + DGAN+FGYF 
Sbjct  375  TKEKFNNPVMLIGENGIDQSGNETLPHALYDKFRIDYFQKYLQELQYAIRDGANVFGYFV  434

Query  543  WSLLDNFEWRIGYTSRFGIVYV  608
            WSLLDNFEWR+GYTSRFGIV+V
Sbjct  435  WSLLDNFEWRLGYTSRFGIVHV  456



>ref|NP_001053070.1| Os04g0474800 [Oryza sativa Japonica Group]
 dbj|BAF14984.1| Os04g0474800, partial [Oryza sativa Japonica Group]
Length=395

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK+++ AA+RA DF  GWF+ P++ G+YP +M+ +VG+RLP+FT ++ KLVKG+ D++G+
Sbjct  169  SKSNDDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGL  228

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT  Y  +  P     ++Y  D        RNG+PIGP+A S WLY+ P G    + Y
Sbjct  229  NYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLY  288

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  289  VKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGY  348

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  349  FAWSLLDNFEWSNGYTVRFGINFV  372



>dbj|BAG94781.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK+++ AA+RA DF  GWF+ P++ G+YP +M+ +VG+RLP+FT ++ KLVKG+ D++G+
Sbjct  165  SKSNDDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGL  224

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT  Y  +  P     ++Y  D        RNG+PIGP+A S WLY+ P G    + Y
Sbjct  225  NYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLY  284

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  285  VKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGY  344

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  345  FAWSLLDNFEWSNGYTVRFGINFV  368



>ref|XP_002448027.1| hypothetical protein SORBIDRAFT_06g019840 [Sorghum bicolor]
 gb|EES12355.1| hypothetical protein SORBIDRAFT_06g019840 [Sorghum bicolor]
Length=512

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S++++ AA+RA DF  GWF+ P++ G YP +M+ +V +RLP+FT ++ KLVKG+ D++G+
Sbjct  286  SRSNDDAARRALDFMFGWFMDPLIRGHYPLSMRRLVRNRLPQFTSEQSKLVKGAFDFIGL  345

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YTT Y  +  P      +Y  D        RNGVPIGP+A S WLY+ P G    + Y
Sbjct  346  NYYTTNYAANLPPSNGLNLSYSTDSQANLTGVRNGVPIGPQAASSWLYIYPQGFRDLLLY  405

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D V N  L L E+L D+ RI YY  +L  L+  + DGAN+ GY
Sbjct  406  VKENYGNPTVYITENGVDEVNNKSLPLQEALKDSTRIEYYHKHLLALQSAISDGANVKGY  465

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  466  FAWSLLDNFEWVNGYTVRFGIYFV  489



>ref|XP_006850052.1| hypothetical protein AMTR_s00022p00199830, partial [Amborella 
trichopoda]
 gb|ERN11633.1| hypothetical protein AMTR_s00022p00199830, partial [Amborella 
trichopoda]
Length=333

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 133/204 (65%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            + ++N AAQRA DF  GW++ P+  G+YP +M+++V  RLP+FT +E KLVKGS D++G+
Sbjct  107  TNSNNAAAQRAIDFMFGWYMDPLTRGDYPISMKSLVRKRLPKFTKEESKLVKGSFDFIGL  166

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT  Y            TY  D        RNGV IGP+A S WLY+ P G+   + Y
Sbjct  167  NYYTARYAASVPSNNGLPPTYDTDSRANLTTERNGVSIGPQAASAWLYVYPPGIKDLLVY  226

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            +KERY NP+++++ENG+D   N  L+L E LND  RI YY  +LA ++  + +G N+ GY
Sbjct  227  IKERYNNPVIYITENGIDEFNNASLSLKEQLNDKMRIKYYSKHLAFVRSAIREGVNVKGY  286

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI YV
Sbjct  287  FAWSLLDNFEWVNGYTVRFGICYV  310



>ref|XP_006652406.1| PREDICTED: beta-glucosidase 13-like [Oryza brachyantha]
Length=504

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 135/204 (66%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK+   AA+RA DF +GWF+ P++ GEYP +M+ +VG RLP+FT ++  L+KG+ D++G+
Sbjct  278  SKSSIDAAKRALDFMLGWFMDPLIRGEYPLSMRELVGSRLPQFTREQSGLIKGAFDFIGL  337

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ Y     P     ++Y  D        RNGVPIGP+A S WL++ P G  + V Y
Sbjct  338  NYYTSNYAGSLPPSNGLNNSYNTDARANLTAVRNGVPIGPQAASPWLFIYPQGFRELVLY  397

