BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016C01 649 bp,

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KFL94796.1|  putative YSIRK type signal peptide                    92.8    7e-18   Lactobacillus gasseri SJ-9E-US
gb|ABJ60955.1|  hypothetical protein LGAS_1663                        92.8    7e-18   Lactobacillus gasseri ATCC 33323 = JCM 1131
gb|KFL96555.1|  putative LPXTG-motif cell wall anchor domain protein  92.0    1e-17   Lactobacillus gasseri SV-16A-US
gb|EFB61571.1|  LPXTG-motif cell wall anchor domain protein           91.3    2e-17   Lactobacillus gasseri 224-1
ref|WP_041807453.1|  cell wall anchor protein                         85.5    2e-15   Lactobacillus gasseri
ref|WP_035426675.1|  cell wall anchor protein                         85.5    2e-15   Lactobacillus gasseri
ref|WP_003646770.1|  cell wall anchor protein                         85.5    2e-15   
ref|WP_035425140.1|  cell wall anchor protein                         85.5    2e-15   Lactobacillus gasseri
ref|WP_042749347.1|  cell wall anchor protein                         84.3    5e-15   
ref|WP_035423195.1|  cell wall anchor protein                         80.5    5e-14   
ref|WP_002460604.1|  hypothetical protein                             81.3    5e-14   Staphylococcus lugdunensis
ref|WP_037540934.1|  hypothetical protein                             80.1    1e-13   Staphylococcus lugdunensis
ref|WP_002492503.1|  hypothetical protein                             79.7    2e-13   Staphylococcus lugdunensis
ref|WP_037555315.1|  hypothetical protein                             79.3    2e-13   Staphylococcus lugdunensis
ref|WP_021314972.1|  hypothetical protein                             76.6    3e-13   
ref|WP_037545809.1|  hypothetical protein                             79.0    3e-13   Staphylococcus lugdunensis
ref|WP_042802751.1|  hypothetical protein                             78.6    4e-13   Mannheimia haemolytica
ref|WP_001083120.1|  alpha-L-fucosidase                               72.4    3e-11   Streptococcus oralis
dbj|BAA77828.1|  trappin                                              67.8    7e-11   Hippopotamus amphibius
ref|WP_001083124.1|  alpha-L-fucosidase                               71.2    8e-11   Streptococcus sp. GMD5S
gb|EFJ68906.1|  LPXTG-motif cell wall anchor domain protein           70.9    1e-10   Lactobacillus gasseri JV-V03
ref|WP_001083116.1|  alpha-L-fucosidase                               70.9    1e-10   Streptococcus sp. GMD3S
ref|WP_001083117.1|  alpha-L-fucosidase                               70.5    2e-10   Streptococcus oralis
ref|WP_032847157.1|  hypothetical protein                             70.1    2e-10   Mannheimia granulomatis
gb|AAQ92320.1|  elafin                                                67.4    2e-10   Ovis aries [domestic sheep]
emb|CCB52766.1|  putative LPXTG cell wall-anchored protein (pseud...  69.7    3e-10   Staphylococcus lugdunensis N920143
ref|WP_015431801.1|  hypothetical protein                             69.7    3e-10   Bibersteinia trehalosi
ref|WP_042902012.1|  alpha-L-fucosidase                               68.6    6e-10   Streptococcus oralis
ref|WP_001083121.1|  alpha-L-fucosidase                               68.2    8e-10   Streptococcus oralis
ref|XP_007932588.1|  hypothetical protein MYCFIDRAFT_45664            64.3    9e-10   Cercospora fijiensis CIRAD86
ref|WP_001083118.1|  alpha-L-fucosidase                               67.8    1e-09   Streptococcus oralis
ref|WP_001083119.1|  alpha-L-fucosidase                               67.8    1e-09   Streptococcus oralis
ref|WP_001083127.1|  alpha-L-fucosidase                               67.8    1e-09   Streptococcus oralis
ref|WP_001083125.1|  alpha-L-fucosidase                               66.6    2e-09   Streptococcus oralis
ref|WP_001083110.1|  MULTISPECIES: alpha-L-fucosidase                 66.6    2e-09   Streptococcus
ref|WP_042768039.1|  alpha-L-fucosidase                               65.9    4e-09   
ref|WP_003144797.1|  gram-positive signal peptide, ysirk family       65.1    8e-09   Gemella haemolysans
ref|WP_040443091.1|  hypothetical protein                             61.2    1e-08   
ref|WP_035430318.1|  cell wall anchor protein                         62.0    1e-08   
ref|WP_001083112.1|  hypothetical protein                             63.9    2e-08   Streptococcus oralis
ref|WP_025267364.1|  hypothetical protein                             63.9    2e-08   Bibersteinia trehalosi
ref|WP_001083113.1|  alpha-L-fucosidase                               63.5    2e-08   Streptococcus mitis
ref|WP_038804553.1|  alpha-L-fucosidase                               63.2    3e-08   Streptococcus oralis
ref|XP_003647604.1|  hypothetical protein Ecym_6415                   62.0    7e-08   Eremothecium cymbalariae DBVPG#7215
gb|KFY75885.1|  hypothetical protein V498_09857                       60.8    1e-07   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|WP_036967957.1|  ribonuclease                                     60.8    1e-07   Pseudoalteromonas lipolytica
gb|KFY54418.1|  hypothetical protein V496_07262                       60.8    2e-07   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|AHA42334.1|  neurofilament triplet H1 protein                      57.8    2e-07   Andrias davidianus ranavirus
ref|XP_808638.1|  hypothetical protein                                59.3    3e-07   Trypanosoma cruzi strain CL Brener
ref|WP_013355917.1|  cell surface protein precursor                   59.7    3e-07   Lactobacillus plantarum
ref|WP_042907803.1|  hypothetical protein                             58.2    3e-07   
gb|EGV03550.1|  alpha-L-fucosidase                                    59.7    4e-07   Streptococcus infantis SK970
ref|WP_013746171.1|  phospholipase/lecithinase/hemolysin              59.3    4e-07   Gallibacterium anatis
gb|AGV20596.1|  neurofilament triplet H1-like protein                 56.6    5e-07   Andrias davidianus ranavirus
ref|WP_039090727.1|  hypothetical protein                             58.9    5e-07   Gallibacterium anatis
gb|KGQ47133.1|  hypothetical protein IO46_13420                       58.5    8e-07   Gallibacterium anatis
ref|WP_042907582.1|  hypothetical protein                             58.5    8e-07   
ref|WP_018379564.1|  hypothetical protein                             58.5    8e-07   Streptococcus thoraltensis
gb|EAR66038.1|  cell wall-anchored protein                            56.6    8e-07   Bacillus sp. NRRL B-14911
ref|XP_011196264.1|  PREDICTED: probable serine/threonine-protein...  57.4    1e-06   Bactrocera cucurbitae [melon fruit fly]
ref|WP_039155889.1|  hypothetical protein                             58.2    1e-06   
ref|WP_010389626.1|  ribonuclease                                     58.2    1e-06   Pseudoalteromonas undina
ref|WP_028835972.1|  ribonuclease                                     58.2    1e-06   Pseudoalteromonas sp. 23_GOM-1509m
gb|AFR22934.1|  cell surface protein precursor                        57.8    1e-06   Lactobacillus helveticus R0052
ref|WP_039083408.1|  hypothetical protein                             57.8    1e-06   Gallibacterium anatis
gb|KFY94434.1|  hypothetical protein V500_03260                       57.8    1e-06   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|WP_039163635.1|  hypothetical protein                             57.8    2e-06   Gallibacterium anatis
ref|WP_039081894.1|  hypothetical protein                             57.8    2e-06   Gallibacterium anatis
ref|WP_039153091.1|  hypothetical protein                             57.8    2e-06   Gallibacterium anatis
ref|WP_039156382.1|  hypothetical protein                             57.4    2e-06   Gallibacterium anatis
gb|KDA98464.1|  cell wall anchor protein                              57.4    2e-06   Lactobacillus gasseri K7
ref|WP_039946191.1|  hypothetical protein                             55.1    2e-06   
ref|WP_033032426.1|  hypothetical protein                             53.5    3e-06   
ref|WP_001083114.1|  alpha-L-fucosidase                               57.0    3e-06   Streptococcus oralis
ref|WP_039157809.1|  hypothetical protein                             57.0    3e-06   Gallibacterium anatis
ref|WP_021461970.1|  hypothetical protein                             57.0    3e-06   Gallibacterium anatis
ref|WP_011328491.1|  ribonuclease                                     56.6    3e-06   Pseudoalteromonas haloplanktis
gb|EHJ52010.1|  agglutinin receptor                                   56.6    3e-06   Streptococcus macacae NCTC 11558
gb|AGL65247.2|  Cell surface protein                                  56.6    4e-06   Lactobacillus plantarum subsp. plantarum P-8
ref|WP_040539980.1|  hypothetical protein                             55.8    4e-06   
gb|EPD62247.1|  hypothetical protein HMPREF1211_03881                 56.2    4e-06   Streptomyces sp. HGB0020
ref|WP_033587337.1|  hypothetical protein                             55.8    5e-06   
ref|XP_001622881.1|  predicted protein                                53.5    5e-06   Nematostella vectensis
ref|WP_039490054.1|  MULTISPECIES: ribonuclease                       56.2    5e-06   Pseudoalteromonas
ref|XP_004916500.1|  PREDICTED: salivary glue protein Sgs-4-like      55.1    6e-06   Xenopus tropicalis [western clawed frog]
ref|WP_014567818.1|  mucin binding protein                            55.8    6e-06   Lactobacillus johnsonii
ref|WP_021032005.1|  RNase E                                          55.8    7e-06   Pseudoalteromonas arctica
ref|WP_009013731.1|  TolA domain protein                              55.5    7e-06   Streptococcus sp. C300
ref|WP_035425692.1|  cell wall anchor protein                         55.5    7e-06   
gb|KGK34316.1|  hypothetical protein JL09_g6537                       52.4    8e-06   Pichia kudriavzevii
ref|WP_003642311.1|  cell surface protein precursor                   55.5    8e-06   Lactobacillus plantarum
ref|WP_004897948.1|  mucin binding protein                            55.5    8e-06   Lactobacillus johnsonii
gb|ACF42267.1|  neurofilament triplet H1 protein                      53.9    8e-06   Soft-shelled turtle iridovirus
ref|WP_039167092.1|  hypothetical protein                             55.5    8e-06   Gallibacterium anatis
ref|XP_006659167.1|  PREDICTED: uncharacterized protein LOC102702307  55.1    9e-06   Oryza brachyantha
ref|WP_039145306.1|  hypothetical protein                             55.1    9e-06   
ref|WP_024002328.1|  cell surface protein precursor                   55.5    1e-05   Lactobacillus plantarum
gb|EMC77213.1|  Ovarian abundant message protein                      53.5    1e-05   Columba livia [carrier pigeon]
gb|EFB22434.1|  hypothetical protein PANDA_020193                     52.4    1e-05   Ailuropoda melanoleuca
ref|WP_033037822.1|  ribonuclease                                     55.1    1e-05   Pseudoalteromonas sp. S3431
ref|WP_000300357.1|  hypothetical protein                             54.7    1e-05   
ref|WP_033615607.1|  cell wall anchor protein                         55.1    1e-05   Lactobacillus plantarum
ref|WP_025288912.1|  hypothetical protein                             55.1    1e-05   Bibersteinia trehalosi
ref|WP_024593398.1|  ribonuclease                                     55.1    1e-05   Pseudoalteromonas haloplanktis
ref|XP_002940580.2|  PREDICTED: uncharacterized protein LOC100379885  55.1    1e-05   
gb|AHG85653.1|  hypothetical protein F544_4210                        54.7    2e-05   Bibersteinia trehalosi USDA-ARS-USMARC-190
gb|AHM26124.1|  RGI orf47L-like protein                               52.8    2e-05   Frog virus 3
ref|WP_023599945.1|  mucin binding protein                            54.7    2e-05   Lactobacillus johnsonii
gb|KFL87002.1|  hypothetical protein LpDm1_2602                       54.7    2e-05   Lactobacillus plantarum
ref|XP_005531742.1|  PREDICTED: collagen alpha-1(XXIV) chain-like     52.8    2e-05   
ref|WP_016085848.1|  hypothetical protein                             52.4    3e-05   Bacillus cereus
ref|WP_024600481.1|  ribonuclease                                     53.9    3e-05   Pseudoalteromonas haloplanktis
ref|WP_016527324.1|  adherence-associated mucus-binding protein,L...  53.9    3e-05   Lactobacillus plantarum
ref|WP_034092386.1|  hypothetical protein                             51.6    3e-05   
ref|WP_024601393.1|  ribonuclease                                     53.9    3e-05   Pseudoalteromonas atlantica
ref|WP_007375272.1|  ribonuclease E                                   53.9    3e-05   
ref|WP_034371226.1|  cell surface protein                             53.9    3e-05   Dermabacter hominis
ref|WP_039085890.1|  hypothetical protein                             53.5    3e-05   
ref|WP_039162097.1|  hypothetical protein                             53.5    4e-05   Gallibacterium anatis
ref|WP_037886013.1|  hypothetical protein                             51.2    4e-05   
ref|WP_000300356.1|  hypothetical protein                             53.1    5e-05   
gb|EMC77394.1|  putative serine/threonine-protein kinase kinX         53.1    5e-05   Columba livia [carrier pigeon]
gb|AIW68555.1|  neurofilament triplet H1-like protein                 51.2    5e-05   Common midwife toad ranavirus
ref|XP_008310536.1|  PREDICTED: protein SPT2 homolog isoform X1       53.1    5e-05   Cynoglossus semilaevis
ref|XP_007182705.1|  PREDICTED: LOW QUALITY PROTEIN: G2/mitotic-s...  53.1    5e-05   Balaenoptera acutorostrata scammoni
ref|XP_008310537.1|  PREDICTED: protein SPT2 homolog isoform X2       53.1    5e-05   Cynoglossus semilaevis
gb|ACB11439.1|  neurofilament triplet H1-like protein                 52.4    5e-05   Ambystoma tigrinum virus
gb|AJI79873.1|  hypothetical protein CSING_11890                      53.1    6e-05   Corynebacterium singulare
gb|ACB11440.1|  neurofilament triplet H1-like protein                 52.4    6e-05   Ambystoma tigrinum virus
ref|WP_024596135.1|  ribonuclease                                     52.8    7e-05   Pseudoalteromonas haloplanktis
ref|WP_039147361.1|  hypothetical protein                             52.8    8e-05   Gallibacterium anatis
ref|WP_010557308.1|  ribonuclease                                     52.4    8e-05   Pseudoalteromonas marina
gb|EJP18773.1|  LPXTG cell wall anchor domain protein                 52.0    8e-05   Streptococcus oralis SK304
gb|EMC89538.1|  Collagen-like protein 2                               49.7    9e-05   Columba livia [carrier pigeon]
ref|WP_010188733.1|  hypothetical protein                             51.6    1e-04   
ref|WP_032667851.1|  hypothetical protein                             49.7    1e-04   
ref|WP_039141203.1|  hypothetical protein                             52.0    1e-04   Gallibacterium anatis
ref|WP_018346332.1|  hypothetical protein                             52.0    1e-04   Gallibacterium anatis
ref|WP_028835759.1|  ribonuclease                                     52.0    1e-04   Pseudoalteromonas sp. 6BO_GOM-1096m
ref|XP_004646348.1|  PREDICTED: G2/mitotic-specific cyclin-B3         52.0    1e-04   Octodon degus
gb|ETN66453.1|  Unc-89 protein                                        52.0    1e-04   Anopheles darlingi [American malaria mosquito]
ref|WP_024590363.1|  MULTISPECIES: ribonuclease                       52.0    1e-04   Pseudoalteromonas
ref|WP_039152156.1|  hypothetical protein                             51.6    1e-04   
ref|WP_042132036.1|  hypothetical protein                             51.6    1e-04   Paenibacillus sp. FSL R5-0345
gb|KDS93254.1|  surface protein                                       51.6    1e-04   Dermabacter hominis 1368
ref|XP_011194718.1|  PREDICTED: uncharacterized protein LOC105220036  51.6    2e-04   Bactrocera cucurbitae [melon fruit fly]
gb|AGC91524.1|  putative biofilm-associated protein                   51.6    2e-04   Staphylococcus warneri SG1
ref|WP_035427023.1|  cell wall anchor protein                         51.6    2e-04   Lactobacillus gasseri
ref|WP_011824199.1|  hypothetical protein                             50.1    2e-04   Prochlorococcus marinus
gb|KEK46499.1|  LPXTG cell wall anchor domain protein                 51.6    2e-04   Staphylococcus warneri Lyso 1 2011
ref|WP_036322739.1|  hypothetical protein                             48.9    2e-04   
gb|EPQ06187.1|  Sialidase                                             49.7    2e-04   Myotis brandtii
ref|XP_007812695.1|  Neurofilament triplet H protein                  51.2    2e-04   Metarhizium acridum CQMa 102
ref|WP_033102701.1|  MULTISPECIES: ribonuclease                       51.2    2e-04   Alteromonadales
ref|WP_041896497.1|  hypothetical protein                             50.4    3e-04   
ref|WP_040802052.1|  hypothetical protein                             48.1    3e-04   
gb|ACB11433.1|  neurofilament triplet H1-like protein                 50.4    3e-04   Ambystoma tigrinum virus
ref|WP_014940697.1|  signal peptide protein                           50.8    3e-04   Lactobacillus buchneri
gb|ELT92048.1|  hypothetical protein CAPTEDRAFT_227575                50.8    3e-04   Capitella teleta
gb|ACB11441.1|  neurofilament triplet H1-like protein                 50.1    3e-04   Ambystoma tigrinum virus
gb|ACB11429.1|  neurofilament triplet H1-like protein                 50.1    3e-04   Ambystoma tigrinum virus
gb|EWZ85759.1|  hypothetical protein FOWG_10855                       50.4    4e-04   Fusarium oxysporum f. sp. lycopersici MN25
ref|WP_039139264.1|  hypothetical protein                             50.4    4e-04   
gb|EXA35697.1|  hypothetical protein FOVG_12852                       50.4    4e-04   Fusarium oxysporum f. sp. pisi HDV247
ref|WP_036903336.1|  hypothetical protein                             47.4    4e-04   
ref|WP_024604127.1|  ribonuclease                                     50.4    4e-04   Pseudoalteromonas haloplanktis
gb|ACB11434.1|  neurofilament triplet H1-like protein                 50.1    4e-04   Ambystoma tigrinum virus
ref|WP_008126344.1|  ribonuclease                                     50.4    4e-04   Pseudoalteromonas sp. BSi20480
ref|WP_039161440.1|  hypothetical protein                             50.1    4e-04   
gb|KFY21541.1|  hypothetical protein V493_07318                       50.1    5e-04   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|EGU75460.1|  hypothetical protein FOXB_14029                       50.1    5e-04   Fusarium oxysporum Fo5176
gb|ACX55818.1|  Aap                                                   47.4    6e-04   Staphylococcus epidermidis
ref|WP_003657303.1|  Hypothetical protein                             48.5    6e-04   
ref|XP_011244138.1|  PREDICTED: endochitinase A-like                  49.3    7e-04   
ref|XP_002736705.2|  PREDICTED: uncharacterized protein C1orf173-...  49.7    7e-04   Saccoglossus kowalevskii
ref|WP_007585714.1|  ribonuclease                                     49.7    7e-04   Pseudoalteromonas sp. BSi20429
ref|XP_010871682.1|  PREDICTED: sporozoite surface protein 2-like     48.9    8e-04   Esox lucius
gb|ACX55817.1|  Aap                                                   47.0    8e-04   Staphylococcus epidermidis
ref|WP_035756719.1|  hypothetical protein                             47.4    8e-04   
ref|XP_002780730.1|  conserved hypothetical protein                   49.3    8e-04   Perkinsus marinus ATCC 50983
gb|ACB11427.1|  neurofilament triplet H1-like protein                 48.9    8e-04   Ambystoma tigrinum virus
gb|EHJ07815.1|  accumulation-associated protein                       47.4    0.001   Staphylococcus simiae CCM 7213



>gb|KFL94796.1| putative YSIRK type signal peptide [Lactobacillus gasseri SJ-9E-US]
Length=2449

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEP
Sbjct  2210  AQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEP  2269

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P      D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  2270  TKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  2329


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  2228  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  2287

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  2288  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  2344


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  2203  PTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  2262

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  2263  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  2311


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  2200  PVEPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  2259

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  2260  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  2293


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 32/63 (51%), Gaps = 6/63 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  2202  EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  2255

Query  479   HPL  487
              P+
Sbjct  2256  EPI  2258



>gb|ABJ60955.1| hypothetical protein LGAS_1663 [Lactobacillus gasseri ATCC 33323 
= JCM 1131]
Length=2449

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEP
Sbjct  2210  AQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEP  2269

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P      D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  2270  TKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  2329


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  2228  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  2287

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  2288  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  2344


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  2203  PTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  2262

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  2263  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  2311


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  2200  PVEPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  2259

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  2260  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  2293


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 32/63 (51%), Gaps = 6/63 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  2202  EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  2255

Query  479   HPL  487
              P+
Sbjct  2256  EPI  2258



>gb|KFL96555.1| putative LPXTG-motif cell wall anchor domain protein [Lactobacillus 
gasseri SV-16A-US]
Length=2206

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  1985  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  2044

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  2045  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  2101


 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D 
Sbjct  1978  PTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDK  2037

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  2038  PARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  2086


 Score = 90.5 bits (223),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  1960  PTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  2019

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  2020  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  2068


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D P   SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  1957  PVEPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  2016

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  2017  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  2050


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 6/63 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D P   SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  1959  EPTTP------DKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  2012

Query  479   HPL  487
              P+
Sbjct  2013  EPI  2015



>gb|EFB61571.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus gasseri 
224-1]
Length=1929

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  1708  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  1767

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1768  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1824


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D 
Sbjct  1701  PTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDK  1760

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1761  PARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1809


 Score = 89.7 bits (221),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  1683  PTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  1742

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1743  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1791


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D P   SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  1680  PVEPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  1739

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1740  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1773


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 6/63 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D P   SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  1682  EPTTP------DKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1735

Query  479   HPL  487
              P+
Sbjct  1736  EPI  1738



>ref|WP_041807453.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1203

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEP
Sbjct  964   AQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEP  1023

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P      D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1024  TKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  982   ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  1041

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1042  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  957   PTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  1016

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1017  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  954   PVEPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  1013

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1014  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 32/63 (51%), Gaps = 6/63 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1009

Query  479   HPL  487
              P+
Sbjct  1010  EPI  1012



>ref|WP_035426675.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1203

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEP
Sbjct  964   AQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEP  1023

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P      D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1024  TKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  982   ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  1041

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1042  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  957   PTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  1016

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1017  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  954   PVEPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  1013

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1014  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 32/63 (51%), Gaps = 6/63 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1009

Query  479   HPL  487
              P+
Sbjct  1010  EPI  1012



>ref|WP_003646770.1| cell wall anchor protein [Lactobacillus gasseri]
 gb|EFQ45682.1| putative phage head-tail adaptor [Lactobacillus gasseri MV-22]
Length=1205

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEP
Sbjct  964   AQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEP  1023

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P      D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1024  TKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  982   ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  1041

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1042  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  957   PTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  1016

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1017  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 47/94 (50%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  954   PVEPTTPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  1013

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1014  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 32/63 (51%), Gaps = 6/63 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEPT P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  1009

Query  479   HPL  487
              P+
Sbjct  1010  EPI  1012



>ref|WP_035425140.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1203

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  982   ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  1041

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  1042  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  1098


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D 
Sbjct  975   PTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDK  1034

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  1035  PARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  1083


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  957   PTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  1016

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  1017  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  1065


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P   D P   SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  954   PVEPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  1013

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  1014  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  1047



>ref|WP_042749347.1| cell wall anchor protein [Lactobacillus gasseri]
Length=1077

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  856  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  915

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
            T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P
Sbjct  916  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKP  972


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      D 
Sbjct  849  PTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDK  908

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P
Sbjct  909  PARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEP  957


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P   D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  831  PTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  890

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  891  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  939


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +2

Query  203  PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
            P  P   D P   SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  828  PVEPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  887

Query  383  YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  888  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  921



>ref|WP_035423195.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=665

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P   D P   SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D 
Sbjct  557  PTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDK  616

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P
Sbjct  617  PAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEP  665


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +2

Query  203  PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
            P  P   D P   SEPT P  P   + PA  +EPT P      D PA  SEPT P  P+ 
Sbjct  554  PVEPTTPDKPTQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPIT  613

Query  383  YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             D PA  SEPT P  P   D PA  +EPT P  P
Sbjct  614  PDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEP  647


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 39/84 (46%), Gaps = 0/84 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  582  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  641

Query  305  TMPNYHLKYDSPAMLSEPTMPNHP  376
            T P      D PA  SEP  P  P
Sbjct  642  TKPEEPTTPDKPAQPSEPIKPEEP  665



>ref|WP_002460604.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|EFU83717.1| serine-aspartate repeat-containing protein F [Staphylococcus 
lugdunensis M23590]
Length=2202

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   +EP+ P+   K   
Sbjct  2003  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSE  2062

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P+  SEP  P+ P K + P+  SEP  PS P K   P   SEP+ P+ P
Sbjct  2063  PSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEP  2111


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P+  SEP  P+   
Sbjct  2006  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSEPS  2064

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             K   P   SEP  PN P K   P   SEP+ PS P K   P+  SEP+ P+ P
Sbjct  2065  KPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEPSKPSEP  2117


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 58/117 (50%), Gaps = 1/117 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   SEP  P+ P K   P   +EP+ P+ P K   P+  SEP  P+   
Sbjct  2018  PNE-PNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPG  2076

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             K + P+  SEP  P+ P K   P   SEP+ PS P K   P   SEP+ PN  ++ S
Sbjct  2077  KPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEPSKPSEPNKPSEPSKPNKSVHTS  2133


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   SEP  P+ P K   P   SEP  PN P K   P   SEP+ P+   K   
Sbjct  2015  PGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEPNKPSE  2074

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P   +EP+ P+ P K   P+  SEP  PS P K   P+  SEP  P+ P
Sbjct  2075  PGKPNEPSKPSEPNKPSEPSKPSEPNKPSEPSKPSEPSKPSEPNKPSEP  2123


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 47/98 (48%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K + P+  SEP  P+
Sbjct  2002  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPNKPSEPGKPNEPSKPSEPNKPS  2061

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P K   P   SEP  P+ P K   P   SEP+ P+ P
Sbjct  2062  EPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPSKPSEP  2099



>ref|WP_037540934.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|EVI50319.1| hypothetical protein T979_01412 [Staphylococcus lugdunensis UCIM6116]
Length=2202

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 46/116 (40%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   SEP  P+   K + 
Sbjct  2003  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNE  2062

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P   SEP  P+ P K   P+  SEP  PS P K + P+  SEP  P+ P  G P +
Sbjct  2063  PNKPSEPGKPSEPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEP--GKPSE  2116


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   SEP  P+ P K   P   SEP  P+ P K   P   SEP  P+   
Sbjct  2018  PNE-PNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSEPS  2076

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             K   P+  SEP  P+ P K + P+  SEP  PS P K   P+  SEP  PN  ++ S
Sbjct  2077  KPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEPGKPNKSVHTS  2133


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   SEP  P+ P K   P   SEP  P+ P K   P   +EP  P+   K   
Sbjct  2015  PGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSE  2074

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P+  SEP+ P+ P K   P   +EP+ PS P K   P   SEP+ P+ P  G P +
Sbjct  2075  PSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEP--GKPNK  2128


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K   P   SEP  PN
Sbjct  2002  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPN  2061

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P K   P   SEP+ PS P K   P   SEP  PN P
Sbjct  2062  EPNKPSEPGKPSEPSKPSEPSKPSEPNKPSEPGKPNEP  2099


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 51/113 (45%), Gaps = 1/113 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P   SEP  PN   
Sbjct  2006  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPSEPGKPNEPN  2064

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             K   P   SEP+ P+ P K   P   SEP  P+ P K   P   SEP  P+ P
Sbjct  2065  KPSEPGKPSEPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEP  2117



>ref|WP_002492503.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|EHS04472.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis 
VCU139]
Length=2190

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   +EP  P+   K   
Sbjct  2003  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSE  2062

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P+  SEP+ P+ P K   P   +EP+ PS P K   P   SEP+ P+ P  G P +
Sbjct  2063  PSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEP--GKPNK  2116


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P   SEP  P+   
Sbjct  2006  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSEPS  2064

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             K   P+  SEP  P+ P K + P+  SEP  PS P K   P+  SEP  PN  ++ S
Sbjct  2065  KPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEPGKPNKSVHTS  2121


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 51/105 (49%), Gaps = 2/105 (2%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K + P   SEP  P+
Sbjct  2002  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPS  2061

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
              P K   P+  SEP  PS P K + P+  SEP  P+ P  G P +
Sbjct  2062  EPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEP--GKPSE  2104



>ref|WP_037555315.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|KAK56509.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis 
VCU148]
Length=2147

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   SEP  PN P K   P   SEP  P+ P K   P   +EP  P+   K   
Sbjct  1960  PNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSE  2019

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P+  SEP+ P+ P K   P   +EP+ PS P K   P   SEP+ P+ P  G P +
Sbjct  2020  PSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEP--GKPNK  2073


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   +EP  P+ P K   P   SEP  P+ P K   P   SEP  P+   
Sbjct  1963  PNE-PGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPSEPS  2021

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             K   P+  SEP  P+ P K + P+  SEP  PS P K   P+  SEP  PN  ++ S
Sbjct  2022  KPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEPGKPSEPSKPSEPGKPNKSVHTS  2078


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 51/105 (49%), Gaps = 2/105 (2%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  PN P K   P   +EP  P+ P K   P   SEP  P+   K + P   SEP  P+
Sbjct  1959  EPNKPNEPGKPSEPGKPNEPNKPSEPGKPSEPGKPSEPGKPSEPGKPNEPNKPSEPGKPS  2018

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
              P K   P+  SEP  PS P K + P+  SEP  P+ P  G P +
Sbjct  2019  EPSKPSEPSKPSEPNKPSEPGKPNEPSKPSEPNKPSEP--GKPSE  2061



>ref|WP_021314972.1| hypothetical protein, partial [Lactobacillus gasseri]
 gb|EQB84156.1| hypothetical protein M497_01245, partial [Lactobacillus gasseri 
2016]
Length=343

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 53/106 (50%), Gaps = 0/106 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            D PA  SEPT P  P   D PA  +EPT P  P   + PA  SEPT P   +  D PA  
Sbjct  101  DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQP  160

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            SEPT P  P   D PA  +EPT P  P   D PA  SEP  P  P 
Sbjct  161  SEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPT  206


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P   D PA  +EPT P  P   D PA  SEPT P  P+  + PA  SEPT P      
Sbjct  113  EEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTP  172

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            D PA  +EPT P  P   D PA  SEP  P  P   D PA  SEPT P  P 
Sbjct  173  DKPARPTEPTKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPT  224


 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            ARP        P   D PA  SEPT P  P+  D PA  SEPT P  P   + PA  +EP
Sbjct  122  ARPTEPTKPEEPTTPDKPAQPSEPTKPEEPITPDKPAQPSEPTKPEEPTTPDKPARPTEP  181

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
            T P      D PA  SEP  P  P   D PA  SEPT P  P   D P   SEPT P  
Sbjct  182  TKPEEPTTPDKPAQPSEPIKPEEPTTPDKPAQPSEPTEPKEPTTPDKPTQPSEPTKPEE  240


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 49/99 (49%), Gaps = 6/99 (6%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EPT P      D PA  SEPT P  P   + PA  +EPT P      D PA  SEPT P 
Sbjct  96   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPTKPE  149

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P+  D PA  SEPT P  P   D PA  +EPT P  P 
Sbjct  150  EPITPDKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPT  188



>ref|WP_037545809.1| hypothetical protein [Staphylococcus lugdunensis]
 gb|KAK55372.1| putative serine-aspartate repeat protein F [Staphylococcus lugdunensis 
VCU150]
Length=2167

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   +EP  P+ P K   P   SEP  PN P K   P   SEP  P+   K + 
Sbjct  1971  PNKPNEPGKPNEPGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNE  2030

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P   SEP  P+ P K   P   SEP  PS P K   P   SEP  P+ P
Sbjct  2031  PNKPSEPNKPSEPGKPSEPGKPSEPNKPSEPGKPSEPGKPSEPNKPSEP  2079


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 55/120 (46%), Gaps = 3/120 (3%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K + P   SEPT P+ P K   P   +EP  P+ P K   P   SEP  PN   
Sbjct  1974  PNE-PGKPNEPGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNEPN  2032

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             K   P   SEP  P+ P K   P   SEP  PS P K   P   SEP  P+ P  G P +
Sbjct  2033  KPSEPNKPSEPGKPSEPGKPSEPNKPSEPGKPSEPGKPSEPNKPSEPNKPSEP--GKPSK  2090


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 49/105 (47%), Gaps = 2/105 (2%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  PN P K + P   SEPT P+ P K   P   +EP  P+   K   P   SEP  PN
Sbjct  1970  EPNKPNEPGKPNEPGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPN  2029

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
              P K   P   SEP  PS P K   P   SEP  P+ P  G P +
Sbjct  2030  EPNKPSEPNKPSEPGKPSEPGKPSEPNKPSEPGKPSEP--GKPSE  2072


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 51/113 (45%), Gaps = 1/113 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   SEP  P+ P K + P   SEP  P+ P K   P   +EP  P+   
Sbjct  1980  PNE-PGKPSEPTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNEPNKPSEPN  2038

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             K   P   SEP  P+ P K   P   SEP  PS P K   P   SEP  P+ P
Sbjct  2039  KPSEPGKPSEPGKPSEPNKPSEPGKPSEPGKPSEPNKPSEPNKPSEPGKPSKP  2091


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 46/108 (43%), Gaps = 0/108 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K   P   SEP  PN P K   P   SEP  P+ P K   P   SEP  P+   K   
Sbjct  1989  PTKPSEPNKPSEPGKPNEPNKPSEPGKPSEPNKPSEPGKPNEPNKPSEPNKPSEPGKPSE  2048

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
             P   SEP  P+ P K   P   SEP  PS P K   P   S+P    H
Sbjct  2049  PGKPSEPNKPSEPGKPSEPGKPSEPNKPSEPNKPSEPGKPSKPNKSVH  2096


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 41/94 (44%), Gaps = 1/94 (1%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P   SEP  P+ P K + P   SEP  P+ P K   P   SEP  P+   
Sbjct  2004  PNE-PNKPSEPGKPSEPNKPSEPGKPNEPNKPSEPNKPSEPGKPSEPGKPSEPNKPSEPG  2062

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  427
             K   P   SEP  P+ P K   P   S+P    H
Sbjct  2063  KPSEPGKPSEPNKPSEPNKPSEPGKPSKPNKSVH  2096



>ref|WP_042802751.1| hypothetical protein [Mannheimia haemolytica]
 gb|EXI62308.1| hypothetical protein AK33_06225 [Mannheimia haemolytica serotype 
A1/A6 str. PKL10]
Length=2028

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 44/172 (26%), Positives = 72/172 (42%), Gaps = 6/172 (3%)
 Frame = +2

Query  2    TSKYIIKPSFN*IPTAMASPSSRLTIGAFLLIS----HLLLNSSMARPITMMPNHHPLKY  169
            T+  +I PS   + T   S      +G+  L++        ++S A+P        P++ 
Sbjct  96   TATEVIAPSATPLSTLGFSALGLAALGSVALVNRGGKQTSTSNSSAQPEKTAQPEQPIQP  155

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + P    +PT P  P + + P    +PT P  P + E P    +PT P    + + PA  
Sbjct  156  EQPTQPEQPTQPEQPAQPEQPVQPEQPTQPEQPTQPEQPIQPEQPTQPEKPTQPEQPAQP  215

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             +P  P  P + + P    +P  P  P + + P    +PT P  P    PEQ
Sbjct  216  EQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTR--PEQ  265


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 2/127 (2%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+P   +    P + + P    +P  P  P + + P    +P  P  P++ E P    +P
Sbjct  171  AQPEQPVQPEQPTQPEQPTQPEQPIQPEQPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQP  230

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            T P    + + PA   +PT P  P + + P    +PT P  P + + PA   +PT P  P
Sbjct  231  TQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQP  290

Query  485  LNGSPEQ  505
                PEQ
Sbjct  291  TQ--PEQ  295


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P + + P    +P  P  P++ + P    +PT P  P + E PA   +PT P    + +
Sbjct  199  QPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPE  258

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P    +PT P  P + + PA   +PT P  P + + P    +PT P  P
Sbjct  259  QPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQP  308


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 51/117 (44%), Gaps = 2/117 (2%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P++ + P    +PT P  P + + P    +PT P  P + E PA   +P  P    + +
Sbjct  193  QPIQPEQPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPE  252

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P    +PT P  P + + P    +P  P  P + + P    +PT P  P    PEQ
Sbjct  253  QPTQPEQPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQ--PEQ  307


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 50/117 (43%), Gaps = 2/117 (2%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P + + P    +PT P  P + + P    +PT P  P + E PA   +P  P    + +
Sbjct  169  QPAQPEQPVQPEQPTQPEQPTQPEQPIQPEQPTQPEKPTQPEQPAQPEQPIQPEQPTQPE  228

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P    +P  P  P + + P    +PT P  P + + P    +PT P  P    PEQ
Sbjct  229  QPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQPTQPEQPTQPEKP--AQPEQ  283


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 50/117 (43%), Gaps = 2/117 (2%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P + + P    +PT P  P + + PA   +P  P  P + E P    +P  P    + +
Sbjct  187  QPTQPEQPIQPEQPTQPEKPTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPE  246

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P    +PT P  P + + P    +PT P  P + + P    +PT P  P    PEQ
Sbjct  247  QPTQPEQPTQPEQPTRPEQPTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQ--PEQ  301


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 47/109 (43%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P + + PA   +P  P  P + + P    +P  P  P + E P    +PT P    + + 
Sbjct  206  PTQPEQPAQPEQPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQ  265

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P    +PT P  P + + P    +PT P  P + + P    +PT P  P
Sbjct  266  PTQPEQPTQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKP  314


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 0/99 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P++ + P    +PT P  P + + PA   +PT P  P + E P    +PT P    + +
Sbjct  217  QPIQPEQPTQPEQPTQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTRPEQPTQPEQPTQPE  276