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE+YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  398  VKEKYGNPTIYITENGVDEFNNKTLPLQEALKDDTRIEYYHKHLLSLLSAIRDGANVKGY  457

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI YV
Sbjct  458  FAWSLLDNFEWSNGYTVRFGINYV  481



>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
 pdb|3PTK|B Chain B, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
 pdb|3PTM|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 
With 2- Fluoroglucopyranoside
 pdb|3PTM|B Chain B, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 
With 2- Fluoroglucopyranoside
 pdb|3PTQ|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 
With Dinitrophenyl 2-Deoxy-2-Fluoro-Beta-D-Glucopyranoside
 pdb|3PTQ|B Chain B, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 
With Dinitrophenyl 2-Deoxy-2-Fluoro-Beta-D-Glucopyranoside
Length=505

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK++N AA+RA DF  GWF+ P++ G+YP +M+ +VG+RLP+FT ++ KLVKG+ D++G+
Sbjct  279  SKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGL  338

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT  Y  +  P     ++Y  D        RNG+PIGP+A S WLY+ P G    + Y
Sbjct  339  NYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLY  398

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  399  VKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGY  458

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  459  FAWSLLDNFEWSNGYTVRFGINFV  482



>emb|CAH66812.1| OSIGBa0135C13.7 [Oryza sativa Indica Group]
 gb|EEC77466.1| hypothetical protein OsI_16288 [Oryza sativa Indica Group]
Length=510

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK++N AA+RA DF  GWF+ P++ G+YP +M+ +VG+RLP+FT ++ KLVKG+ D++G+
Sbjct  284  SKSNNDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGL  343

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT  Y  +  P     ++Y  D        RNG+PIGP+A S WLY+ P G    + Y
Sbjct  344  NYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLY  403

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  404  VKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGY  463

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  464  FAWSLLDNFEWSNGYTVRFGINFV  487



>ref|XP_008441738.1| PREDICTED: beta-glucosidase 42 isoform X3 [Cucumis melo]
Length=502

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AA R  DFH GW++HPI +G+YP+ M+  +GD LP+FT +E +L+  S+D+VG+
Sbjct  261  SVEDRTAASRRLDFHFGWYMHPIYFGDYPEVMREELGDNLPKFTDEEKELIMNSVDFVGL  320

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ ++ D        + Y++          +G  IG RA SEWLY+VPWGL K + Y
Sbjct  321  NHYTSRFIADASESPDGGNFYKSQKMARLVQWEDGELIGERAASEWLYIVPWGLRKLLNY  380

Query  363  VKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            +K++Y NP++F++ENG+D   N T  L E L+D  R+ Y+K YLAEL + + DG ++ GY
Sbjct  381  IKQKYNNPIIFITENGVDDEENETCPLHEMLDDKMRVRYFKGYLAELSKAIRDGVDVRGY  440

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFG++YV
Sbjct  441  FAWSLLDNFEWAQGYTKRFGLIYV  464



>ref|XP_008441736.1| PREDICTED: beta-glucosidase 42 isoform X2 [Cucumis melo]
Length=504

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AA R  DFH GW++HPI +G+YP+ M+  +GD LP+FT +E +L+  S+D+VG+
Sbjct  261  SVEDRTAASRRLDFHFGWYMHPIYFGDYPEVMREELGDNLPKFTDEEKELIMNSVDFVGL  320

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ ++ D        + Y++          +G  IG RA SEWLY+VPWGL K + Y
Sbjct  321  NHYTSRFIADASESPDGGNFYKSQKMARLVQWEDGELIGERAASEWLYIVPWGLRKLLNY  380

Query  363  VKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            +K++Y NP++F++ENG+D   N T  L E L+D  R+ Y+K YLAEL + + DG ++ GY
Sbjct  381  IKQKYNNPIIFITENGVDDEENETCPLHEMLDDKMRVRYFKGYLAELSKAIRDGVDVRGY  440

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFG++YV
Sbjct  441  FAWSLLDNFEWAQGYTKRFGLIYV  464



>ref|XP_008441735.1| PREDICTED: beta-glucosidase 42 isoform X1 [Cucumis melo]
Length=521

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AA R  DFH GW++HPI +G+YP+ M+  +GD LP+FT +E +L+  S+D+VG+
Sbjct  261  SVEDRTAASRRLDFHFGWYMHPIYFGDYPEVMREELGDNLPKFTDEEKELIMNSVDFVGL  320