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  451
             PA   +PT P  P + + P    +PT P  P + + PA
Sbjct  277  KPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPA  315



>ref|WP_001083120.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EIC76503.1| alpha-L-fucosidase [Streptococcus oralis SK610]
Length=2028

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P +P++ + PA   +P  P  P + E PA   +PT P    + + 
Sbjct  1699  PAQPEKPAQPEQPAEPENPVQPEKPAQPEKPAEPEKPAQPEKPAQPEKPTQPETPAQPEK  1758

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +PT P +P++ + PA   +PT P +P++ + PA    P  P  P
Sbjct  1759  PAQPEQPTQPENPVQPEKPAQPEQPTQPENPVQPEKPAQPETPAQPEKP  1807


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 35/121 (29%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P   +    P + ++P    +P  P  P + + PA   +P  P +P++ E PA   +P
Sbjct  1670  AQPENPVQPEKPAQPETPVQPEKPAEPEKPAQPEKPAQPEQPAEPENPVQPEKPAQPEKP  1729

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +PT P  P + + PA   +PT P +P++ + PA   +PT P +P
Sbjct  1730  AEPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPENPVQPEKPAQPEQPTQPENP  1789

Query  485   L  487
             +
Sbjct  1790  V  1790


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P       +P++ + PA   +P  P  P + + PA   +PT P  P + E PA   +P
Sbjct  1706  AQPEQPAEPENPVQPEKPAQPEKPAEPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEQP  1765

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P   ++ + PA   +PT P +P++ + PA    P  P  P + ++P    +P  P  P
Sbjct  1766  TQPENPVQPEKPAQPEQPTQPENPVQPEKPAQPETPAQPEKPAQPETPTQPEKPVQPEKP  1825


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 7/128 (5%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +PT P +P++ + PA   +PT P +P++ E PA    P
Sbjct  1742  AQPEKPTQPETPAQPEKPAQPEQPTQPENPVQPEKPAQPEQPTQPENPVQPEKPAQPETP  1801

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P      + PA    PT P  P++ + P     PT P +P++ + PA    P  P  P
Sbjct  1802  AQP------EKPAQPETPTQPEKPVQPEKPTEPENPTQPENPVQPEKPAQPETPAQPEKP  1855

Query  485   L-NGSPEQ  505
             + + SPE+
Sbjct  1856  ITSSSPEE  1863


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +PT P  P + + PA   +PT P +P++ E PA   +P
Sbjct  1724  AQPEKPAEPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPENPVQPEKPAQPEQP  1783

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P   ++ + PA    P  P  P + ++P    +P  P  P + ++P     P  P  P
Sbjct  1784  TQPENPVQPEKPAQPETPAQPEKPAQPETPTQPEKPVQPEKPTEPENPTQPENPVQPEKP  1843


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 54/116 (47%), Gaps = 10/116 (9%)
 Frame = +2

Query  170   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             ++P    +P  P  P++ + PA   EP  P  P   E PA   +P  P   ++ + PA  
Sbjct  1673  ENPVQPEKPAQPETPVQPEKPA---EPEKPAQP---EKPAQPEQPAEPENPVQPEKPAQP  1726

Query  350   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN----GSPEQ  505
              +P  P  P + + PA   +PT P  P + + PA   +PT P +P+       PEQ
Sbjct  1727  EKPAEPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPENPVQPEKPAQPEQ  1782



>dbj|BAA77828.1| trappin [Hippopotamus amphibius]
Length=180

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 50/112 (45%), Gaps = 6/112 (5%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            DP KG + + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  24   DPVKGQYPVKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVK--  81

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
                G D + G    KG   + G D + G+   KG + + G D + G+   K
Sbjct  82   ----GQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVK  129


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 0/102 (0%)
 Frame = -1

Query  465  GSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSIA  286
            G D + G+   KG   + G D + G+   KG + + G D + G+   K    + G D + 
Sbjct  16   GQDPVKGQDPVKGQYPVKGQDPVKGQDPVKGQYPVKGQDPVKGQDPVKGQDPVKGQDPVK  75

Query  285  GDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
            G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  76   GQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQYPVK  117



>ref|WP_001083124.1| alpha-L-fucosidase [Streptococcus sp. GMD5S]
Length=2093

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P++ ++P    +P  P +P++ + PA   +PT P  P + E PA   +P
Sbjct  1795  AQPEKPAEPEKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQP  1854

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + + PA   +PT P  P + + PA    P  P  P + + PA    PT P  P
Sbjct  1855  TQPETPAQPEKPAQPEKPTQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETP  1914


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 6/113 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             +P++ + PA   +PT P  P + + PA   +PT P  P + E PA   +PT P      +
Sbjct  1823  NPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQP------E  1876

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
             +PA   +P  P  P + + PA   +P  P +P + ++PA   +P   + P  G
Sbjct  1877  TPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEG  1929


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 44/98 (45%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + + P     PT P  P + E+P    +P  P    + ++PA   +P  P 
Sbjct  1793  EAAQPEKPAEPEKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPETPAQPEKPAQPE  1852

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++PA   +P  P  P + ++PA   +P  P  P
Sbjct  1853  QPTQPETPAQPEKPAQPEKPTQPETPAQPEKPAQPETP  1890


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 46/110 (42%), Gaps = 0/110 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +PT P  P + + PA   +PT P  P + E PA    P
Sbjct  1831  AQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQPETPAQPEKPAQPETP  1890

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
               P    + + PA    PT P  P + + P   S P      L +  P++
Sbjct  1891  AQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEGVKDLVFTLPSL  1940



>gb|EFJ68906.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus gasseri 
JV-V03]
Length=1059

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 48/117 (41%), Gaps = 1/117 (1%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P   D P   S+PT P  P     P   SEPT P  P     P   SEPT P        
Sbjct  831  PTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPGK  890

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGSPEQ  505
            P   SEPT P  P     P   SEPT P  P     PA  SEPT P  P + G P Q
Sbjct  891  PVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPIIPGKPAQ  947


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/106 (41%), Positives = 44/106 (42%), Gaps = 0/106 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P     P   SEPT P  P     P   SEPT P  P     P   SEPT P        
Sbjct  849  PTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGK  908

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
            P   SEPT P  P     PA  SEPT P  P+    PA  SEPT P
Sbjct  909  PVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPIIPGKPAQPSEPTKP  954


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 45/102 (44%), Gaps = 0/102 (0%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EPT P+ P +   P    EPT P  P++   P    EPT P   ++   P    EPT P 
Sbjct  830  EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPG  889

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             P++   P    EPT P  P++   P    EPT P  P   S
Sbjct  890  KPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPS  931


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 36/88 (41%), Gaps = 7/88 (8%)
 Frame = +2

Query  245  EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
            EPT P+ P +   P    EPT P        P   SEPT P  P     P   SEPT P 
Sbjct  830  EPTTPDKPTQPSKPTKPEEPTTPG------KPVQPSEPTKPEEPTTPAKPVQPSEPTKPE  883

Query  425  HPLKYDSPAMLSEPTMPNHPLN-GSPEQ  505
             P     P   SEPT P  P   G P Q
Sbjct  884  EPTTPGKPVQPSEPTKPEEPTTPGKPVQ  911



>ref|WP_001083116.1| alpha-L-fucosidase [Streptococcus sp. GMD3S]
Length=2111

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P    +PT P +P++ + PA   +P  P  P + E+PA   +P  P    + ++
Sbjct  1830  PAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPET  1889

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL-NGSPEQ  505
             PA   +PT P +P++ ++PA   +P  P  P + + P     P  P  P+ + SPE+
Sbjct  1890  PAQPEKPTQPENPVQPETPAQPEKPAQPEKPAQPEKPTQPENPAQPEKPITSSSPEE  1946


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + ++P    +P  P  P + + P    +PT P +P++ E PA   +P  P    + ++
Sbjct  1812  PTQPENPVQPEKPAQPEKPAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQPET  1871

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P  P  P + ++PA   +PT P +P++ ++PA   +P  P  P
Sbjct  1872  PAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETPAQPEKPAQPEKP  1920


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P       +P++ + P    +P  P  P + ++P    +P  P  P + E P    +P
Sbjct  1783  AQPEKPAQPENPVQPEKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPEKP  1842

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P   ++ + PA   +P  P  P + ++PA   +P  P  P + ++PA   +PT P +P
Sbjct  1843  TQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENP  1902

Query  485   L  487
             +
Sbjct  1903  V  1903


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P   +    P + + PA   +PT P +P++ + PA   +P  P  P++ E P     P
Sbjct  1789  AQPENPVQPEKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPEKPTQPENP  1848

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +PT P  P + + PA   +PT P  P + + P     P  P  P
Sbjct  1849  VQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETP  1908


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/98 (29%), Positives = 48/98 (49%), Gaps = 0/98 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             +P++ + PA   +P  P  P + ++PA   +P  P  P + E+PA   +PT P   ++ +
Sbjct  1847  NPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPE  1906

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  448
             +PA   +P  P  P + + P     P  P  P+   SP
Sbjct  1907  TPAQPEKPAQPEKPAQPEKPTQPENPAQPEKPITSSSP  1944


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/104 (27%), Positives = 45/104 (43%), Gaps = 6/104 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA------MLS  352
             E   P  P + ++P    +PT P  P + E P     P  P    + + PA         
Sbjct  1781  EAAQPEKPAQPENPVQPEKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPE  1840

Query  353   EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +PT P +P++ + PA   +P  P  P + ++PA   +P  P  P
Sbjct  1841  KPTQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKP  1884


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 47/96 (49%), Gaps = 6/96 (6%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +P  P  P + ++PA   +PT P +P++ E+PA   +P
Sbjct  1855  AQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETPAQPEKP  1914

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEP  412
               P      + PA   +PT P +P + + P   S P
Sbjct  1915  AQP------EKPAQPEKPTQPENPAQPEKPITSSSP  1944



>ref|WP_001083117.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EIC78239.1| alpha-L-fucosidase [Streptococcus oralis SK100]
Length=2034

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/121 (29%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +PT P  P + + P     P  P  P + E PA   +P
Sbjct  1676  AQPEKPAQPEKPTQPETPAQPEKPTQPETPAQPEKPTQPENPVQPEKPAQPEKPAQPEQP  1735

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P   ++ + PA   +P  P  P + + PA    P  P  P++ + PA   +PT P +P
Sbjct  1736  TQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENP  1795

Query  485   L  487
             +
Sbjct  1796  V  1796


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +PT P +P++ + PA   +P  P  P + E PA    P  P   ++ + 
Sbjct  1723  PAQPEKPAQPEQPTQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEK  1782

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +PT P +P++ + PA   +P  P  P + + P    +P  P  P
Sbjct  1783  PAQPEKPTQPENPVQPEKPAQPEKPAQPEKPAQPEKPTQPEKPAQPEKP  1831


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + P     P  P  P + + PA   +PT P +P++ E PA   +P
Sbjct  1694  AQPEKPTQPETPAQPEKPTQPENPVQPEKPAQPEKPAQPEQPTQPENPVQPEKPAQPEKP  1753

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    P  P  P++ + PA   +PT P +P++ + PA   +P  P  P
Sbjct  1754  AQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKP  1813


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 7/128 (5%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA    P  P  P++ + PA   +PT P +P++ E PA   +P
Sbjct  1748  AQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEKP  1807

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P      + PA   +PT P  P + + PA   +PT P  P + + P     P  P  P
Sbjct  1808  AQP------EKPAQPEKPTQPEKPAQPEKPAQPEKPTQPEKPAQPEKPTQPETPAQPEKP  1861

Query  485   L-NGSPEQ  505
             + + SPE+
Sbjct  1862  ITSSSPEE  1869


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 6/120 (5%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P       +P++ + PA   +P  P  P + + PA    P  P  P++ E PA   +P
Sbjct  1730  AQPEQPTQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKP  1789

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P      ++P    +P  P  P + + PA   +PT P  P + + PA   +PT P  P
Sbjct  1790  TQP------ENPVQPEKPAQPEKPAQPEKPAQPEKPTQPEKPAQPEKPAQPEKPTQPEKP  1843


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 0/106 (0%)
 Frame = +2

Query  170   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             + PA   +P  P  P + ++PA   +PT P  P + E P     P  P    + + PA  
Sbjct  1673  EKPAQPEKPAQPEKPTQPETPAQPEKPTQPETPAQPEKPTQPENPVQPEKPAQPEKPAQP  1732

Query  350   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              +PT P +P++ + PA   +P  P  P + + PA    P  P  P+
Sbjct  1733  EQPTQPENPVQPEKPAQPEKPAQPEKPAQPEQPAQPETPAQPEKPV  1778


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + ++PA   +P  P  P + E P     P  P    + + 
Sbjct  1747  PAQPEKPAQPEKPAQPEQPAQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEK  1806

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P  P  P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  1807  PAQPEKPAQPEKPTQPEKPAQPEKPAQPEKPTQPEKPAQPEKPTQPETP  1855


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 47/105 (45%), Gaps = 8/105 (8%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + + PA   +PT P      E+PA   +PT P    + + P     P  P 
Sbjct  1668  EAAQPEKPAQPEKPAQPEKPTQP------ETPAQPEKPTQPETPAQPEKPTQPENPVQPE  1721

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
              P + + PA   +PT P +P++ + PA   +P  P  P    PEQ
Sbjct  1722  KPAQPEKPAQPEQPTQPENPVQPEKPAQPEKPAQPEKP--AQPEQ  1764


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/116 (27%), Positives = 51/116 (44%), Gaps = 6/116 (5%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHP------LKYESP  286
             A+P T      P++ + PA   +PT P +P++ + PA   +P  P  P       + E P
Sbjct  1766  AQPETPAQPEKPVQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPAQPEKPTQPEKP  1825

Query  287   AMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
             A   +P  P    + + PA   +PT P  P + + P   S P      L +  P++
Sbjct  1826  AQPEKPAQPEKPTQPEKPAQPEKPTQPETPAQPEKPITSSSPEEGVKDLVFTLPSL  1881



>ref|WP_032847157.1| hypothetical protein [Mannheimia granulomatis]
Length=2035

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/186 (25%), Positives = 73/186 (39%), Gaps = 22/186 (12%)
 Frame = +2

Query  2    TSKYIIKPSFN*IPTAMASPSSRLTIGAFLLISHLLLNSSMARPITMMPNHHPLKYDSPA  181
            T+  +I PS   + T   S     T+G+  L++     +S +   T      P + + PA
Sbjct  96   TATEVIAPSATLLSTLGFSALGLATLGSVALVNRGGKQTSTSNSSTQ--PEKPTQPEKPA  153

Query  182  MLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPT  361
               +P  P  P + + P    +PT P  P + E PA   +P  P    + + PA   +PT
Sbjct  154  QPEQPAQPEQPTQPEQPTQPEQPTQPEKPAQPEKPAQPEQPAQPAQPSQPEKPAQPEKPT  213

Query  362  MPNHPLK------------------YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P  P +                   + PA   +P  P  P + + PA   +PT P  P 
Sbjct  214  QPEQPTQPEQPTQPAQPAQPAQPAQPEKPAQPEQPAQPEQPAQPEKPAQPEQPTQPEQPT  273

Query  488  NGSPEQ  505
               PEQ
Sbjct  274  Q--PEQ  277


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/134 (27%), Positives = 53/134 (40%), Gaps = 20/134 (15%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLK------------------YES  283
            P + + PA   +P  P  P + + PA   +PT P  P +                   E 
Sbjct  182  PAQPEKPAQPEQPAQPAQPSQPEKPAQPEKPTQPEQPTQPEQPTQPAQPAQPAQPAQPEK  241

Query  284  PAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            PA   +P  P    + + PA   +PT P  P + + P    +PT P  P + + P    +
Sbjct  242  PAQPEQPAQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPTQPEQ  301

Query  464  PTMPNHPLNGSPEQ  505
            PT P  P    PEQ
Sbjct  302  PTQPEKP--AQPEQ  313


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + PA   +P  P  P + + PA   +PT P  P + E P    +PT P    + + P   
Sbjct  240  EKPAQPEQPAQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPTQP  299

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  448
             +PT P  P + + PA   +P  P  P K D P
Sbjct  300  EQPTQPEKPAQPEQPAQPKQPAQPEQPPKEDEP  332


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 53/132 (40%), Gaps = 12/132 (9%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+P        P + + P    +P  P  P + + PA  ++P+ P  P + E P    +P
Sbjct  159  AQPEQPTQPEQPTQPEQPTQPEKPAQPEKPAQPEQPAQPAQPSQPEKPAQPEKPTQPEQP  218

Query  305  TMPNYHLKY------------DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  448
            T P    +             + PA   +P  P  P + + PA   +PT P  P + + P
Sbjct  219  TQPEQPTQPAQPAQPAQPAQPEKPAQPEQPAQPEQPAQPEKPAQPEQPTQPEQPTQPEQP  278

Query  449  AMLSEPTMPNHP  484
                +PT P  P
Sbjct  279  TQPEQPTQPEQP  290


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 53/138 (38%), Gaps = 18/138 (13%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLK------------------YDSPAMLSEP  250
            A+P        P + + PA   +PT P  P +                   + PA   +P
Sbjct  189  AQPEQPAQPAQPSQPEKPAQPEKPTQPEQPTQPEQPTQPAQPAQPAQPAQPEKPAQPEQP  248

Query  251  TMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHP  430
              P  P + E PA   +PT P    + + P    +PT P  P + + P    +PT P  P
Sbjct  249  AQPEQPAQPEKPAQPEQPTQPEQPTQPEQPTQPEQPTQPEQPTQPEKPTQPEQPTQPEKP  308

Query  431  LKYDSPAMLSEPTMPNHP  484
             + + PA   +P  P  P
Sbjct  309  AQPEQPAQPKQPAQPEQP  326



>gb|AAQ92320.1| elafin [Ovis aries]
Length=262

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  76   DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  135

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  136  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKGQDPVKGQDPVKGQGPVK  187


 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  94   DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  153

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  154  DPVKGQDPVKGQDLVKGQDPVKGQDPVKGQGPVKGQDPVKGQDPVKGQDPVK  205


 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  64   DPVKGQDPVEGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  123

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  124  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKGQDPVK  175


 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  88   DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  147

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  148  DPVKGQDPVKGQDPVKGQDLVKGQDPVKGQDPVKGQGPVKGQDPVKGQDPVK  199


 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            +P KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  58   NPVKGQDPVKGQDPVEGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  117

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  118  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVK  169


 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            DP +G   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  70   DPVEGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  129

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              + G D + G    KG   + G D + G+   KG   + G D + G+   K
Sbjct  130  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDLVKGQDPVKGQDPVK  181


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            DP KG   + G D + G+   KG   + G D + G+   KG   + G D + G+   K  
Sbjct  106  DPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQDPVKGQ  165

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              + G D + G    KG   + G D + G+   KG   + G D + G    K
Sbjct  166  DLVKGQDPVKGQDPVKGQGPVKGQDPVKGQDPVKGQDPVKGQDRVRGPLLTK  217



>emb|CCB52766.1| putative LPXTG cell wall-anchored protein (pseudogene) [Staphylococcus 
lugdunensis N920143]
Length=1619

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 49/108 (45%), Gaps = 12/108 (11%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P   SEP  PN P K   P+  SEP  P+ P K   P   SEP  PN       
Sbjct  1454  PNKPNEPGKPSEPGKPNEPNKPSEPSKPSEPNKPSEPSKPSEPGKPSEPNKPN-------  1506