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ ++ D        + Y++          +G  IG RA SEWLY+VPWGL K + Y
Sbjct  321  NHYTSRFIADASESPDGGNFYKSQKMARLVQWEDGELIGERAASEWLYIVPWGLRKLLNY  380

Query  363  VKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            +K++Y NP++F++ENG+D   N T  L E L+D  R+ Y+K YLAEL + + DG ++ GY
Sbjct  381  IKQKYNNPIIFITENGVDDEENETCPLHEMLDDKMRVRYFKGYLAELSKAIRDGVDVRGY  440

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFG++YV
Sbjct  441  FAWSLLDNFEWAQGYTKRFGLIYV  464



>gb|ABI34907.3| glycoside hydrolase family 1 protein [Leucaena leucocephala]
Length=394

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 134/203 (66%), Gaps = 2/203 (1%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            K+D  AA RA DF  GWF+ P+  GEYPK+M+ +VG RLP+F+  E  LVKGS D++G+N
Sbjct  168  KSDQNAAARAVDFMFGWFMGPLTEGEYPKSMRALVGSRLPKFSKKESSLVKGSFDFLGLN  227

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
             YT  Y  +         +YQ D +      RNG PIGPRA S+WLY+ P G+   + YV
Sbjct  228  YYTANYAANAPSLRNARPSYQTDSHANLTTERNGTPIGPRAASDWLYVYPRGIRDLLLYV  287

Query  366  KERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            K +Y NPL++++ENG+D   +  LTL E+L DT RI YY  +L  L+  + DGAN+ GYF
Sbjct  288  KTKYNNPLIYITENGIDEFDDPTLTLEEALIDTFRIDYYFRHLYYLQSAIKDGANVKGYF  347

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYT RFGI +V
Sbjct  348  AWSLLDNFEWASGYTVRFGINFV  370



>ref|XP_006386092.1| hypothetical protein POPTR_0003s22030g [Populus trichocarpa]
 gb|ERP63889.1| hypothetical protein POPTR_0003s22030g [Populus trichocarpa]
Length=494

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 143/205 (70%), Gaps = 4/205 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +K D  AA+RA DF +GWF+ P+  G+YP TM+++VGDRLP+F+ ++ +++KGS D++G+
Sbjct  268  AKHDQNAAKRALDFMLGWFMDPLTNGDYPHTMRSLVGDRLPKFSREQSEMIKGSFDFLGL  327

Query  183  NQYTTFY-VYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            N YTT Y  Y P+  +P   +Y  D     +  R+GV IGP+A S+WLY+ P G+   + 
Sbjct  328  NYYTTNYAAYMPHSNSPNA-SYLTDSRANLSTERHGVLIGPKAASDWLYIYPRGIRDLLL  386

Query  360  YVKERYGNPLMFLSENGMDYV--GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFG  533
            YVK  Y NPL++++ENG+D    G+LTL E+L DT R+ YY  +L  L+R + DG N+ G
Sbjct  387  YVKREYRNPLIYITENGVDEFNNGSLTLKEALVDTMRVDYYHHHLDFLRRSIKDGVNVKG  446

Query  534  YFAWSLLDNFEWRIGYTSRFGIVYV  608
            YFAWSLLDNFEW  GYT RFGI YV
Sbjct  447  YFAWSLLDNFEWYAGYTVRFGINYV  471



>ref|XP_002512138.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF50172.1| beta-glucosidase, putative [Ricinus communis]
Length=508

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 138/205 (67%), Gaps = 3/205 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +K D+ A++RA DF  GW++HP+VYG+YPK+M N+VG+RLPRFT D+  +VKGS D++G+
Sbjct  281  TKPDHQASKRALDFMYGWYMHPLVYGDYPKSMINLVGNRLPRFTTDQSMMVKGSFDFIGL  340

Query  183  NQYTTFYVYD-PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            N Y++FY Y  P        +Y  D        R+G+PIGP   S W+++ P GL   + 
Sbjct  341  NYYSSFYAYSVPATSNSVNISYSTDSLTNLTTERDGIPIGPTDGSIWIHVYPRGLRDVLM  400

Query  360  YVKERYGNPLMFLSENGMDYV--GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFG  533
            Y K++Y NP ++++ENG+D +  G  TL E +ND  RI YYK +LA L+R + +G ++ G
Sbjct  401  YTKKKYNNPTIYITENGIDQLDNGTSTLTELVNDLNRIDYYKRHLASLERAIKEGVDVKG  460

Query  534  YFAWSLLDNFEWRIGYTSRFGIVYV  608
            YFAWSLLDNFEW   YT R+GI  V
Sbjct  461  YFAWSLLDNFEWAAAYTMRYGINVV  485



>gb|EAY94514.1| hypothetical protein OsI_16286 [Oryza sativa Indica Group]
Length=374

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 140/204 (69%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK+ + AA+RA DF +GWF+ P++ G+YP +M+ +VG+RLP F+ ++  +VKG+ D++G+
Sbjct  129  SKSSSDAARRALDFMLGWFMDPLIRGDYPLSMRELVGNRLPEFSKEQSGMVKGAFDFIGL  188

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ Y  +  P   + ++Y  D +     +RNG+PIGP+A S W ++ P G+ + + Y
Sbjct  189  NYYTSSYADNDPPSHGHNNSYNTDSHAKITGSRNGIPIGPQAASFWFHIYPEGICEMLLY  248

Query  363  VKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D V N T  L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  249  VKENYGNPTIYITENGVDEVNNKTMPLEEALKDDTRIEYYHKHLLALLSAMRDGANVKGY  308

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  309  FAWSLLDNFEWAEGYTVRFGINFV  332



>ref|XP_011025248.1| PREDICTED: beta-glucosidase 12-like [Populus euphratica]
Length=511

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 143/205 (70%), Gaps = 4/205 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +K D  AA+RA DF +GWF+ P+  G+YP TM+++ GDRLPRF+ ++ +++KGS D++G+
Sbjct  285  AKQDQNAAKRALDFMLGWFMDPLTNGDYPHTMRSLAGDRLPRFSREQSEMIKGSFDFLGL  344

Query  183  NQYTTFY-VYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVT  359
            N YTT Y  Y P+  +P   +Y  D     +  R+GV IGP+A S+WLY+ P G+   + 
Sbjct  345  NYYTTNYAAYTPHSNSPNA-SYLTDSRANLSTERHGVLIGPKAASDWLYIYPRGIRDLLL  403

Query  360  YVKERYGNPLMFLSENGMDYV--GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFG  533
            YVK+ Y NPL++++ENG+D    G+LTL E+L DT R+ YY  +L  L+R + DG N+ G
Sbjct  404  YVKKEYRNPLIYITENGVDEFNNGSLTLKEALVDTMRVDYYYHHLDFLRRSIKDGVNVKG  463

Query  534  YFAWSLLDNFEWRIGYTSRFGIVYV  608
            YFAWSLLDNFEW  GYT RFGI YV
Sbjct  464  YFAWSLLDNFEWYAGYTVRFGINYV  488



>emb|CAH67305.1| OSIGBa0106G07.1 [Oryza sativa Indica Group]
Length=506

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK++  AA+RA DF +GWF+ P++ GEYP +M+ +V +RLP+FT ++ +L+KGS D++G+
Sbjct  280  SKSNIDAARRALDFMLGWFMDPLIRGEYPLSMRELVRNRLPQFTKEQSELIKGSFDFIGL  339

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ Y     P     ++Y  D        RNG+PIGP+A S WLY+ P G  + V Y
Sbjct  340  NYYTSNYAGSLPPSNGLNNSYSTDARANLTAVRNGIPIGPQAASPWLYIYPQGFRELVLY  399

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  400  VKENYGNPTIYITENGVDEFNNKTLPLQEALKDDTRIDYYHKHLLSLLSAIRDGANVKGY  459

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  460  FAWSLLDNFEWSNGYTVRFGINFV  483



>ref|NP_001053071.1| Os04g0474900 [Oryza sativa Japonica Group]
 sp|Q7XKV2.2|BGL13_ORYSJ RecName: Full=Beta-glucosidase 13; Short=Os4bglu13; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE05485.2| OSJNBa0022H21.5 [Oryza sativa Japonica Group]
 dbj|BAF14985.1| Os04g0474900 [Oryza sativa Japonica Group]
 gb|EEE61180.1| hypothetical protein OsJ_15167 [Oryza sativa Japonica Group]
Length=506

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK++  AA+RA DF +GWF+ P++ GEYP +M+ +V +RLP+FT ++ +L+KGS D++G+
Sbjct  280  SKSNIDAARRALDFMLGWFMDPLIRGEYPLSMRELVRNRLPQFTKEQSELIKGSFDFIGL  339

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ Y     P     ++Y  D        RNG+PIGP+A S WLY+ P G  + V Y
Sbjct  340  NYYTSNYAGSLPPSNGLNNSYSTDARANLTAVRNGIPIGPQAASPWLYIYPQGFRELVLY  399