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
                  EP+ P+ P K + P+  SEPT PS P K   P   S+P    H
Sbjct  1507  -----EPSKPSEPNKPNEPSKPSEPTKPSEPNKPSEPGKPSKPNKSVH  1549


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 45/98 (46%), Gaps = 6/98 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  PN P K   P   +EP  P+ P K   P   SEP+ P+       P   SEP  PN
Sbjct  1453  EPNKPNEPGKPSEPGKPNEPNKPSEPSKPSEPNKPSEPSKPS------EPGKPSEPNKPN  1506

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P K   P   +EP+ PS P K   P   SEP  P+ P
Sbjct  1507  EPSKPSEPNKPNEPSKPSEPTKPSEPNKPSEPGKPSKP  1544


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 38/84 (45%), Gaps = 6/84 (7%)
 Frame = +2

Query  245   EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             EP  PN P K   P   +EP  P+       P+  SEP  P+ P K   P   SEP  P+
Sbjct  1453  EPNKPNEPGKPSEPGKPNEPNKPS------EPSKPSEPNKPSEPSKPSEPGKPSEPNKPN  1506

Query  425   HPLKYDSPAMLSEPTMPNHPLNGS  496
              P K   P   +EP+ P+ P   S
Sbjct  1507  EPSKPSEPNKPNEPSKPSEPTKPS  1530


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 40/94 (43%), Gaps = 13/94 (14%)
 Frame = +2

Query  146   PNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHL  325
             PN  P K   P+  SEP  P+ P K   P   SEP  PN P K   P   +EP+ P    
Sbjct  1469  PNE-PNKPSEPSKPSEPNKPSEPSKPSEPGKPSEPNKPNEPSKPSEPNKPNEPSKP----  1523

Query  326   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  427
                     SEPT P+ P K   P   S+P    H
Sbjct  1524  --------SEPTKPSEPNKPSEPGKPSKPNKSVH  1549



>ref|WP_015431801.1| hypothetical protein [Bibersteinia trehalosi]
 gb|AGH37662.1| hypothetical protein WQG_3820 [Bibersteinia trehalosi USDA-ARS-USMARC-192]
Length=2013

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 45/103 (44%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   P   SE
Sbjct  83   PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  142

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P  P+ P +   P   SEP  PS P +   P   +EP  P  P
Sbjct  143  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTEPEQPTEP  185


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 49/115 (43%), Gaps = 3/115 (3%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P +   P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  83   PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  142

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPE  502
            P   SEP  P+ P +   P   SEP  PS P   + P    +PT P   +N   E
Sbjct  143  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEP---EQPTEPEQPTEPQLTINAITE  194


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 47/106 (44%), Gaps = 7/106 (7%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EP  P+ P +   P   SEP  P+ P +   P   SEP  P+       P   SEP  P+
Sbjct  70   EPEQPSEPEQPVEPEQPSEPEQPSEPEQPSEPEQPSEPEQPS------EPEQPSEPEQPS  123

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS-PEQ  505
             P +   P   SEP  PS P +   P   SEP  P+ P   S PEQ
Sbjct  124  EPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQ  169



>ref|WP_042902012.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|KEQ51034.1| hypothetical protein SK143_0192 [Streptococcus oralis]
Length=2087

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +P  P  P++ + PA   +P  P  P + E+P    +P
Sbjct  1795  AQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKP  1854

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P   ++ + PA    P  P  P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  1855  AEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPEKP  1914

Query  485   L-NGSPEQ  505
             + + SPE+
Sbjct  1915  ITSSSPEE  1922


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +PT P  P + + PA   +P  P  P + E PA    P  P   ++ + 
Sbjct  1794  PAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEK  1853

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P  P  P + ++PA   +P  P  P + + PA   +P  P  P
Sbjct  1854  PAEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1902


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + ++PA   +P  P  P++ E PA   +P  P    + ++
Sbjct  1788  PAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPEN  1847

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P    +P  P  P++ + PA    P  P  P + + PA   +P  P  P
Sbjct  1848  PVQPEKPAEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP  1896


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/125 (25%), Positives = 55/125 (44%), Gaps = 0/125 (0%)
 Frame = +2

Query  110   LNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA  289
             +N ++   +  +      + + P    +P  P  P + + PA   +PT P  P + E PA
Sbjct  1760  VNQALKTALEQISKLEATQPEKPTQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPA  1819

Query  290   MLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
                +P  P    + + PA    P  P +P++ + PA   +P  P  P + ++PA   +P 
Sbjct  1820  QPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPVQPEKPAQPETPAQPEKPA  1879

Query  470   MPNHP  484
              P  P
Sbjct  1880  QPEKP  1884


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + + P     P  P  P + E P    +P  P    + ++
Sbjct  1782  PTQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPET  1841

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA    P  P  P + + P    +P  P  P + + PA   +P  P  P
Sbjct  1842  PAQPENPVQPEKPAEPEKPVQPEKPAQPETPAQPEKPAQPEKPAQPEKP  1890


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 0/81 (0%)
 Frame = +2

Query  245   EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             +PT P  P + E PA   +P  P    + ++PA   +P  P  P++ + PA   +P  P 
Sbjct  1781  KPTQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPVQPEKPAQPEQPAQPE  1840

Query  425   HPLKYDSPAMLSEPTMPNHPL  487
              P + ++P    +P  P  P+
Sbjct  1841  TPAQPENPVQPEKPAEPEKPV  1861



>ref|WP_001083121.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EGL90722.1| alpha-L-fucosidase [Streptococcus oralis SK255]
Length=1962

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 54/116 (47%), Gaps = 2/116 (2%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + ++P    +P  P  P + E PA   +P  P    + + 
Sbjct  1675  PAESEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPEKPAQPEK  1734

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             PA   +PT P  P + + PA   +PT P  P + ++PA   +P  P  P    PE+
Sbjct  1735  PAQPEKPTQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKP--AQPEK  1788


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/132 (26%), Positives = 57/132 (43%), Gaps = 2/132 (2%)
 Frame = +2

Query  110   LNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA  289
             +N ++   +  +    P + + PA   +P  P  P + + PA    P  P  P++ E PA
Sbjct  1653  VNQALETALEQINKLEPAQPEKPAESEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPA  1712

Query  290   MLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
                +P  P    + + PA   +P  P  P + ++PA   +P  P  P + + PA    P 
Sbjct  1713  EPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPEKPAQPETPA  1772

Query  470   MPNHPLNGSPEQ  505
              P  P    PE+
Sbjct  1773  QPEKP--AEPEK  1782


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA    P  P  P++ + PA   +P  P  P + E PA   +P  P    + ++
Sbjct  1687  PAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPET  1746

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
             PA   +P  P  P + + PA    P  P  P + + PA   +P   + P  G
Sbjct  1747  PAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSPEEG  1798


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 51/114 (45%), Gaps = 0/114 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++P    +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1682  AQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1741

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
             T P    + + PA   +PT P  P + ++PA   +P  P  P + + P   S P
Sbjct  1742  TQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSP  1795


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 0/99 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + + PA   +PT P  P + E PA   +PT P    + ++
Sbjct  1711  PAEPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPEKPAQPET  1770

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
             PA   +P  P  P + + P   S P      L +  P++
Sbjct  1771  PAQPEKPAEPEKPAQPEKPITSSSPEEGVKDLVFTLPSL  1809



>ref|XP_007932588.1| hypothetical protein MYCFIDRAFT_45664 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME76825.1| hypothetical protein MYCFIDRAFT_45664 [Pseudocercospora fijiensis 
CIRAD86]
Length=157

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (45%), Gaps = 5/141 (4%)
 Frame = +2

Query  80   GAFLLISHLLLNSSMARPITMMPNHH-----PLKYDSPAMLSEPTMPNHPLKYDSPAMLS  244
            G  +L   ++L+ S+    ++M +       PL  + P ML  P + +  L  D   +L 
Sbjct  10   GPLMLDGSIMLDGSLVVDGSLMLDDRLILDEPLILNGPLMLDGPLVLDGSLTLDDRLILD  69

Query  245  EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
            EP M N PL  + P +L    M +  L  D P ML+ P M + PL  D   ML +P MP 
Sbjct  70   EPLMLNGPLMLDWPLVLDGSLMLDDRLTLDEPLMLNSPLMLDGPLVLDGSLMLDDPLMPD  129

Query  425  HPLKYDSPAMLSEPTMPNHPL  487
              L  D   M     MP+  L
Sbjct  130  GSLMPDGSLMPDGSLMPDGSL  150


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              PL    P ML    M +  L  D   ML +  + + PL    P ML  P + +  L  
Sbjct  3    DGPLVLQGPLMLDGSIMLDGSLVVDGSLMLDDRLILDEPLILNGPLMLDGPLVLDGSLTL  62

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            D   +L EP M N PL  D P +L    M    L  D P ML+ P M + PL
Sbjct  63   DDRLILDEPLMLNGPLMLDWPLVLDGSLMLDDRLTLDEPLMLNSPLMLDGPL  114


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 44/108 (41%), Gaps = 6/108 (6%)
 Frame = +2

Query  182  MLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPT  361
            ML  P +   PL  D   ML    + +  L  +   +L EP + N  L  D P +L    
Sbjct  1    MLDGPLVLQGPLMLDGSIMLDGSLVVDGSLMLDDRLILDEPLILNGPLMLDGPLVLDGSL  60

Query  362  MPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM------LSEPTMPNHPL  487
              +  L  D P ML+ P M   PL  D   M      L EP M N PL
Sbjct  61   TLDDRLILDEPLMLNGPLMLDWPLVLDGSLMLDDRLTLDEPLMLNSPL  108



>ref|WP_001083118.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EIC79947.1| alpha-L-fucosidase [Streptococcus oralis SK10]
Length=1989

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P++ E+P    +P
Sbjct  1685  AQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPETPTQPEKP  1744

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++PA   +P  P  P++ + P    +P  P  P + ++PA   +P  P  P
Sbjct  1745  AQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKP  1804


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 56/120 (47%), Gaps = 4/120 (3%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + ++PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P   ++ ++
Sbjct  1678  PAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPET  1737

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN----GSPEQ  505
             P    +P  P  P + ++PA   +P  P  P++ + P    +P  P  P        PEQ
Sbjct  1738  PTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQ  1797


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/112 (27%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + PA   +PT P  P++ ++P    +P  P  P + E+PA   +P  P   ++ + 
Sbjct  1714  PVQPEKPAQPEKPTQPEKPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEK  1773

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
             P    +P  P  P + ++PA   +P  P  P + + PA   +P   + P  G
Sbjct  1774  PVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPITSSSPEEG  1825


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 48/120 (40%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P++ + PA   +P  P  P + ++P    +P  P  P + E P     P
Sbjct  1679  AQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPETP  1738

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + + PA    P  P  P + + P    +P  P  P + + PA    P  P  P
Sbjct  1739  TQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQP  1798


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/128 (26%), Positives = 52/128 (41%), Gaps = 1/128 (1%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++P    +P  P  P + + P     PT P  P + E PA    P
Sbjct  1697  AQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPVQPETPTQPEKPAQPEKPAQPETP  1756

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + P    +P  P  P + + PA    P  P  P + + P    +P  P  P
Sbjct  1757  AQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKP  1816

Query  485   L-NGSPEQ  505
             + + SPE+
Sbjct  1817  ITSSSPEE  1824


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 0/99 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + ++PA   +P  P  P + E PA   +P  P   ++ + PA   +PT P 
Sbjct  1671  EAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPE  1730

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P++ ++P    +P  P  P + ++PA   +P  P  P+
Sbjct  1731  KPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPV  1769


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 50/125 (40%), Gaps = 0/125 (0%)
 Frame = +2

Query  110   LNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA  289
             +N ++   +  +      + + PA    P  P  P++ + PA   +P  P  P + E+P 
Sbjct  1656  VNKALETALEQISKLEAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPV  1715

Query  290   MLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
                +P  P    + + P     PT P  P + + PA    P  P  P + + P    +P 
Sbjct  1716  QPEKPAQPEKPTQPEKPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPV  1775

Query  470   MPNHP  484
              P  P
Sbjct  1776  QPEKP  1780


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 0/99 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + + PA   +P  P  P++ E PA   +P  P    + + 
Sbjct  1738  PTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQ  1797

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
             PA   +PT P  P + + P   S P      L +  P++
Sbjct  1798  PAEPEKPTQPEKPAQPEKPITSSSPEEGVKDLVFTLPSL  1836



>ref|WP_001083119.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EFE57508.1| Gram-positive signal peptide protein, YSIRK family [Streptococcus 
oralis ATCC 35037]
Length=2031

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P T      P + + PA   +P  P  P + ++PA   +P  P  P + E PA   +P
Sbjct  1733  AQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP  1792

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P + + PA   +PT P  P + ++PA   +P  P  P
Sbjct  1793  AQPEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKP  1852


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + ++PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P    + ++
Sbjct  1678  PAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQPET  1737

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P  P  P + + PA    P  P  P + + PA   +P  P  P
Sbjct  1738  PAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKP  1786


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 6/120 (5%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P + E+PA   +P
Sbjct  1685  AQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQPETPAQPEKP  1744

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P      + PA   +P  P  P + ++PA   +P  P  P + + PA   +P  P  P
Sbjct  1745  AQP------EKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1798


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 6/109 (6%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + PA   +PT P  P + ++PA   +P  P  P + E PA    P  P      ++
Sbjct  1714  PVQPEKPAQPEKPTQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPETPAQP------ET  1767

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P  P  P + + PA   +P  P  P + + PA   +P  P  P
Sbjct  1768  PAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQPEKPAQPETP  1816


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 33/123 (27%), Positives = 52/123 (42%), Gaps = 0/123 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA    P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1745  AQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKP  1804

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++PA   +P  P  P + + PA    P  P  P + + PA   +P   + P
Sbjct  1805  AQPEKPAQPETPAQPEKPAQPEKPTQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSP  1864

Query  485   LNG  493
               G
Sbjct  1865  EEG  1867


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 6/120 (5%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +P  P  P + + PA    P  P  P + E PA   +P
Sbjct  1721  AQPEKPTQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKP  1780

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P      + PA   +P  P  P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  1781  AQP------EKPAQPEKPAQPEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKPTQPEKP  1834


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA    P  P  P + + P    +P  P  P + E PA   +P  P    + ++
Sbjct  1702  PAQPEKPAQPETPVQPEKPAQPEKPTQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPET  1761

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA    P  P  P + + PA   +P  P  P + + PA   +P  P  P
Sbjct  1762  PAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQPEKP  1810


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 49/120 (41%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P       +P + + P    +P  P  P + + PA    P  P  P + E P    +P
Sbjct  1673  AQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPEKP  1732

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P + ++PA    P  P  P + + PA   +P  P  P
Sbjct  1733  AQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETPAQPEKPAQPEKPAQPEKPAQPEKP  1792


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + ++PA   +P  P  P + E PA   +P  P   ++ + PA   +PT P 
Sbjct  1671  EAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPTQPE  1730

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++PA   +P  P  P + + PA    P  P  P
Sbjct  1731  KPAQPETPAQPEKPAQPEKPAQPEKPAQPETPAQPETP  1768


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1769  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAETEKPAQPEKPAQPETPAQPEKPAQPEKP  1828

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
             T P    + ++PA   +P  P  P + + P   S P      L +  P++
Sbjct  1829  TQPEKPAQPETPAQPEKPAEPEKPAQPEKPITSSSPEEGVKDLVFTLPSL  1878



>ref|WP_001083127.1| alpha-L-fucosidase [Streptococcus oralis]
 emb|CBZ00014.1| cell wall surface anchor family protein [Streptococcus oralis 
Uo5]
Length=2064

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P T      P + ++PA   +PT P  P + + PA   +P  P +P + E PA    P 
Sbjct  1767  QPETPAQPEKPTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETPA  1826

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P+  ++ + PA   +P  P  P++ ++PA   +P  P  P + + PA    P  P  P
Sbjct  1827  QPDNPVQPEKPAEPEKPAQPEKPVQPETPAQPEKPVQPETPAQPEKPAQPETPAQPEKP  1885


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + ++P     P  P  P + ++PA   +PT P  P + E PA   +P  P    + + 
Sbjct  1759  PAQPETPTQPETPAQPEKPTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQ  1818

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA    P  P++P++ + PA   +P  P  P++ ++PA   +P  P  P
Sbjct  1819  PAQPETPAQPDNPVQPEKPAEPEKPAQPEKPVQPETPAQPEKPVQPETP  1867


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + ++PA   +P  P  P + + PA   +PT P +P++ E PA    PT P    + + 
Sbjct  1717  PTQPETPAQPEKPAQPEKPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEK  1776

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P     P  P  P + + PA   +P  P  P++ ++P    +P  P  P
Sbjct  1777  PTQPETPAQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETP  1825


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P     PT P +P++ + P    +P  P  P + E+PA   +P  P    + + 
Sbjct  1681  PAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPEKPAQPEK  1740

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +PT P +P++ + PA    PT P  P + + P     P  P  P
Sbjct  1741  PAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETPAQPEKP  1789


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/111 (28%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             +P++ + P    +P  P  P + ++PA   +P  P  P + E PA   +PT P   ++ +
Sbjct  1698  NPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPEKPAQPEKPAQPEKPTQPENPVQPE  1757

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA    PT P  P + + P     P  P  P + + PA   +P  P  P+
Sbjct  1758  KPAQPETPTQPETPAQPEKPTQPETPAQPEKPTQPEKPAEPEKPAQPEKPV  1808


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +PT P +P++ + PA    PT P  P + E P     P
Sbjct  1724  AQPEKPAQPEKPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETP  1783

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P++ ++P    +P  P  P + D+P    +P  P  P
Sbjct  1784  AQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETPAQPDNPVQPEKPAEPEKP  1843


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++P    +P  P  P + ++PA   +PT P  P + E P    +P
Sbjct  1736  AQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETPAQPEKPTQPETPAQPEKPTQPEKP  1795

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + P     PT P  P + ++PA    P  P  P + + PA   +P  P  P
Sbjct  1796  AEPEKPAQPEKPVQPENPTQPEQPAQPETPAQPDNPVQPEKPAEPEKPAQPEKPVQPETP  1855


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 46/98 (47%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + + P     PT P +P++ E P    +P  P    + ++PA   +P  P 
Sbjct  1674  EAAQPEKPAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPE  1733

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + + PA   +PT P +P++ + PA    PT P  P
Sbjct  1734  KPAQPEKPAQPEKPTQPENPVQPEKPAQPETPTQPETP  1771


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 52/114 (46%), Gaps = 0/114 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P +P + + PA    P  P++P++ E PA   +P
Sbjct  1784  AQPEKPTQPEKPAEPEKPAQPEKPVQPENPTQPEQPAQPETPAQPDNPVQPEKPAEPEKP  1843

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
               P   ++ ++PA   +P  P  P + + PA    P  P  P + + P   S P
Sbjct  1844  AQPEKPVQPETPAQPEKPVQPETPAQPEKPAQPETPAQPEKPAQPEKPITSSSP  1897


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 37/81 (46%), Gaps = 0/81 (0%)
 Frame = +2