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  400  VKENYGNPTIYITENGVDEFNNKTLPLQEALKDDTRIDYYHKHLLSLLSAIRDGANVKGY  459

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  460  FAWSLLDNFEWSNGYTVRFGINFV  483



>ref|XP_002987383.1| hypothetical protein SELMODRAFT_235275 [Selaginella moellendorffii]
 gb|EFJ11470.1| hypothetical protein SELMODRAFT_235275 [Selaginella moellendorffii]
Length=465

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 135/201 (67%), Gaps = 3/201 (1%)
 Frame = +3

Query  12   DNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQY  191
            D  A+QR  +F +GWFL P  +G+YP TM+  VGDRLP+FTP+E K V+GS+++VGIN Y
Sbjct  238  DKVASQRRLEFQLGWFLDPFFFGDYPATMREYVGDRLPKFTPEEQKSVRGSVEFVGINHY  297

Query  192  TTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKE  371
            ++ +V       P    Y  D  +  +  RNG  IG +A S WLY+VPWGL++ + +V E
Sbjct  298  SSRFVTPALYAKPS-DNYHQDQRILTSAVRNGAVIGDKAASPWLYIVPWGLHRVLKWVSE  356

Query  372  RYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            RY  P ++++ENGMD   N  LTL E L+D KRI +Y+ YL  + +   +G ++ GYFAW
Sbjct  357  RYNRPPIYVTENGMDEENNSTLTLDEQLDDLKRIHFYQDYLTAVLQATREGMDIRGYFAW  416

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SL+DNFEW +GYT RFG+ YV
Sbjct  417  SLVDNFEWAMGYTKRFGLYYV  437



>ref|XP_010680724.1| PREDICTED: beta-glucosidase 40 [Beta vulgaris subsp. vulgaris]
Length=513

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 142/207 (69%), Gaps = 10/207 (5%)
 Frame = +3

Query  12   DNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQY  191
            D  AAQRA+DF +GWFL P+++G+YP +M+  VGDRLP+F+  E  L+KGS+D+VGIN Y
Sbjct  284  DIEAAQRAQDFQLGWFLDPLMFGDYPSSMRERVGDRLPKFSAAESSLLKGSLDFVGINHY  343

Query  192  TTFYVYDPYPKTPYIHTYQNDW-----NVGFAYARNGVPIGPRANSEWLYMVPWGLYKAV  356
            TT+Y  +   KT  I    ND       +   +  +G PIG RAN+ WLY+VP G+ + +
Sbjct  344  TTYYARN--NKTNIIGFLLNDALADSGTITLPFGHDGKPIGERANAIWLYIVPRGMRELM  401

Query  357  TYVKERYGNPLMFLSENGMDYVGNL--TLAESLNDTKRISYYKSYLAELKRVV-DDGANL  527
             Y+K +YGNP++F++ENGMD   ++  +L ++L D KRI Y+  YL  L   + +DG N+
Sbjct  402  NYIKHKYGNPIVFITENGMDDGNSIFKSLEDALKDEKRIRYFNGYLENLAAAIKEDGCNV  461

Query  528  FGYFAWSLLDNFEWRIGYTSRFGIVYV  608
             GYFAWSLLDN+EW  GYTSRFG+ YV
Sbjct  462  KGYFAWSLLDNWEWAAGYTSRFGLYYV  488



>sp|Q7XKV4.2|BGL12_ORYSJ RecName: Full=Beta-glucosidase 12; Short=Os4bglu12; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE05483.2| OSJNBa0022H21.3 [Oryza sativa Japonica Group]
 gb|EEE61179.1| hypothetical protein OsJ_15166 [Oryza sativa Japonica Group]
Length=510

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 136/204 (67%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK+++ AA+RA DF  GWF+ P++ G+YP +M+ +VG+RLP+FT ++ KLVKG+ D++G+
Sbjct  284  SKSNDDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGL  343

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT  Y  +  P     ++Y  D        RNG+PIGP+A S WLY+ P G    + Y
Sbjct  344  NYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLY  403

Query  363  VKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D   N  L L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  404  VKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGY  463

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  464  FAWSLLDNFEWSNGYTVRFGINFV  487



>ref|XP_006858818.1| hypothetical protein AMTR_s00066p00171930 [Amborella trichopoda]
 gb|ERN20285.1| hypothetical protein AMTR_s00066p00171930 [Amborella trichopoda]
Length=527

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S  D  AAQR  +F +GWFL PI +G+YP  M+  +GDRLP+FT DEV L++GS+D+VG+
Sbjct  284  SLEDKEAAQRRVEFQLGWFLDPIYFGDYPAIMREKLGDRLPKFTNDEVALLRGSVDFVGL  343