Query  245   EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             E   P  P + E P     PT P   ++ + P    +P  P  P + ++PA   +P  P 
Sbjct  1674  EAAQPEKPAEPEKPVQPENPTQPENPVQPEKPGQPEKPAQPEKPTQPETPAQPEKPAQPE  1733

Query  425   HPLKYDSPAMLSEPTMPNHPL  487
              P + + PA   +PT P +P+
Sbjct  1734  KPAQPEKPAQPEKPTQPENPV  1754



>ref|WP_001083125.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EID24691.1| alpha-L-fucosidase [Streptococcus oralis SK1074]
Length=1992

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 1/128 (1%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P + E P    +P
Sbjct  1700  AQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKP  1759

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + P    +PT P  P + + P    +P  P +P + ++PA    P  P  P
Sbjct  1760  DQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKP  1819

Query  485   L-NGSPEQ  505
             + + SPE+
Sbjct  1820  ITSSSPEE  1827


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P    + + 
Sbjct  1693  PVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEK  1752

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P    +P  P  P + + P    +PT P  P + + P    +P  P++P
Sbjct  1753  PVQPEKPDQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNP  1801


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 49/109 (45%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P    +P  P  P++ + PA   +P  P  P + E PA   +P  P   ++ + 
Sbjct  1675  PAQPEKPVQPEKPAQPEKPVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEK  1734

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +PT P  P + + P    +P  P  P + + P    +PT P  P
Sbjct  1735  PAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEKPTQPETP  1783


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/112 (26%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + + P    +P  P  P++ E P    +P  P   ++ + 
Sbjct  1717  PAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEK  1776

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
             P     P  P  P + + PA    PT P  P + ++PA   +P   + P  G
Sbjct  1777  PTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKPITSSSPEEG  1828


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/105 (26%), Positives = 44/105 (42%), Gaps = 0/105 (0%)
 Frame = +2

Query  170   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             ++PA   +P  P  P + + P    +P  P  P++ E P    +P  P    + + P   
Sbjct  1673  ETPAQPEKPVQPEKPAQPEKPVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQP  1732

Query  350   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              +P  P  P   + PA   +P  P  P + + PA   +P  P  P
Sbjct  1733  EKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEKP  1777



>ref|WP_001083110.1| MULTISPECIES: alpha-L-fucosidase [Streptococcus]
 gb|EJO20845.1| alpha-L-fucosidase [Streptococcus sp. BS35b]
 gb|ETS90425.1| alpha-L-fucosidase [Streptococcus sp. BS29a]
Length=1998

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 1/128 (1%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P   +    P + + PA   +P  P  P++ + PA   +PT P  P + E P    +P
Sbjct  1706  AQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKP  1765

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + P    +PT P  P + + P    +P  P +P + ++PA    P  P  P
Sbjct  1766  DQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKP  1825

Query  485   L-NGSPEQ  505
             + + SPE+
Sbjct  1826  ITSSSPEE  1833


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 0/118 (0%)
 Frame = +2

Query  131   PITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM  310
             P T +    P + + P    +P  P  P++ + PA   +P  P  P + E PA   +P  
Sbjct  1672  PETPVQPEKPTQPEKPVQPEKPAQPEKPVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQ  1731

Query  311   PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P   ++ + PA   +PT P  P + + P    +P  P  P + + P    +PT P  P
Sbjct  1732  PEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEKPTQPETP  1789


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P    + + 
Sbjct  1699  PVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEK  1758

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P    +P  P  P + + P    +PT P  P + + P    +P  P++P
Sbjct  1759  PVQPEKPDQPEKPAQPEKPVQPEKPTQPETPAQPEKPDQPEKPAQPDNP  1807


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 0/106 (0%)
 Frame = +2

Query  170   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             ++P    +PT P  P++ + PA   +P  P  P + E P    +P  P    + + PA  
Sbjct  1673  ETPVQPEKPTQPEKPVQPEKPAQPEKPVQPEKPAQPEKPIQPEKPDQPEKPAQPEKPAQP  1732

Query  350   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              +P  P  P + + P    +P  P  P++ + P    +P  P  P+
Sbjct  1733  EKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPV  1778


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/112 (26%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + + P    +P  P  P++ E P    +P  P   ++ + 
Sbjct  1723  PAQPEKPAQPEKPVQPEKPAQPEKPTNPEKPAQPEKPVQPEKPDQPEKPAQPEKPVQPEK  1782

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
             P     P  P  P + + PA    PT P  P + ++PA   +P   + P  G
Sbjct  1783  PTQPETPAQPEKPDQPEKPAQPDNPTQPETPAQPETPAQPEKPITSSSPEEG  1834



>ref|WP_042768039.1| alpha-L-fucosidase [Streptococcus sp. DBCMS]
Length=2025

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P++ + P     P  P  P + ++PA   +P  P  P + E+P     P
Sbjct  1727  AQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENP  1786

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P   ++ + PA   +P  P  P + + PA   +PT P  P + + PA   +PT P  P
Sbjct  1787  TQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPAQPEKPTQPETP  1846


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + + PA   +P  P  P + E+PA   +P  P    + + 
Sbjct  1678  PAQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEK  1737

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P    +PT P  P + + P     P  P  P + + PA    PT P +P
Sbjct  1738  PVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENP  1786


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + + PA    P  P  P + E PA   +P
Sbjct  1679  AQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKP  1738

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++PA   +PT P  P + + PA   +P  P +P + ++P    +P  P  P
Sbjct  1739  VQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKP  1798


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 6/120 (5%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P T      P + + PA   +P  P  P + ++PA   +PT P  P + E PA   +P
Sbjct  1715  AQPETPAQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKP  1774

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P      ++P     PT P  P++ + PA   +P  P  P + + PA   +PT P  P
Sbjct  1775  AQP------ENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKP  1828


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA    P  P  P + + PA   +P  P  P + E+PA   +P
Sbjct  1697  AQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKP  1756

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + + PA   +P  P +P + ++P    +P  P  P + + PA    P  P  P
Sbjct  1757  TQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQP  1816


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + ++PA   +P  P  P + E P    +P
Sbjct  1685  AQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKPVQPEKP  1744

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + + P     P  P  P + + PA    PT P +P + + P    +P  P  P
Sbjct  1745  TQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKP  1804


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/125 (26%), Positives = 55/125 (44%), Gaps = 0/125 (0%)
 Frame = +2

Query  110   LNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA  289
             +N ++   +  +      + + PA   +P  P  P + + PA   +P  P  P + E PA
Sbjct  1656  VNKALETALEQISKLEAAQPEKPAQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPA  1715

Query  290   MLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
                 P  P    + + PA   +P  P  P + ++PA   +PT P  P + + PA   +P 
Sbjct  1716  QPETPAQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPA  1775

Query  470   MPNHP  484
              P +P
Sbjct  1776  QPENP  1780


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/128 (27%), Positives = 56/128 (44%), Gaps = 1/128 (1%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P   +    P + ++PA   +PT P  P + + PA   +P  P +P + E+P    +P
Sbjct  1733  AEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKP  1792

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    P  P  P + + P    +P  P  P + + P     P  P  P
Sbjct  1793  VQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPAQPEKPTQPETPAQPEKP  1852

Query  485   L-NGSPEQ  505
             + + SPE+
Sbjct  1853  ITSSSPEE  1860


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 52/121 (43%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1673  AQPEKPAQPEKPAQPEKPAQPEQPAQPEQPAQPEQPAQPEQPAQPETPAQPEKPAQPEKP  1732

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P   ++ + P     P  P  P + ++PA   +P  P  P + ++P     PT P  P
Sbjct  1733  AEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKP  1792

Query  485   L  487
             +
Sbjct  1793  V  1793


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +P  P  P + + P    +PT P  P + E P     P
Sbjct  1703  AQPEQPAQPEQPAQPETPAQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETP  1762

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    PT P +P + + P    +P  P  P + ++PA   +P  P  P
Sbjct  1763  AQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKP  1822


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 49/120 (41%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + P    +PT P  P + + P     P  P  P + E PA    P
Sbjct  1721  AQPEKPAQPEKPAEPEKPVQPEKPTQPETPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1780

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + + P    +P  P  P + ++PA   +P  P  P + + PA   +P  P  P
Sbjct  1781  TQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKPTQPEKPAQPEKPAQPEKP  1840


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/112 (27%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P     P  P  P + + PA    PT P +P + E P    +P  P    + ++
Sbjct  1750  PAQPEKPTQPETPAQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPET  1809

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
             PA   +P  P  P + + PA   +P  P  P + ++PA   +P   + P  G
Sbjct  1810  PAQPEQPAEPEKPTQPEKPAQPEKPAQPEKPTQPETPAQPEKPITSSSPEEG  1861


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (44%), Gaps = 0/110 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++P     PT P  P++ + PA   +P  P  P + E PA   +P
Sbjct  1763  AQPEKPAEPEKPAQPENPTQPENPTQPEKPVQPEKPAQPEKPAQPETPAQPEQPAEPEKP  1822

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
             T P    + + PA   +PT P  P + + P   S P      L +  P++
Sbjct  1823  TQPEKPAQPEKPAQPEKPTQPETPAQPEKPITSSSPEEGVKDLVFTLPSL  1872



>ref|WP_003144797.1| gram-positive signal peptide, ysirk family [Gemella haemolysans]
 gb|EER68201.1| Gram-positive signal peptide protein, YSIRK family [Gemella haemolysans 
ATCC 10379]
Length=3204

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3048  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNK  3107

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3108  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3157


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3000  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNK  3059

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3060  PVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPV  3109


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3006  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNK  3065

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3066  PVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPV  3115


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3024  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNK  3083

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3084  PMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3133


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3042  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNK  3101

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3102  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3151


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  2994  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNK  3053

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++   P   ++P  PN P+
Sbjct  3054  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPV  3103


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3012  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNK  3071

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++   P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3072  PVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3121


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++   
Sbjct  3030  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTK  3089

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3090  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3139


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = +2

Query  170   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + P   
Sbjct  2992  NKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEP  3051

Query  350   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3052  NKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPV  3097


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3018  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNK  3077

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  P  P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3078  PVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3127


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  P   ++ + 
Sbjct  3036  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNK  3095

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3096  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 59/110 (54%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  P  P++   P   ++P  PN  ++ + 
Sbjct  3054  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNK  3113

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3114  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPV  3163


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 58/110 (53%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++ + P   ++P  PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + 
Sbjct  3060  PVEPNKPVEPNKPVEPNKPVEPNKPMEPTKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNK  3119

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  PN P++ + P   ++P  P+ P++ + P   ++P  P   L
Sbjct  3120  PVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPTKRL  3169


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             PN P++ + P   ++P  PN P++   P   ++P  PN  ++ + P   ++P  PN P++
Sbjct  2991  PNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPVE  3050

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              + P   ++P  P+ P++ + P   ++P  PN P+
Sbjct  3051  PNKPVEPNKPVEPNKPVEPNKPVEPNKPVEPNKPM  3085



>ref|WP_040443091.1| hypothetical protein, partial [Facklamia ignava]
Length=148

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 42/111 (38%), Gaps = 0/111 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P   D P    +P MP+ P   D P    EP  P+ P   + P M  EP  P+     
Sbjct  26   DEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTPDKPGMPDEPGTPDEQGTP  85

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            D P    EP  P+     D P    EP  P  P   D P    EP  P+ P
Sbjct  86   DEPGTPDEPGTPDESGTPDEPGTPDEPGTPDEPGTPDEPGTPDEPGTPDEP  136


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 46/118 (39%), Gaps = 2/118 (2%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P   D P    EP  P+ P   D P    +P MP+ P   + P    EP  P+     
Sbjct  8    DEPGTPDEPGTPDEPGTPDEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTP  67

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
            D P M  EP  P+     D P    EP  P      D P    EP  P+ P  G+P++
Sbjct  68   DKPGMPDEPGTPDEQGTPDEPGTPDEPGTPDESGTPDEPGTPDEPGTPDEP--GTPDE  123


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 45/111 (41%), Gaps = 8/111 (7%)
 Frame = +2

Query  173  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  352
             P +  EP  P+ P   D P    EP  P+ P   + P M  EP  P      D P    
Sbjct  3    DPEIRDEPGTPDEPGTPDEPGTPDEPGTPDEPDTPDKPGMPDEPGTP------DEPGTPD  56

Query  353  EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
            EP  P+ P   D P M  EP  P      D P    EP  P+   +G+P++
Sbjct  57   EPGTPDEPGTPDKPGMPDEPGTPDEQGTPDEPGTPDEPGTPDE--SGTPDE  105


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 45/118 (38%), Gaps = 2/118 (2%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P   D P    EP  P+ P   D P    EP  P+ P   + P    +P MP+     
Sbjct  20   DEPGTPDEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGTPDKPGMPDEPGTP  79

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
            D      EP  P+ P   D      EP  P  P   D P    EP  P+ P  G+P++
Sbjct  80   DEQGTPDEPGTPDEPGTPDESGTPDEPGTPDEPGTPDEPGTPDEPGTPDEP--GTPDE  135


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 44/113 (39%), Gaps = 2/113 (2%)
 Frame = +2

Query  167  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  346
             D P    EP  P+ P   D P    EP  P+ P   + P    EP  P+     D P  
Sbjct  7    RDEPGTPDEPGTPDEPGTPDEPGTPDEPDTPDKPGMPDEPGTPDEPGTPDEPGTPDEPGT  66

Query  347  LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
              +P MP+ P   D      EP  P  P   D      EP  P+ P  G+P++
Sbjct  67   PDKPGMPDEPGTPDEQGTPDEPGTPDEPGTPDESGTPDEPGTPDEP--GTPDE  117



>ref|WP_035430318.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=233

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 45/111 (41%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P   D P   S+PT P  P     P   SEPT P  P     P   SEPT P       
Sbjct  4    EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPG  63

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   SEPT P  P     P   SEPT P  P     PA  SEPT P  P+
Sbjct  64   KPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPI  114


 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 44/110 (40%), Gaps = 0/110 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P     P   SEPT P  P     P   SEPT P  P     P   SEPT P      
Sbjct  21   EEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTP  80

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
              P   SEPT P  P     PA  SEPT P  P+    PA  SEPT P  
Sbjct  81   GKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPIIPGKPAQPSEPTKPEE  130


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 44/100 (44%), Gaps = 0/100 (0%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EPT P+ P +   P    EPT P  P++   P    EPT P   ++   P    EPT P 
Sbjct  4    EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPAKPVQPSEPTKPEEPTTPG  63

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             P++   P    EPT P  P++   P    EPT P  P  
Sbjct  64   KPVQPSEPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQ  103



>ref|WP_001083112.1| hypothetical protein, partial [Streptococcus oralis]
 gb|EJP21625.1| alpha-L-fucosidase, partial [Streptococcus oralis SK304]
Length=1883

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + + PA    P  P  P++ E PA   +P  P    + + 
Sbjct  1768  PAEPEKPAQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEK  1827

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P  P  P + ++PA   +P  P  P + ++PA   +P  P  P
Sbjct  1828  PAQPEKPAQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKP  1876


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P + ++P    +P  P  P + E PA   +P  P    + + 
Sbjct  1774  PAQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEK  1833

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA   +PT P  P + + PA   +P  P  P + + PA   +P  P  P+
Sbjct  1834  PAQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPV  1883


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 43/98 (44%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  P  P + + PA   +P  P  P + E+P    +P  P    + + PA   +P  P 
Sbjct  1671  EPAQPEKPAESEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAQPEKPAQPE  1730

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + + PA   +P  P  P + ++P    +P  P  P
Sbjct  1731  KPAQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKP  1768


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/108 (27%), Positives = 49/108 (45%), Gaps = 0/108 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA    P  P  P++ + PA   +P  P  P + E PA   +P
Sbjct  1775  AQPEKPAQPEKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKP  1834

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  448
               P    + ++PA   +P  P  P + ++PA   +P  P  P + ++P
Sbjct  1835  AQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETP  1882



>ref|WP_025267364.1| hypothetical protein [Bibersteinia trehalosi]
 gb|AHG82529.1| hypothetical protein F542_18140 [Bibersteinia trehalosi USDA-ARS-USMARC-188]
 gb|AHG84863.1| hypothetical protein F543_20020 [Bibersteinia trehalosi USDA-ARS-USMARC-189]
Length=2364

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 45/103 (44%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   P   SE
Sbjct  434  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  493

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P  P+ P +   P   SEP  PS P +   P   +EP  P  P
Sbjct  494  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTEPEQPTEP  536


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 49/115 (43%), Gaps = 3/115 (3%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P +   P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  434  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  493

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPE  502
            P   SEP  P+ P +   P   SEP  PS P   + P    +PT P   +N   E
Sbjct  494  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEP---EQPTEPEQPTEPQLTINAITE  545


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 47/106 (44%), Gaps = 7/106 (7%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EP  P+ P +   P   SEP  P+ P +   P   SEP  P+       P   SEP  P+
Sbjct  421  EPEQPSEPEQPVEPEQPSEPEQPSEPEQPSEPEQPSEPEQPS------EPEQPSEPEQPS  474

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS-PEQ  505
             P +   P   SEP  PS P +   P   SEP  P+ P   S PEQ
Sbjct  475  EPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQ  520


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 6/106 (6%)
 Frame = +2

Query  167  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  346
            YD P    +P+ P  P   + P    +PT P  P + E P    +P+ P      + P  
Sbjct  176  YDQPIEPEQPSEPEQPTAPEQPTAPEQPTAPEQPTEPEQPTAPEQPSEP------EQPTE  229

Query  347  LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              +P  P  P + + P+   +PT P  P + + P+   +PT P  P
Sbjct  230  PEQPVEPEQPSEPEQPSEPEQPTEPEQPSEPEQPSEPEQPTEPEQP  275


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/133 (28%), Positives = 56/133 (42%), Gaps = 16/133 (12%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLS------------  298
             P++ + P+   +P+ P  P + + P+   +P+ P  P + E P +              
Sbjct  232  QPVEPEQPSEPEQPSEPEQPTEPEQPSEPEQPSEPEQPTEPEQPTVPEQPPEPEQPSEPE  291

Query  299  ---EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
               EP  P+   +  +P   SEP  P  P +   P   SEP  PS P +   P   SEP 
Sbjct  292  QPIEPEQPSEPERPTAPEQPSEPEQPTEPEQPVEPEQPSEPEQPSEPEQPSEPEQPSEPE  351

Query  470  MPNHPLNGS-PEQ  505
             P+ P   S PEQ
Sbjct  352  QPSEPEQPSEPEQ  364


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 57/133 (43%), Gaps = 16/133 (12%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P   + P+   +PT P  P++ + P+   +P+ P  P + E P+   +P+ P    + +
Sbjct  214  QPTAPEQPSEPEQPTEPEQPVEPEQPSEPEQPSEPEQPTEPEQPSEPEQPSEPEQPTEPE  273

Query  335  SPAMLS---------------EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
             P +                 EP  P+ P +  +P   SEP  P+ P +   P   SEP 
Sbjct  274  QPTVPEQPPEPEQPSEPEQPIEPEQPSEPERPTAPEQPSEPEQPTEPEQPVEPEQPSEPE  333

Query  470  MPNHPLNGS-PEQ  505
             P+ P   S PEQ
Sbjct  334  QPSEPEQPSEPEQ  346


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/125 (25%), Positives = 51/125 (41%), Gaps = 15/125 (12%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P   + P    +PT P  P   + P+   +PT P  P++ E P+   +P+ P    + +
Sbjct  196  QPTAPEQPTAPEQPTEPEQPTAPEQPSEPEQPTEPEQPVEPEQPSEPEQPSEPEQPTEPE  255

Query  335  SPAMLSEPTMPNHPLKYDSPAMLS---------------EPTMPSHPLKYDSPAMLSEPT  469
             P+   +P+ P  P + + P +                 EP  PS P +  +P   SEP 
Sbjct  256  QPSEPEQPSEPEQPTEPEQPTVPEQPPEPEQPSEPEQPIEPEQPSEPERPTAPEQPSEPE  315

Query  470  MPNHP  484
             P  P
Sbjct  316  QPTEP  320


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 52/135 (39%), Gaps = 20/135 (15%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P + + P    +PT P  P   + P    +PT P  P + E P    +P  P    + +
Sbjct  184  QPSEPEQPTAPEQPTAPEQPTAPEQPTEPEQPTAPEQPSEPEQPTEPEQPVEPEQPSEPE  243

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHP------------------LKYDSPAMLS  460
             P+   +PT P  P + + P+   +PT P  P                  ++ + P+   
Sbjct  244  QPSEPEQPTEPEQPSEPEQPSEPEQPTEPEQPTVPEQPPEPEQPSEPEQPIEPEQPSEPE  303

Query  461  EPTMPNHPLNGSPEQ  505
             PT P  P    PEQ
Sbjct  304  RPTAPEQP--SEPEQ  316



>ref|WP_001083113.1| alpha-L-fucosidase [Streptococcus mitis]
 gb|EGU68650.1| Gram-positive signal peptide protein, YSIRK family [Streptococcus 
mitis bv. 2 str. SK95]
Length=2132

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P       +P + + PA   +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1696  AEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1755

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + + PA   +P  P +P + ++PA   +P  P +P + + PA    P  P  P
Sbjct  1756  TQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKP  1815


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 49/119 (41%), Gaps = 0/119 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P T      P + + PA    PT P  P + + PA   +P  P  P + E PA   +P 
Sbjct  1685  QPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPA  1744

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P    + + P     P  P  P + + PA    P  P +P + + PA    PT P  P
Sbjct  1745  QPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1803


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P       +P + + PA    PT P  P + ++PA   +P  P  P++ E+P    +P
Sbjct  1774  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1833

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P   ++ + PA   +P  P  P + + PA   +P  P  P   + PA+  +P +P +P
Sbjct  1834  AEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENP  1893


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P T      P + + PA    P  P +P + + PA    PT P  P + E+PA   +P 
Sbjct  1757  QPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPA  1816

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P   ++ ++P    +P  P  P++ + PA   +P  P  P + + PA   +P  P  P
Sbjct  1817  EPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKP  1875


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 51/109 (47%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P    +PT P  P + + PA   +P  P +P + E PA   +P  P    + + 
Sbjct  1671  PAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEK  1730

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P  P  P + + PA   +PT P  P + + PA   +P  P +P
Sbjct  1731  PAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1779


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P    +P  P  P + + PA+  +P +P  P   E+PA    P  P      + 
Sbjct  1851  PAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEK  1910

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL-NGSPEQ  505
             PA+  +P  P  P + + PA L +P  P  P + + PA   +P +P  P+ + SPE+
Sbjct  1911  PAVPEKPAEPEKPAEPEKPAELEKPAQPEKPAQPEKPAQPEKPAVPEKPITSSSPEE  1967


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + + PA   +P  P  P + E P     P
Sbjct  1702  AQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETP  1761

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    P  P +P + + PA    PT P  P + ++PA   +P  P  P
Sbjct  1762  AQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKP  1821

Query  485   L  487
             +
Sbjct  1822  V  1822


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P   +    P + ++PA   +P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1672  AEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKP  1731

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P + ++PA   +P  P  P + ++PA    P  P  P
Sbjct  1732  AQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKP  1791


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA    P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1762  AQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKP  1821

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P   ++ + PA   +P  P  P + + PA   +PT P  P + + PA   +P +P  P
Sbjct  1822  VQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKP  1881


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +P  P  P + ++PA    P  P  P + E+P    +P
Sbjct  1744  AQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1803

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P++ + PA   +P  P  P + + PA   +PT P  P
Sbjct  1804  AQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKP  1863


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 52/109 (48%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + PA   +P  P  P++ + PA   +P  P  P + E PA   +PT P    + + 
Sbjct  1809  PAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEK  1868

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +P +P  P   + PA+   P  P +P   ++PA   +P +P  P
Sbjct  1869  PAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKP  1917


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + + PA   +PT P  P + E PA   +P
Sbjct  1714  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKP  1773

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++PA   +P  P +P + + PA    P  P  P + + P     P  P  P
Sbjct  1774  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1833


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 48/120 (40%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P++ + P     P  P  P + + PA    PT P  P + E PA   +P
Sbjct  1666  AQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKP  1725

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P + + P     P  P  P + + PA    P  P +P
Sbjct  1726  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENP  1785


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + + P     P  P  P + E PA    P
Sbjct  1720  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1779

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    PT P  P + ++PA   +P  P  P++ ++P    +P  P  P
Sbjct  1780  AQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKP  1839

Query  485   L  487
             +
Sbjct  1840  V  1840


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++P    +P  P  P + + PA   +P  P  P++ E PA   +P
Sbjct  1780  AQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKP  1839

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +PT P  P + + PA   +P +P  P   + PA+   P  P +P
Sbjct  1840  VQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENP  1899


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + P     P  P  P + + PA    P  P +P + E PA    P
Sbjct  1738  AQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENP  1797

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + ++PA   +P  P  P++ ++P    +P  P  P++ + PA   +P  P  P
Sbjct  1798  TQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKP  1857


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + ++PA   +P  P  P + E+PA    P
Sbjct  1726  AQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENP  1785

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++P    +P  P  P + + PA   +P  P  P++ + PA   +P  P  P
Sbjct  1786  AQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKP  1845


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +P  P  P++ ++P    +P  P  P++ E PA   +P
Sbjct  1792  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1851

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P   + PA+  +P +P +P   ++PA    P  P  P
Sbjct  1852  AEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKP  1911


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++P    +P  P  P + + PA   +P  P  P + E PA   +P
Sbjct  1690  AQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKP  1749

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++PA   +P  P  P + ++PA    P  P  P + ++P    +P  P  P
Sbjct  1750  AQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETP  1809


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 32/119 (27%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P T +    P + + P    +P  P  P + + P    +P  P  P + E PA+  +P 
Sbjct  1823  QPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPA  1882

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +P      ++PA    P  P +P   + PA+  +P  P  P + + PA L +P  P  P
Sbjct  1883  VPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAELEKPAQPEKP  1941


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +PT P  P + + PA   +P  P +P + E+PA   +P
Sbjct  1732  AQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKP  1791

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    P  P  P + + P     P  P  P + + P    +P  P  P
Sbjct  1792  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1851


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P++ ++P    +P  P  P++ + PA   +P  P  P + E PA   +P
Sbjct  1810  AQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKPAQPEKP  1869

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P      + PA+  +P +P +P   ++PA    P  P  P   + PA   +P  P  P
Sbjct  1870  AQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKP  1929


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P T      P + + P     P  P  P + + P    +P  P  P + E P    +P
Sbjct  1804  AQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPEKPTQPEKP  1863

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA+  +P +P  P   ++PA    P  P +P   + PA+  +P  P  P
Sbjct  1864  AQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKP  1923


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 43/98 (44%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + + P    +PT P  P + E PA   +P  P    + + PA   +P  P 
Sbjct  1664  EAAQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPE  1723

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  1724  KPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETP  1761


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 49/120 (41%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P       +P + + PA    P  P  P + + P     P  P  P + E P    +P
Sbjct  1786  AQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKP  1845

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + P    +P  P  P + + PA+  +P +P  P   ++PA    P  P +P
Sbjct  1846  AEPEKPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENP  1905


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 31/108 (29%), Positives = 47/108 (44%), Gaps = 6/108 (6%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P   + PA+  +P +P +P   ++PA    P  P  P   E PA   +P
Sbjct  1864  AQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKP  1923

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  448
               P      + PA L +P  P  P + + PA   +P +P  P+   SP
Sbjct  1924  AEP------EKPAELEKPAQPEKPAQPEKPAQPEKPAVPEKPITSSSP  1965



>ref|WP_038804553.1| alpha-L-fucosidase [Streptococcus dentisani]
Length=2117

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P T      P + + PA    PT P  P + + PA   +P  P  P + E P     P 
Sbjct  1685  QPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPA  1744

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P    + + PA    P  P +P + + PA    PT P  P + ++PA   +P  P  P+
Sbjct  1745  QPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPV  1804


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P    +PT P  P + + PA   +P  P +P + E PA   +P  P    + + 
Sbjct  1671  PAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEK  1730

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA   +PT P  P + + PA   +P  P +P + ++PA   +P  P +P
Sbjct  1731  PAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENP  1779


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 48/120 (40%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P++ + P     P  P  P + + PA    PT P  P + E PA   +P
Sbjct  1666  AQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKP  1725

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + P     P  P  P + + PA    P  P +P + + PA    PT P  P
Sbjct  1726  AQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1785


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA   +P  P  P + ++PA    P  P  P + E+P    +P
Sbjct  1726  AQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKP  1785

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA   +P  P  P++ + PA   +P  P  P + + PA  +EP  P  P
Sbjct  1786  AQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQP  1845


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P T      P + + PA    P  P +P + + PA    PT P  P + E+PA   +P 
Sbjct  1739  QPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPA  1798

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P   ++ ++P    +P  P  P++ + PA   +P  P+ P K   P   ++P  P  P
Sbjct  1799  EPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQP  1857


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P+       P K   PA   +PT P  P + + PA   +P +P  P   E PA+   P 
Sbjct  1820  KPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPA  1879

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P      ++PA   +P +P  P + + PA   +P +P  P + + PA   +P  P  P
Sbjct  1880  HPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAVPEKPAQPEKPAQPEKPAQPEKP  1938


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P       +P + + PA   +P  P  P + + PA   +PT P  P + E PA   +P
Sbjct  1696  AEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKP  1755

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++PA   +P  P +P + + PA    P  P  P + + P     P  P  P
Sbjct  1756  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1815


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 56/117 (48%), Gaps = 1/117 (1%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P    +P  P  P + + PA+  +P +P  P   E+PA    P  P      + 
Sbjct  1836  PAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEK  1895

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL-NGSPEQ  505
             PA+  +P  P  P + + PA+  +P  P  P + + PA   +P +P  P+ + SPE+
Sbjct  1896  PAVPEKPAEPEKPAEPEKPAVPEKPAQPEKPAQPEKPAQPEKPAVPEKPITSSSPEE  1952


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +P  P  P + + P     P  P  P + E PA    P
Sbjct  1702  AQPENPTQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1761

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    PT P  P + ++PA   +P  P  P++ ++P    +P  P  P
Sbjct  1762  AQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKP  1821

Query  485   L  487
             +
Sbjct  1822  V  1822


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P   +    P + ++PA   +P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1672  AEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPEKPAQPEKP  1731

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + ++PA   +P  P  P + ++PA    P  P  P + ++P    +P  P  P
Sbjct  1732  AQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETP  1791


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + P     P  P  P + + PA    P  P +P + E PA    P
Sbjct  1720  AQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENP  1779

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    + ++PA   +P  P  P++ ++P    +P  P  P++ + PA   +P  P  P
Sbjct  1780  TQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEP  1839


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/123 (28%), Positives = 58/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P       +P + + PA    PT P  P + ++PA   +P  P  P++ E+P    +P
Sbjct  1756  AQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKP  1815

Query  305   TMPNYHLKYDSPA---MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
               P   ++ + PA     +EP  P  P + + PA   +P  P  P   + PA+  +P +P
Sbjct  1816  AEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVP  1875

Query  476   NHP  484
              +P
Sbjct  1876  ENP  1878


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/120 (27%), Positives = 50/120 (42%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + + PA   +PT P  P + + PA   +P  P +P + E+PA   +P
Sbjct  1714  AQPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENPAQPENPAQPEKP  1773

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + PA    P  P  P + + P     P  P  P + + P    +P  P  P
Sbjct  1774  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1833


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P + ++PA    P  P  P + ++P    +P  P  P + E PA   +P
Sbjct  1744  AQPEKPAEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKP  1803

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P   ++ + PA   +P  P  P + + PA  +EP  P+ P K   P   ++P  P  P
Sbjct  1804  VQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVP  1863


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 57/123 (46%), Gaps = 3/123 (2%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEP---TMPNHPLKYESPAML  295
             A P   +    P++ + PA   +P  P  P + + PA  +EP   T P  P + E PA  
Sbjct  1798  AEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQP  1857

Query  296   SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              +P +P      + PA+   P  P +P   ++PA   +P +P  P + + PA   +P +P
Sbjct  1858  EKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAVP  1917

Query  476   NHP  484
               P
Sbjct  1918  EKP  1920


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 0/118 (0%)
 Frame = +2

Query  131   PITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM  310
             P+       P K   P   +EP  P  P + + P    +P  P  P + E PA+  +P +
Sbjct  1809  PVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAV  1868

Query  311   PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P      ++PA    P  P +P   + PA+  +P  P  P + + PA+  +P  P  P
Sbjct  1869  PEKPAVPENPAHPENPAHPENPAHPEKPAVPEKPAEPEKPAEPEKPAVPEKPAQPEKP  1926


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/123 (27%), Positives = 56/123 (46%), Gaps = 3/123 (2%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA---ML  295
             A+P        P + ++PA   +P  P  P++ ++P    +P  P  P++ E PA     
Sbjct  1774  AQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKP  1833

Query  296   SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             +EP  P    + + PA   +P  P  P   + PA+  +P +P +P   ++PA    P  P
Sbjct  1834  AEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHP  1893

Query  476   NHP  484
               P
Sbjct  1894  EKP  1896


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 44/98 (45%), Gaps = 0/98 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + + P    +PT P  P + E PA   +P  P    + + PA   +P  P 
Sbjct  1664  EAAQPEKPAEPEKPVQPEKPTQPETPAQPEQPAEPEKPAQPENPTQPEKPAQPEKPAQPE  1723

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + + PA   +PT P  P + + PA   +P  P +P
Sbjct  1724  KPAQPEKPAQPEKPTQPETPAQPEKPAEPEKPAQPENP  1761


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 32/112 (29%), Positives = 53/112 (47%), Gaps = 3/112 (3%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLS---EPTMPNYHLK  328
             P + + PA   +P  P  P++ + PA   +P  P  P + E PA  +   +PT P    +
Sbjct  1791  PAQPEKPAEPEKPVQPETPVQPEKPAEPEKPVQPEKPAEPEKPAEPAEPEKPTQPEKPAQ  1850

Query  329   YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              + PA   +P +P  P   + PA+   P  P +P   ++PA   +P +P  P
Sbjct  1851  PEKPAQPEKPAVPEKPAVPEKPAVPENPAHPENPAHPENPAHPEKPAVPEKP  1902


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/120 (28%), Positives = 50/120 (42%), Gaps = 3/120 (3%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P       +P + ++PA   +P  P +P + + PA    P  P  P + E P     P
Sbjct  1750  AEPEKPAQPENPAQPENPAQPEKPAQPENPTQPEKPAQPETPAQPEKPAEPEKPVQPETP  1809

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               P    + + P    +P  P  P K   PA   +PT P  P + + PA   +P +P  P
Sbjct  1810  VQPEKPAEPEKPV---QPEKPAEPEKPAEPAEPEKPTQPEKPAQPEKPAQPEKPAVPEKP  1866



>ref|XP_003647604.1| hypothetical protein Ecym_6415 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET40787.1| hypothetical protein Ecym_6415 [Eremothecium cymbalariae DBVPG#7215]
Length=1208

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  PIALPENHTSKDDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLASSAPIALQE  282
            P+A P+  T K++L    P+A P+  T K++L    P+A P+  T  + L    P+A  +
Sbjct  646  PVATPKKDTPKEELKEVTPVAAPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATPK  705

Query  281  IHTLKDDLASSAPIALPENHTLKDDLASSAPIA  183
              T K++L    P+A P+  T K++L    P+A
Sbjct  706  KDTPKEELKEVTPVATPKKDTPKEELKEVTPVA  738


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = -2

Query  485  KDDLASSAPIALPENHTSKDDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLAS  306
            K++L    P+A P+  T K++L    P+A P+  T K++L    P+A P+  T  + L  
Sbjct  656  KEELKEVTPVAAPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATPKKDTPKEELKE  715

Query  305  SAPIALQEIHTLKDDLASSAPIALPENH  222
              P+A  +  T K++L    P+A P+  
Sbjct  716  VTPVATPKKDTPKEELKEVTPVATPKKE  743


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 58/126 (46%), Gaps = 4/126 (3%)
 Frame = -2

Query  533  TPFHHAINFTAPVIRLKDDLASSAPIALPENHTSKDDLASS-APIALPENHTLKDDLASS  357
            TP         PV+  + +   + P   P+  T K++      P+A P+  T K++L   
Sbjct  606  TPVATPKKEVTPVVTPRKE---ATPEFTPKQDTPKEEPKKEVTPVATPKKDTPKEELKEV  662

Query  356  APIALPENHTSNDNLASSAPIALQEIHTLKDDLASSAPIALPENHTLKDDLASSAPIALQ  177
             P+A P+  T  + L    P+A  +  T K++L    P+A P+  T K++L    P+A  
Sbjct  663  TPVAAPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATPKKDTPKEELKEVTPVATP  722

Query  176  ENHTLK  159
            +  T K
Sbjct  723  KKDTPK  728



>gb|KFY75885.1| hypothetical protein V498_09857 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=1797

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 47/111 (42%), Gaps = 12/111 (11%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPL------KYESPAMLSEPTMP  313
               P K + P ++  P     P+K ++PA + EPT  + P       K E PA + EPT  
Sbjct  1503  EEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPAAVEEPT--  1560

Query  314   NYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
                 K D PA   E T    P      A + EP     P K + PA + EP
Sbjct  1561  ----KVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPATVEEP  1607


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +2

Query  164   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
             K +  A + EPT    P+  ++PA + EP     P   E P  + EP       K + PA
Sbjct  1495  KVEEAAAVEEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPA  1554

Query  344   MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              + EPT  + P   +    + EP       K + P  + EPT    P  
Sbjct  1555  AVEEPTKVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPAT  1603



>ref|WP_036967957.1| ribonuclease [Pseudoalteromonas lipolytica]
 gb|EWH06976.1| ribonuclease [Pseudoalteromonas lipolytica SCSIO 04301]
Length=1047

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 42/106 (40%), Gaps = 0/106 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            D P    EP     P+K + P    EP     P+K E P    EP      ++ + P + 
Sbjct  861  DEPVKAEEPVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEPVQAEEPVQAEEPVIT  920

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             EP   + P+K + P    EP     P+K D P    EP     P+
Sbjct  921  EEPVKADEPVKAEEPVQAEEPVKAEEPVKADEPVKAEEPVKAEEPV  966