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ ++  P  +    + + ++  +      +G  IG RA SEWLY+VPWG+ K ++Y
Sbjct  344  NHYTSRFI-KPCSRGFQWNGFYDEQELERIAEWDGKAIGERAASEWLYIVPWGIRKVISY  402

Query  363  VKERYGNPLMFLSENGMDYVG--NLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            + E+Y  P ++++ENGMD     +L+L ++LNDTKR++Y+K YL  +   + DGA++ GY
Sbjct  403  MTEKYDRPPIYVTENGMDEEDGESLSLQDALNDTKRVNYFKGYLTSVANSIKDGADVRGY  462

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GY+ RFG+VYV
Sbjct  463  FAWSLLDNFEWAQGYSKRFGLVYV  486



>ref|XP_002986009.1| hypothetical protein SELMODRAFT_271823 [Selaginella moellendorffii]
 gb|EFJ12828.1| hypothetical protein SELMODRAFT_271823 [Selaginella moellendorffii]
Length=505

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            S AD  AAQR  DF +GWFL PIV G+YP++M+   G RLP FTP++   +KGS+D++G+
Sbjct  275  SAADKEAAQRGLDFDLGWFLEPIVSGDYPRSMRTSAGTRLPVFTPEQAAAIKGSMDFLGL  334

Query  183  NQYTTFYVY--DPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAV  356
            N YT+ Y       P+    + +Q D  V  ++  NGV IGP+A S+WLY+VPWG  K V
Sbjct  335  NHYTSNYAKAGQVVPRNQVTYYFQ-DSRVASSFENNGVAIGPKAASDWLYIVPWGFQKLV  393

Query  357  TYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLF  530
            TYV +RY NP++ ++ENG+D   +   +L +SL DT R+ YY  Y++ L + +   A++ 
Sbjct  394  TYVAQRYNNPVIIITENGVDEFNDPSRSLKQSLRDTTRVKYYSDYISNLLQAIRSKADVR  453

Query  531  GYFAWSLLDNFEWRIGYTSRFGIVYV  608
            GYFAWSLLDNFEW  GY+ RFG+ +V
Sbjct  454  GYFAWSLLDNFEWNDGYSVRFGLHFV  479



>ref|XP_010673562.1| PREDICTED: beta-glucosidase 24-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 134/203 (66%), Gaps = 2/203 (1%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            + D+ AA RA DF  GWF+ PI YG+YP+TM+++VG RLP+F+ ++  ++KGS D++G+N
Sbjct  184  RQDSLAAVRALDFMFGWFIDPITYGDYPRTMRSLVGSRLPKFSKEQSSMLKGSYDFLGLN  243

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
             YTT Y  D          Y  D  V   + RNG+PIGP+A SEWLY+ P G+Y  + Y 
Sbjct  244  YYTTSYAADAPSLRDQKGNYSTDSLVNMTWERNGIPIGPKAASEWLYVYPRGIYDLLIYT  303

Query  366  KERYGNPLMFLSENGMDYV--GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            K RY NP+++++ENG D V   +L+L E+L D  R+ YY S+LA L   +     L GYF
Sbjct  304  KRRYRNPIIYITENGCDEVNDASLSLEEALADGMRVHYYHSHLAFLNLAMRSRVRLRGYF  363

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GY+ RFGI YV
Sbjct  364  AWSLLDNFEWLAGYSVRFGINYV  386



>gb|EEE62263.1| hypothetical protein OsJ_17050 [Oryza sativa Japonica Group]
Length=442

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 140/204 (69%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            SK+ + AA+RA DF +GWF+ P++ G+YP +M+ +VG+RLP F+ ++  +VKG+ D++G+
Sbjct  197  SKSSSDAARRALDFMLGWFMDPLIRGDYPLSMRELVGNRLPEFSKEQSGMVKGAFDFIGL  256

Query  183  NQYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTY  362
            N YT+ Y  +  P   + ++Y  D +     +RNG+PIGP+A S W ++ P G+ + + Y
Sbjct  257  NYYTSSYADNDPPSHGHNNSYNTDAHAKITGSRNGIPIGPQAASFWFHIYPEGICEMLLY  316

Query  363  VKERYGNPLMFLSENGMDYVGNLT--LAESLNDTKRISYYKSYLAELKRVVDDGANLFGY  536
            VKE YGNP ++++ENG+D V N T  L E+L D  RI YY  +L  L   + DGAN+ GY
Sbjct  317  VKENYGNPTIYITENGVDEVNNKTMPLEEALKDDTRIEYYHKHLLALLSAMRDGANVKGY  376

Query  537  FAWSLLDNFEWRIGYTSRFGIVYV  608
            FAWSLLDNFEW  GYT RFGI +V
Sbjct  377  FAWSLLDNFEWAEGYTVRFGINFV  400



>ref|XP_010265850.1| PREDICTED: beta-glucosidase 12-like [Nelumbo nucifera]
Length=521

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 136/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            KA+  AA RA DF  GWF+HPI YG+YP+TM+++ G RLP+F+ ++ K++KGS D++G+N
Sbjct  296  KANKEAAGRALDFMFGWFMHPITYGDYPETMKSLAGHRLPKFSKEQSKMIKGSYDFLGLN  355

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
             YT  Y  +         TY  D        RNG+PIGPRA S WLY+ P G+ + + Y 
Sbjct  356  YYTANYAANLLRINKVNVTYMTDSRATLTTDRNGIPIGPRAGSNWLYIYPQGIQELLLYT  415

Query  366  KERYGNPLMFLSENGMDYVGNL--TLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            K +Y NP+++++ENG+  V N   TL E+L DT RI YY  +L+ L++ + +G ++ GYF
Sbjct  416  KRKYNNPVIYITENGISEVNNSTWTLEEALTDTMRIYYYSHHLSYLQKAIKEGVDVKGYF  475

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYT RFGI YV
Sbjct  476  AWSLLDNFEWADGYTVRFGINYV  498



>ref|XP_008243590.1| PREDICTED: beta-glucosidase 12-like [Prunus mume]
Length=535

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            +K D  AA RA DF +GWF+ P+  GEYPK MQ++ G+RLP+FT  + K VKGS D++G+
Sbjct  289  TKQDKDAASRAVDFMLGWFMDPLAKGEYPKIMQSLAGNRLPKFTKMQSKSVKGSFDFIGL  348

Query  183  NQYTTFYVYD--PYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAV  356
            N YTT+Y  D  P P      +Y  D    F   RNG  IGP+A S WLY+ P GL + +
Sbjct  349  NYYTTYYAADAPPLPNATTYPSYLTDARTQFLTERNGTSIGPKAGSSWLYVYPKGLQELL  408

Query  357  TYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLF  530
             +VKE Y NPL++++ENG+    N  L+  E+L D  RI YY S+L  L   + DG N+ 
Sbjct  409  LHVKENYHNPLIYITENGVSEFANPKLSREEALVDYHRIDYYDSHLYYLHAAIKDGVNVK  468

Query  531  GYFAWSLLDNFEWRIGYTSRFGIVYV  608
            GYFAWSLLDNFEW  GYT RFGI YV
Sbjct  469  GYFAWSLLDNFEWNDGYTVRFGIYYV  494



>ref|XP_004505367.1| PREDICTED: beta-glucosidase 40-like [Cicer arietinum]
Length=499

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 141/206 (68%), Gaps = 5/206 (2%)
 Frame = +3

Query  3    SKADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGI  182
            ++ D  AAQRA+DF +GWFL P+++G+YP +M++ VG+RLP+F+P E  LVKGS+D+VGI
Sbjct  270  TQKDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSPSEAALVKGSLDFVGI  329

Query  183  NQYTTFYVYDPYPK-TPYIHTYQNDWNVGFAYARNGV-PIGPRANSEWLYMVPWGLYKAV  356
            N YTTFY  D        +H+   D     A   NG  PIG +ANS WLY+VP  +   +
Sbjct  330  NHYTTFYARDNSTNLLGALHSAIADSGT-IALPFNGTKPIGEKANSIWLYIVPQSMRTLM  388

Query  357  TYVKERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLF  530
             Y+K++YGNP +F++ENGMD   +  + + ++L D KRI YY  YL+ L   + DG N+ 
Sbjct  389  NYIKQKYGNPPVFITENGMDDPNSIYIPIKDALKDEKRIRYYNGYLSYLLASIKDGCNVK  448

Query  531  GYFAWSLLDNFEWRIGYTSRFGIVYV  608
            GYFAWSLLDN+EW  GYTSRFG+ Y+
Sbjct  449  GYFAWSLLDNWEWSSGYTSRFGLFYI  474



>gb|KDP25142.1| hypothetical protein JCGZ_22677 [Jatropha curcas]
Length=513

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 141/207 (68%), Gaps = 6/207 (3%)
 Frame = +3