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 43/103 (42%), Gaps = 0/103 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P++ + P    EP   + P+K + P    EP     P++ E P    EP +    +K D 
Sbjct  869  PVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEPVQAEEPVQAEEPVITEEPVKADE  928

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
            P    EP     P+K + P    EP     P+K + P    EP
Sbjct  929  PVKAEEPVQAEEPVKAEEPVKADEPVKAEEPVKAEEPVKADEP  971


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 44/111 (40%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P++    A   EP     P++ + P    EP   + P+K E P    EP      ++ +
Sbjct  850  QPVEAPESANTDEPVKAEEPVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEPVQAE  909

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P    EP +   P+K D P    EP     P+K + P    EP     P+
Sbjct  910  EPVQAEEPVITEEPVKADEPVKAEEPVQAEEPVKAEEPVKADEPVKAEEPV  960


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 37/103 (36%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  358
            A   +P         D P    EP     P+K E P    EP      +K + P    EP
Sbjct  846  AQTEQPVEAPESANTDEPVKAEEPVQAEEPVKTEEPVQADEPVKAEEPVKAEEPVQSEEP  905

Query  359  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
                 P++ + P +  EP     P+K + P    EP     P+
Sbjct  906  VQAEEPVQAEEPVITEEPVKADEPVKAEEPVQAEEPVKAEEPV  948



>gb|KFY54418.1| hypothetical protein V496_07262 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=1797

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 47/111 (42%), Gaps = 12/111 (11%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPL------KYESPAMLSEPTMP  313
               P K + P ++  P     P+K ++PA + EPT  + P       K E PA + EPT  
Sbjct  1503  EEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPAAVEEPT--  1560

Query  314   NYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
                 K D PA   E T    P      A + EP     P K + PA + EP
Sbjct  1561  ----KVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPATVEEP  1607


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +2

Query  164   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
             K +  A + EPT    P+  ++PA + EP     P   E P  + EP       K + PA
Sbjct  1495  KVEEAAAVEEPTKVEEPVVVEAPAAVEEPIKVEAPAAVEEPTKVDEPAAAEESTKVEEPA  1554

Query  344   MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              + EPT  + P   +    + EP       K + P  + EPT    P  
Sbjct  1555  AVEEPTKVDEPAATEESTKVEEPAAVVESAKVEEPVTVEEPTKVEEPAT  1603



>gb|AHA42334.1| neurofilament triplet H1 protein [Andrias davidianus ranavirus]
Length=195

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 42/114 (37%), Gaps = 0/114 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P   + P+K  SP   S P     P+K  SP     P   +  +K
Sbjct  71   KRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVK  130

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP   S P     P+K  SP     P   S P+K  SP   S P     P  
Sbjct  131  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPAK  184


 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 42/107 (39%), Gaps = 0/107 (0%)
 Frame = +2

Query  143  MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
            +    P+K  SP     P   + P+K  SP   S P     P+K  SP     P   +  
Sbjct  81   VKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSP  140

Query  323  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            +K  SP   S P     P+K  SP     P   S P+K  SPA   +
Sbjct  141  VKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPAKRRQ  187


 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 44/116 (38%), Gaps = 6/116 (5%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
            N  P    SP   S P     P+K  SP     P   + P+K +SP   S P      +K
Sbjct  65   NRKPPVKRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSP------VK  118

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
              SP   S P     P+K  SP     P   S P+K  SP   S P     P+  S
Sbjct  119  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKS  174



>ref|XP_808638.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN86787.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=469

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  4    DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  63

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  64   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  114


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  10   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  69

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  70   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  120


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  16   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  75

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  76   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  126


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  22   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  81

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  82   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  132


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  28   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  87

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  88   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  138


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  34   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  93

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  94   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  144


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  40   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  99

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  100  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  150


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  46   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  105

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  106  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  156


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  52   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  111

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  112  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  162


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  58   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  117

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  118  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  168


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  64   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  123

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  124  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  174


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  70   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  129

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  130  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  180


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  76   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  135

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  136  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  186


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  82   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  141

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  142  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  192


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  88   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  147

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  148  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  198


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  94   DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  153

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  154  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  204


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  100  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  159

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  160  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  210


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  106  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  165

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  166  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  216


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  112  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  171

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  172  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  222


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  118  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  177

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  178  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  228


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  124  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  183

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  184  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  234


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  130  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  189

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  190  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  240


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  136  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  195

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  196  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  246


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  142  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  201

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  202  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  252


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  148  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  207

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  208  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  258


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  154  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  213

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  214  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  264


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  160  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  219

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  220  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  270


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  166  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  225

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  226  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  276


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  172  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  231

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  232  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  282


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  178  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  237

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  238  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  288


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  184  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  243

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  244  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  294


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  190  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  249

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  250  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  300


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/109 (23%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  196  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  255

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGES  169
              ++G D++ GD    G   ++G D++ G+    G   ++G D++ G+ 
Sbjct  256  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDD  304


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/102 (23%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = -1

Query  468  VGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSI  289
            +G D++ G+    G   ++G D++ G+    G   ++G D++ G+        ++G D++
Sbjct  1    MGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  60

Query  288  AGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
             GD    G   ++G D++ G+    G   ++G D++ G+   
Sbjct  61   MGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNL  102


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  495  DPFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**  316
            D   G   ++G D++ G+    G   ++G D++ G+    G   ++G D++ G+      
Sbjct  202  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGD  261

Query  315  FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGE  172
              ++G D++ GD    G   ++G D++ G+    G   ++G D++  E
Sbjct  262  DNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNLMGDDNVHSE  309



>ref|WP_013355917.1| cell surface protein precursor [Lactobacillus plantarum]
 gb|ADN99729.1| cell surface protein precursor [Lactobacillus plantarum subsp. 
plantarum ST-III]
Length=1365

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/105 (26%), Positives = 47/105 (45%), Gaps = 0/105 (0%)
 Frame = +2

Query  161   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  340
             +K + P    +P+ P  P + + P+   EP  P  P + E P    +P+ P      + P
Sbjct  1155  IKPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQP  1214

Query  341   AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             +   EP  P  P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1215  SQPEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1259


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/94 (26%), Positives = 40/94 (43%), Gaps = 0/94 (0%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P  P + + P+   EP  P  P + E P    +P+ P      + P+   EP  P  P +
Sbjct  1157  PEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQ  1216

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              + P    +P+ P  P +++ P+   EP     P
Sbjct  1217  PEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKP  1250


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 40/96 (42%), Gaps = 0/96 (0%)
 Frame = +2

Query  197   TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  376
             T     +K + P    +P+ P  P + E P+   EP  P    + + P    +P+ P  P
Sbjct  1149  TYKKSAIKPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP  1208

Query  377   LKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                + P+   EP  P  P + + P    +P+ P  P
Sbjct  1209  GHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEP  1244


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 0/89 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1172  PGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1231

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1232  PGQHEQPSQPEEPGQSEKPGELQKPSQPA  1260



>ref|WP_042907803.1| hypothetical protein, partial [Gallibacterium anatis]
Length=229

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  66   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  125

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  126  QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  176


 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  102  QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  161

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  162  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  212


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  18   QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQ-----  72

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  73   -PAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  122


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  114  QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  173

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  174  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  224


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  90   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  149

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  150  QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  200


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/126 (20%), Positives = 60/126 (48%), Gaps = 9/126 (7%)
 Frame = +2

Query  128  RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLK------YESPA  289
            +P+T      P+    P + ++P + + P+  + P + ++P + N P+          PA
Sbjct  18   QPVT---EDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPA  74

Query  290  MLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
            + ++P + N  +    P + ++P     P+  + PA  ++P + + P+    P + ++P 
Sbjct  75   VETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  134

Query  470  MPNHPL  487
            + N P+
Sbjct  135  VANQPV  140


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  47   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  106

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  107  NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  158



>gb|EGV03550.1| alpha-L-fucosidase [Streptococcus infantis SK970]
Length=2417

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 46/103 (45%), Gaps = 6/103 (6%)
 Frame = +2

Query  176   PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
             P+   EP  P  P K + P+   +P+ P  P + E PA   +P+ P      + PA   +
Sbjct  1896  PSKPEEPAKPEDPSKPEDPSKPEDPSKPEDPARPEDPARPEDPSKP------EDPARPED  1949

Query  356   PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P+ P  P +   P+   +P  P  P K + PA    P+ P  P
Sbjct  1950  PSKPEDPARPKDPSKPEDPARPEDPSKPEDPARPEYPSKPEDP  1992


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/88 (31%), Positives = 40/88 (45%), Gaps = 0/88 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K + P+   +P+ P  P K + PA   +P  P  P K E PA   +P+ P    +   
Sbjct  1902  PAKPEDPSKPEDPSKPEDPSKPEDPARPEDPARPEDPSKPEDPARPEDPSKPEDPARPKD  1961

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMP  421
             P+   +P  P  P K + PA    P+ P
Sbjct  1962  PSKPEDPARPEDPSKPEDPARPEYPSKP  1989


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 0/91 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P        P K + P+   +P  P  P + + P+   +P  P  P K E PA   +P
Sbjct  1903  AKPEDPSKPEDPSKPEDPSKPEDPARPEDPARPEDPSKPEDPARPEDPSKPEDPARPKDP  1962

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPA  397
             + P    + + P+   +P  P +P K + PA
Sbjct  1963  SKPEDPARPEDPSKPEDPARPEYPSKPEDPA  1993



>ref|WP_013746171.1| phospholipase/lecithinase/hemolysin [Gallibacterium anatis]
 gb|AEC17397.1| Phospholipase/lecithinase/hemolysin [Gallibacterium anatis UMN179]
Length=1722

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P + + P+  + PA+ ++P + N P     P + ++P      +  
Sbjct  1146  NQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVA  1205

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  1206  NQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  1257


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/110 (23%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  1129  QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  1182

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              PA+ ++P + N P+    P + ++P + + P+  + P +  +P + N P
Sbjct  1183  QPAIETQPVVANQPVAETQPVVANQPVVETQPVVANQPVVEDQPVVANQP  1232


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA+ ++P + N      
Sbjct  1093  QPVVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVAN------  1146

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P   ++P + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  1147  QPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  1197


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 59/116 (51%), Gaps = 6/116 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLK------YDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  316
              P+  + PA+ ++P + N P+        + PA+ ++P + N P+    P + ++P    
Sbjct  1069  QPVVANQPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPMVANQPVAEV  1128

Query  317   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               +  + PA+ ++P + N P+    P + ++P +   P+  + PA+ ++P + N P
Sbjct  1129  QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQP  1184


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P + +  +  
Sbjct  1110  NQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVA  1169

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA+ ++P + N P     P + ++P   + P+  + P + ++P + N P+
Sbjct  1170  NQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPVVANQPV  1221


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+  D P + ++P +   P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  1158  NQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPVVA  1217

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P +  +P + N P     P + ++P + + P+  + P +  +P +   P+
Sbjct  1218  NQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPV  1269


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/106 (22%), Positives = 53/106 (50%), Gaps = 0/106 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P     P + ++P     P+    P + ++P + N  +  D
Sbjct  1165  QPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPVVANQPVVED  1224

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  1225  QPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  1270


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P +   P+    P    +P + N      
Sbjct  1045  QPVVANQPAIETQPVVANQPVAETQPVVANQPAIETQPVVTNQPVAEVQPVVAN------  1098

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  1099  QPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPV  1149


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  1105  QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  1164

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1165  QPVVANQPAVETQPVVANQPAIETQPVVANQPVAETQPVVANQPVVETQPV  1215


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 53/115 (46%), Gaps = 0/115 (0%)
 Frame = +2

Query  143   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
             M  + P+    P + ++P     P+  + PA  ++P + N P     P + ++P +    
Sbjct  999   MVANQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAIETQP  1058

Query  323   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             +  + P   ++P + N P     P + ++P     P+  + PA+ ++P + N P+
Sbjct  1059  VVANQPVAETQPVVANQPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPV  1113


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P   + PA   +P + N P     P + ++P      +  
Sbjct  1014  NQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAIETQPVVANQPVAETQPVVA  1073

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA+ ++P + N P+    P + ++P + + P+  + P   ++P + N P+
Sbjct  1074  NQPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPMVANQPV  1125


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + N P     P + ++P     P+    PA+ ++P + N  +   
Sbjct  1057  QPVVANQPVAETQPVVANQPAIETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAET  1116

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P     P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  1117  QPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPV  1167


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  1026  NQPAAETQPEVANQPAAEVQPVVANQPAIETQPVVANQPVAETQPVVANQPAIETQPVVT  1085

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             + P    +P + N P     P + ++P   + P+  + P    +P + N P
Sbjct  1086  NQPVAEVQPVVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQP  1136



>gb|AGV20596.1| neurofilament triplet H1-like protein [Andrias davidianus ranavirus]
Length=169

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 41/105 (39%), Gaps = 0/105 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P   + P+K  SP   S P     P+K  SP     P   +  +K
Sbjct  57   KRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVK  116

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
              SP   S P     P+K  SP     P   S P+K  SPA   +
Sbjct  117  RKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPAKRRQ  161


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 55/139 (40%), Gaps = 7/139 (5%)
 Frame = +2

Query  74   TIGAFLLISHLLLNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPT  253
            ++GA +L + ++  S+  R    + N  P    SP   S P     P+K  SP     P 
Sbjct  27   SLGA-MLSAPVVRASAPVRKRKSLVNRKPPVKRSPVKKSSPVKRKSPVKKSSPVKRKSPV  85

Query  254  MPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPL  433
              + P+K +SP   S P      +K  SP   S P     P+K  SP     P   S P+
Sbjct  86   KKSSPVKRKSPVKKSSP------VKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPV  139

Query  434  KYDSPAMLSEPTMPNHPLN  490
            K  SP   S P     P  
Sbjct  140  KRKSPVKKSSPVKRKSPAK  158


 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 41/102 (40%), Gaps = 6/102 (6%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            +P +   P+K  SP     P   + P+K +SP   S P      +K  SP   S P    
Sbjct  53   KPPVKRSPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSP------VKRKSPVKKSSPVKRK  106

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             P+K  SP     P   S P+K  SP   S P     P+  S
Sbjct  107  SPVKKSSPVKRKSPVKKSSPVKRKSPVKKSSPVKRKSPVKKS  148



>ref|WP_039090727.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ30229.1| hypothetical protein JP34_11875, partial [Gallibacterium anatis]
Length=1027

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/114 (22%), Positives = 57/114 (50%), Gaps = 0/114 (0%)
 Frame = +2

Query  143   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
             M  + P     P + ++P +   P+  + PA+ ++P + N P     P + ++P +    
Sbjct  889   MVANQPAAEAQPVVANQPAVETQPVVANQPAIETQPEVANQPAAEVQPVVANQPAVETQP  948

Query  323   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +  + PA+ ++P + N P+    P + ++P + + P   + PA+ ++P + N P
Sbjct  949   VVANQPAVETQPVVTNQPVVETQPVVANQPVVEAQPEVANQPAVETQPVVANQP  1002


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/106 (22%), Positives = 54/106 (51%), Gaps = 6/106 (6%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P     P + ++P +   P+    PA+ ++P + N      
Sbjct  911   QPVVANQPAIETQPEVANQPAAEVQPVVANQPAVETQPVVANQPAVETQPVVTN------  964

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              P + ++P + N P+    P + ++P + + P+  + PA+ ++P +
Sbjct  965   QPVVETQPVVANQPVVEAQPEVANQPAVETQPVVANQPAVEAQPVV  1010



>gb|KGQ47133.1| hypothetical protein IO46_13420, partial [Gallibacterium anatis]
Length=1095

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  972

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  973   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1023


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1008

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1009  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1059


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  961   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1020

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1021  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1071


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  937   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  996

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  997   QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1047


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  884  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  943

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  944  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  987


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P + N P     P + ++P   + P+  + P + ++P +   P+
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  981


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  984   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1043

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  1044  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1095


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  925   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  984

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  985   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1034


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  954   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1005


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA  ++P + N P     P + ++P + + P     P + ++P +   P+
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  993


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 53/109 (49%), Gaps = 6/109 (6%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+    P + ++P + N      
Sbjct  979   QPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVAN------  1032

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  1033  QPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQ  1081



>ref|WP_042907582.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ49214.1| hypothetical protein IO46_11125, partial [Gallibacterium anatis]
Length=610

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P   ++P + N P+  D P + ++P +   P+    PA+ ++P + N      
Sbjct  41   QPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  94

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  95   QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  145


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/110 (24%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  29   QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  82

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  83   QPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  132


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  5    QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  64

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  65   QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  115


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/106 (21%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P +  +P + N P     P + ++P +   P+    P + ++P + N  +  D
Sbjct  53   QPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVED  112

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
             P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  113  QPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  158


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +2

Query  179  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  358
            A+ ++P + N P+    P + ++P     P+    PA+ ++P + N       P   ++P
Sbjct  1    AVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVAN------QPVAETQP  54

Query  359  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  55   VVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  97


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/112 (19%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P + + P+  + PA+ ++P + N P     P + ++P +    +  
Sbjct  46   NQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVA  105

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P +  +P + N P     P + ++P + + P+  + P +  +P +   P+
Sbjct  106  NQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPV  157



>ref|WP_018379564.1| hypothetical protein [Streptococcus thoraltensis]
Length=1523

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 35/110 (32%), Positives = 50/110 (45%), Gaps = 3/110 (3%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             +P   D P    +P+ P+ P   D P   + P  PN P K  +P   S P  P+   K +
Sbjct  1370  NPSTPDKPNTPGKPSTPDKPNTPDKP---NTPDKPNTPDKPNTPDKPSTPDKPSTPDKPN  1426

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +P   + P  PN P K  +P   + P  P+ P K ++P   S P  PN P
Sbjct  1427  TPDKPNTPDKPNTPDKPSTPDKPNTPDKPNTPDKPNTPGKPSTPDKPNTP  1476


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 54/122 (44%), Gaps = 2/122 (2%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P+ P K ++P   S P  PN P K  +P   + P  PN   K  +P   S P  PN P K
Sbjct  1371  PSTPDKPNTPGKPSTPDKPNTPDKPNTPDKPNTPDKPNTPDKPSTPDKPSTPDKPNTPDK  1430

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ*SLWHGETVFNNKLSKAIS  562
              ++P   + P  PS P K ++P   + P  PN P  G P      +      N +S+   
Sbjct  1431  PNTPDKPNTPDKPSTPDKPNTPDKPNTPDKPNTP--GKPSTPDKPNTPDKLENSISQEKQ  1488

Query  563   IP  568
             +P
Sbjct  1489  LP  1490


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/100 (33%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P K  +P   + P  PN P K ++P   + P  P+ P K  +P   + P  PN   K ++
Sbjct  1380  PGKPSTPDKPNTPDKPNTPDKPNTPDKPNTPDKPSTPDKPSTPDKPNTPDKPNTPDKPNT  1439

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAML  457
             P   S P  PN P K ++P   + P  PS P K ++P  L
Sbjct  1440  PDKPSTPDKPNTPDKPNTPDKPNTPGKPSTPDKPNTPDKL  1479


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = +2

Query  116   SSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML  295
             S+  +P T      P K ++P   + P  PN P K ++P   S P  P+ P K  +P   
Sbjct  1372  STPDKPNTPGKPSTPDKPNTPDKPNTPDKPNTPDKPNTPDKPSTPDKPSTPDKPNTPDKP  1431