Query  3    SKADNY--AAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYV  176
            SKA N   AA+RA DF  GWF+ PI YG+YP T++++VG+RLP+FT  + +++KGSID++
Sbjct  285  SKAKNQQNAAKRALDFMFGWFMEPITYGDYPHTLRSLVGNRLPKFTEKQSEMLKGSIDFL  344

Query  177  GINQYTTFY-VYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKA  353
            G+N YT  Y  Y P+       +Y  D     +  R G+PIGPRA S+WLY+ P G+   
Sbjct  345  GLNYYTANYAAYVPFSNAINA-SYLTDVRAKLSSERRGIPIGPRAASDWLYVYPRGIRDL  403

Query  354  VTYVKERYGNPLMFLSENGMDYV--GNLTLAESLNDTKRISYYKSYLAELKRVVDDGANL  527
            + Y KE+Y NPL++++ENG+D    G LTL E L D  RI YY  +L+ L++ ++DG N+
Sbjct  404  LLYTKEKYRNPLIYITENGIDEFNNGTLTLEEQLVDHMRIDYYYRHLSFLRKAIEDGVNV  463

Query  528  FGYFAWSLLDNFEWRIGYTSRFGIVYV  608
             GYFAWSLLDNFEW  GYT RFGI YV
Sbjct  464  KGYFAWSLLDNFEWSSGYTVRFGINYV  490



>ref|XP_002979904.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii]
 gb|EFJ18774.1| hypothetical protein SELMODRAFT_268319 [Selaginella moellendorffii]
Length=497

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 135/201 (67%), Gaps = 3/201 (1%)
 Frame = +3

Query  12   DNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGINQY  191
            D  A+QR  +F +GWFL P  +G+YP TM+  VGDRLP+FTP+E K V+GS+++VGIN Y
Sbjct  270  DKVASQRRLEFQLGWFLDPFFFGDYPATMREYVGDRLPKFTPEEQKSVRGSVEFVGINHY  329

Query  192  TTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYVKE  371
            ++ +V       P    Y  D  +  +  RNG  IG +A S WLY+VPWGL++ + +V E
Sbjct  330  SSRFVTPALYAKPS-DNYHQDQRILTSAVRNGAVIGDKAASPWLYIVPWGLHRVLKWVSE  388

Query  372  RYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYFAW  545
            RY  P ++++ENGMD   N  LTL E L+D KRI +Y+ YL  + +   +G ++ GYFAW
Sbjct  389  RYNRPPIYVTENGMDEENNSTLTLDEQLDDLKRIHFYQDYLTAVLQATREGMDIRGYFAW  448

Query  546  SLLDNFEWRIGYTSRFGIVYV  608
            SL+DNFEW +GYT RFG+ YV
Sbjct  449  SLVDNFEWAMGYTKRFGLYYV  469



>gb|ABY48758.1| glycosylhydrolase 1 [Leucaena leucocephala]
Length=507

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 134/203 (66%), Gaps = 2/203 (1%)
 Frame = +3

Query  6    KADNYAAQRARDFHIGWFLHPIVYGEYPKTMQNIVGDRLPRFTPDEVKLVKGSIDYVGIN  185
            K+D  AA RA DF  GWF+ P+  GEYPK+M+ +VG RLP+F+  E  LVKGS D++G+N
Sbjct  281  KSDQNAAARAVDFMFGWFMGPLTEGEYPKSMRALVGSRLPKFSKKESSLVKGSFDFLGLN  340

Query  186  QYTTFYVYDPYPKTPYIHTYQNDWNVGFAYARNGVPIGPRANSEWLYMVPWGLYKAVTYV  365
             YT  Y  +         +YQ D +      RNG PIGPRA S+WLY+ P G+   + YV
Sbjct  341  YYTANYAANAPSLRNARPSYQTDSHANLTTERNGTPIGPRAASDWLYVYPRGIRDLLLYV  400

Query  366  KERYGNPLMFLSENGMDYVGN--LTLAESLNDTKRISYYKSYLAELKRVVDDGANLFGYF  539
            K +Y NPL++++ENG+D   +  LTL E+L DT RI YY  +L  L+  + DGAN+ GYF
Sbjct  401  KTKYNNPLIYITENGIDEFDDPTLTLEEALIDTFRIDYYFRHLYYLQSAIKDGANVKGYF  460

Query  540  AWSLLDNFEWRIGYTSRFGIVYV  608
            AWSLLDNFEW  GYT RFGI +V
Sbjct  461  AWSLLDNFEWASGYTVRFGINFV  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230