Query  296   SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             + P  PN   K  +P   + P  PN P K ++P   S P  P+ P K ++ ++  E  +P
Sbjct  1432  NTPDKPNTPDKPSTPDKPNTPDKPNTPDKPNTPGKPSTPDKPNTPDKLEN-SISQEKQLP  1490



>gb|EAR66038.1| cell wall-anchored protein [Bacillus sp. NRRL B-14911]
Length=200

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (6%)
 Frame = -2

Query  461  PIALPENHTSK------DDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLASSA  300
            P+AL      K      + LA  A +AL E+  L+  LA  A +AL E+    ++LA  A
Sbjct  29   PLALKAQLARKESKVLRESLALKAQLALKESKVLRGPLALKAQLALKESKVLRESLALKA  88

Query  299  PIALQEIHTLKDDLASSAPIALPENHTLKDDLASSAPIALQENHTLK  159
             +A +E   L++ LA  A +A  E+  L++ LA  A +A +E+  L+
Sbjct  89   QLARKESKVLREKLALKAQLARKESKVLRESLALKAQLARKESKVLR  135



>ref|XP_011196264.1| PREDICTED: probable serine/threonine-protein kinase kinX [Bactrocera 
cucurbitae]
Length=258

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 13/119 (11%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P++ D PA + EP+    P   + P+ + EP     P K E PA   EP+      K +
Sbjct  119  KPVQGDEPAKVEEPSKVEQPADSEEPSKVEEPAKVEEPSKVEQPADSEEPS------KVE  172

Query  335  SPAM-------LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             PA         ++P   + P K + P+ + +P     PLK + PA + EPT    P +
Sbjct  173  QPAQDDDLLLLDAKPAQGDEPAKVEEPSKVEQPADSEEPLKVEQPAKVEEPTKVEQPAD  231


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 50/120 (42%), Gaps = 7/120 (6%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML-------SEPTM  310
              P K + PA   EP+    P K + P+ + +P     P K E PA         ++P  
Sbjct  130  EEPSKVEQPADSEEPSKVEEPAKVEEPSKVEQPADSEEPSKVEQPAQDDDLLLLDAKPAQ  189

Query  311  PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             +   K + P+ + +P     PLK + PA + EPT    P   + P+ + +P     P  
Sbjct  190  GDEPAKVEEPSKVEQPADSEEPLKVEQPAKVEEPTKVEQPADSEEPSKVEQPAQAEQPAE  249



>ref|WP_039155889.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ59493.1| hypothetical protein IO45_06335, partial [Gallibacterium anatis]
Length=612

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P   ++P + N P+  D P + ++P +   P+    PA+ ++P + N      
Sbjct  43   QPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  96

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  97   QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  147


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/110 (24%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  31   QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  84

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  85   QPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  134


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 54/104 (52%), Gaps = 6/104 (6%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            PA+ ++P + N P+    P + ++P     P+    PA+ ++P + N       P   ++
Sbjct  2    PAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVAN------QPVAETQ  55

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  56   PVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  99


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  7    QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  66

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  67   QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  117


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/106 (21%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P +  +P + N P     P + ++P +   P+    P + ++P + N  +  D
Sbjct  55   QPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVED  114

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
             P + ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  115  QPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  160


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/112 (19%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P + + P+  + PA+ ++P + N P     P + ++P +    +  
Sbjct  48   NQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVA  107

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P +  +P + N P     P + ++P + + P+  + P +  +P +   P+
Sbjct  108  NQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPV  159



>ref|WP_010389626.1| ribonuclease [Pseudoalteromonas undina]
 gb|ERG62061.1| RNase E [Pseudoalteromonas undina NCIMB 2128]
Length=1077

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 42/108 (39%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
            K + P   +EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  852  KTEEPVKTAEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPV  911

Query  344  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               EP     P+K + P    EP     P+K + P    EP     P+
Sbjct  912  KTEEPVKTEEPVKTEEPVKAEEPVKTEEPVKTEEPVKTEEPVQTEEPV  959


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 40/103 (39%), Gaps = 0/103 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K   P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  856  PVKTAEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPVKTEE  915

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
            P    EP     P+K + P    EP     P+K + P    EP
Sbjct  916  PVKTEEPVKTEEPVKAEEPVKTEEPVKTEEPVKTEEPVQTEEP  958


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 39/103 (38%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  358
            A   EP     P+K + P    EP     P+K E P    EP      +K + P    EP
Sbjct  851  AKTEEPVKTAEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEP  910

Query  359  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
                 P+K + P    EP     P+K + P    EP     P+
Sbjct  911  VKTEEPVKTEEPVKTEEPVKAEEPVKTEEPVKTEEPVKTEEPV  953


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 39/102 (38%), Gaps = 0/102 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  868  PVKTEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKTEE  927

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            P    EP     P+K + P    EP     P+K +      E
Sbjct  928  PVKAEEPVKTEEPVKTEEPVKTEEPVQTEEPVKTEEQVQTEE  969


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 41/102 (40%), Gaps = 0/102 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  874  PVKTEEPVKAEEPVKAEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKTEEPVKAEE  933

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            P    EP     P+K + P    EP      ++ +  A+ +E
Sbjct  934  PVKTEEPVKTEEPVKTEEPVQTEEPVKTEEQVQTEEVAIEAE  975



>ref|WP_028835972.1| ribonuclease [Pseudoalteromonas sp. 23_GOM-1509m]
Length=1084

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 41/108 (38%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
            K + P    EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  859  KVEEPVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPV  918

Query  344  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               EP     P+K + P    EP     P+K + P    EP     P+
Sbjct  919  KAEEPVKAEEPVKAEEPVQAEEPVQTEEPVKAEEPVKAEEPVKAEEPV  966


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 39/102 (38%), Gaps = 0/102 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K + P    EP   + P+K   P    EP     P+K E      EP      +K + 
Sbjct  869  PVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPVKAEEPVKAEE  928

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            P    EP     P++ + P    EP     P+K + P    E
Sbjct  929  PVKAEEPVQAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKAEE  970



>gb|AFR22934.1| cell surface protein precursor [Lactobacillus helveticus R0052]
Length=980

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA  ++P  PN P + + PA  ++P  PN P +   PA  ++P  PN   + + 
Sbjct  817  PVNPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNK  876

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
            PA  ++P  PN P + + PA  ++P  P+ P K ++    + P
Sbjct  877  PAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAKLNNLGKSTNP  919


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query  188  SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  367
            S P  PN P + + PA  ++P  PN P +   PA  ++P  PN       PA  ++P  P
Sbjct  815  SIPVNPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPN------KPAEPNKPAEP  868

Query  368  NHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            N P + + PA  ++P  P+ P + + PA  ++P  PN P
Sbjct  869  NKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKP  907


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P   ++P  PN P + + PA  ++P  PN P +   PA  ++P  PN   + + PA  ++
Sbjct  817  PVNPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNK  876

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P  PN P + + PA  ++P  P+ P + + PA L+      +P
Sbjct  877  PAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAKLNNLGKSTNP  919


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (53%), Gaps = 0/93 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P + + PA  ++P  PN P + + PA  ++P  PN P +   PA  ++P  PN   + + 
Sbjct  829  PAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNKPAEPNK  888

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  436
            PA  ++P  PN P + + PA L+     ++P K
Sbjct  889  PAEPNKPAEPNKPAEPNKPAKLNNLGKSTNPGK  921



>ref|WP_039083408.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ34025.1| hypothetical protein JP32_01535 [Gallibacterium anatis]
Length=1651

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1037  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPTAET  1096

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P + + P+  + PA+ ++P + N P+
Sbjct  1097  QPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAVETQPVVANQPV  1147


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  911   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  970

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
              P + ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  971   QPEVATQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQ  1019


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 53/110 (48%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1025  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVET  1084

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++PT    P+  + P + ++P     P+  + PA+ ++P + N P
Sbjct  1085  QPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQP  1134


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P +    +  +
Sbjct  947   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVTNQPVVEAQPVVAN  1006

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1007  QPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1057


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+    P   ++P + N  +  +
Sbjct  1049  QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPTAETQPVVANQPVVTN  1108

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P    +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1109  QPVAEVQPVVANQPAVETQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  1159


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+    P + ++P + N P     P + ++P + N P+    P + ++P +    +  +
Sbjct  1073  QPVVATQPVVETQPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVAN  1132

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P+    P + ++P + + P     P + ++P     P+
Sbjct  1133  QPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPVVANQPVAKTQPI  1183


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P +   P+    P + ++PT    P+    P + ++P      +  +
Sbjct  1061  QPVVANQPAVETQPVVATQPVVETQPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVAN  1120

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P     P + ++P + + P+  + P + ++P +   P+
Sbjct  1121  QPAVETQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPV  1171


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+    P + ++PT    P+  + P + ++P     P+    PA+ ++P + N      
Sbjct  1079  QPVVETQPVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAVET  1138

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  + P + ++P + + P+  + P   ++P + N P+
Sbjct  1139  QPVVANQPVVETQPVVTNQPVVETQPEVATQPVVANQPVAKTQPIVANQPV  1189


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 55/115 (48%), Gaps = 0/115 (0%)
 Frame = +2

Query  143   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
             M  + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      
Sbjct  889   MVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQP  948

Query  323   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             +  + PA  ++P + N P+    P + ++P + + P+    P + ++P +   P+
Sbjct  949   VVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVTNQPVVEAQPV  1003


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  959   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVAN  1018

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
               A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1019  QLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1068


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 58/121 (48%), Gaps = 3/121 (2%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P+     + P+    P + ++P +   P+  +  A  ++P + N P+    P + ++P
Sbjct  988   AQPVV---TNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQP  1044

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              +    +  + P + ++P + N P     P + ++P + + P+  + P   ++P + N P
Sbjct  1045  AVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPTAETQPVVANQP  1104

Query  485   L  487
             +
Sbjct  1105  V  1105


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA  ++P + N P+    P + ++P + N     
Sbjct  928   NQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN-----  982

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  983   -QPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1033


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +2

Query  176   PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
             P + ++P +   P   + PA+ ++P + N P+    P + ++P +    +    P + ++
Sbjct  1026  PVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQ  1085

Query  356   PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + N P     P + ++P + + P+    P + ++P +   P+
Sbjct  1086  PVIANQPTAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPV  1129


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + P + ++P + N       P + ++P +       
Sbjct  982   NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVA  1041

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             + PA+ ++P + N P+    P + ++P + + P+    P + ++P + N P
Sbjct  1042  NQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQP  1092



>gb|KFY94434.1| hypothetical protein V500_03260 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=1850

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 14/108 (13%)
 Frame = +2

Query  164   KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPA--MLSEPTMPNYHLKYDS  337
             K++ P ++ EP     P K + PA+  EPT      K E PA  ++ EPT      K + 
Sbjct  1544  KFEEPVVVDEPAAVEEPTKVEEPAVAEEPT------KVEEPAADVVEEPT------KVEE  1591

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
             PA ++EP     P   + P  + EPT    P K + P  + EPT    
Sbjct  1592  PAAVAEPIKAAEPAVVEEPTKVEEPTKVEEPTKVEEPVAVEEPTAVEQ  1639



>ref|WP_039163635.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ61741.1| hypothetical protein IO48_06935 [Gallibacterium anatis 4895]
Length=1527

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P + + P+  + PA+  +P + N P+    P + ++P      +  
Sbjct  897   NQPVVETQPVVANQPVVEDQPVVANQPAVEDQPVVANQPVVETQPVVANQPVAETQPVVA  956

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA  ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  957   NQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQPV  1008


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+  D P + ++P + + P+  + P + ++P + N P+    P + ++P         
Sbjct  909   NQPVVEDQPVVANQPAVEDQPVVANQPVVETQPVVANQPVAETQPVVANQPAAETQPEVA  968

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA   +P + N P+    P + ++P + + P   + P + ++P + N P+
Sbjct  969   NQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVTNQPV  1020


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA  ++P + N P     P + ++P +    +  
Sbjct  933   NQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVA  992

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  993   NQPVVEAQPEVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPV  1044


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/106 (23%), Positives = 52/106 (49%), Gaps = 6/106 (6%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + PA+ ++P + N P+    P + ++P + + P+    PA+  +P + N       P + 
Sbjct  885  NQPAVEAQPVVANQPVVETQPVVANQPVVEDQPVVANQPAVEDQPVVAN------QPVVE  938

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            ++P + N P+    P + ++P   + P   + PA   +P + N P+
Sbjct  939  TQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPV  984


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P   D P + ++P +   P+  + P   ++P + N P     P + ++P      +  
Sbjct  921   NQPAVEDQPVVANQPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVA  980

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             + P + ++P + N P+    P + ++P + + P+  + P    +P + N P
Sbjct  981   NQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVTNQPVAEVQPVVANQP  1031


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P     P + ++P +   P+    P + ++P + N      
Sbjct  952   QPVVANQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVAN------  1005

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P + + P+  + P   ++P + N P+
Sbjct  1006  QPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPV  1056


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/112 (19%), Positives = 50/112 (45%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P     P + ++P     P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  957   NQPAAETQPEVANQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVT  1016

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P    +P + N P     P + ++P   + P+  + P +  +P + N P+
Sbjct  1017  NQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPI  1068


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P     P + ++P +   P+  + P + ++P + N P+    P + ++P      +  
Sbjct  969   NQPAAEVQPVVANQPVVETQPVVANQPVVEAQPEVANQPVVETQPVVTNQPVAEVQPVVA  1028

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
             + PA+ ++P + N P+    P + ++P +   P+  + P + ++P
Sbjct  1029  NQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPIVEAQP  1073



>ref|WP_039081894.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ37876.1| hypothetical protein JP35_08810 [Gallibacterium anatis]
Length=1612

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  922   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  981

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  982   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1032


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  874  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  927

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  928  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  978


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  +  A  ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1060  QPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVET  1119

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  1120  QPVVATQPVVETQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  1170


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 55/109 (50%), Gaps = 0/109 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  958   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1017

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N 
Sbjct  1018  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVETQPVVANQ  1066


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1072  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVET  1131

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P +  +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1132  QPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  1182


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + +  +  +
Sbjct  1084  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVEDQPVVAN  1143

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA  ++P + N P     P + ++P + + P+  + P + ++P +   P+
Sbjct  1144  QPAAKTQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPV  1194


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1012  QPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVETQPVVANQLAAET  1071

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1072  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1122


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + P + ++P + N P     P + ++P +    +  
Sbjct  1077  NQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVE  1136

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             D P + ++P     P+  + PA+ ++P + + P+    P + ++P +   P
Sbjct  1137  DQPVVANQPAAKTQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQP  1187


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  946   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  1005

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  1006  QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1056


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+  + P + ++P      +  +
Sbjct  1096  QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVEDQPVVANQPAAKTQPVVAN  1155

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P+    P + ++P + + P     P + ++P +   P+
Sbjct  1156  QPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPVVETQPEVATQPV  1206


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  893  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  952

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  953  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  996


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  934   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  993

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  994   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1043


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  993   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1052

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1053  NQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1104


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  903   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  962

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  963   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1014


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 49/111 (44%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  892   QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  951

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA  ++P + N P     P + ++P + + P     P + ++P +   P+
Sbjct  952   QPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  1002


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  970   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1029

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P     P + ++P + + P+  +  A  ++P + N P+
Sbjct  1030  QPVVEAQPEVANQPAVETQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1080


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 54/117 (46%), Gaps = 6/117 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSP------AMLSEPTMPNHPLKYESPAMLSEPTMPN  316
              P   + PA+ ++P + N P+    P      A  ++P + N P+    P + ++P +  
Sbjct  1036  QPEVANQPAVETQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1095

Query  317   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               +  + P + ++P + N P     P + ++P + + P+  D P + ++P     P+
Sbjct  1096  QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVVEDQPVVANQPAAKTQPV  1152



>ref|WP_039153091.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ69327.1| hypothetical protein IO47_00165 [Gallibacterium anatis]
Length=1775

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 56/111 (50%), Gaps = 6/111 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++    N P   D P + ++P +   P+    PA+ ++P + N      
Sbjct  1205  QPVAANQPAVETQAVAANQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  1258

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  1259  QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  1309


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 56/110 (51%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P + N P+    P + ++P +    +  +
Sbjct  971   QPVVANQPAVETQPMVANQPVAEAQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  1030

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              PA  ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  1031  QPAAETQPEVANQPAAEVQPVVANQPVVEAQPVVANQPVVEAQPEVANQP  1080


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/110 (23%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P   + PA+ ++P + N P     P + ++P     P+    PA+ ++P + N  +   
Sbjct  935   QPEVANQPAVETQPVIANQPAAETQPEVANQPAAEVQPVVANQPAVETQPMVANQPVAEA  994

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++P + N P+    P + ++P + + P+  + PA  ++P + N P
Sbjct  995   QPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVANQP  1044


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 56/115 (49%), Gaps = 0/115 (0%)
 Frame = +2

Query  143   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
             M  + P   D P + ++P + + P+  + PA  ++P + N P+    P + ++P +    
Sbjct  889   MVANQPAVEDQPVVETQPVVEDQPVVANQPAAEAQPVVTNQPVAEVQPEVANQPAVETQP  948

Query  323   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             +  + PA  ++P + N P     P + ++P + + P+  + P   ++P +   P+
Sbjct  949   VIANQPAAETQPEVANQPAAEVQPVVANQPAVETQPMVANQPVAEAQPVVETQPV  1003


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P     P + ++P +   P+  + PA   +P + N P+    P + ++P      +  
Sbjct  1150  NQPAVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAA  1209

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA+ ++    N P   D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  1210  NQPAVETQAVAANQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  1261


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++    N P   + P + ++P +    +  
Sbjct  1186  NQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAANQPAVEDQPVVANQPAVETQPVVA  1245

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             + PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  1246  NQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  1296


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/101 (22%), Positives = 51/101 (50%), Gaps = 0/101 (0%)
 Frame = +2

Query  170   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             + PA+  +P + N P     P + ++P +   P+    P + ++P + N  +  D P + 
Sbjct  1222  NQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVA  1281

Query  350   SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
             ++P     P+  + PA+ ++P + + P+  D P + ++P +
Sbjct  1282  NQPAAKTQPVVANQPAVETQPVVANQPVVEDQPEVATQPVV  1322


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + P + ++P + N P     P   ++P +    +  
Sbjct  1162  NQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAA  1221

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA+  +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1222  NQPAVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPV  1273


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + PA  ++P + N P     P + ++P +    +  
Sbjct  1006  NQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVANQPAAEVQPVVANQPVVEAQPVVA  1065

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1066  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1117


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/115 (23%), Positives = 55/115 (48%), Gaps = 6/115 (5%)
 Frame = +2

Query  143   MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
             M  + P+    P + ++P + N P+    P + ++P +   P+    PA  ++P + N  
Sbjct  985   MVANQPVAEAQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVAN--  1042

Query  323   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
                  PA   +P + N P+    P + ++P + + P   + PA+ ++P + N P+
Sbjct  1043  ----QPAAEVQPVVANQPVVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1093


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA   +P + N P+    P + ++P     P+    PA+ ++    N     D
Sbjct  1169  QPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAANQPAVED  1228

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  1229  QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  1279


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+    P + ++P     P+  + PA+ ++P + N P     P + ++P      +  +
Sbjct  995   QPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPAAETQPEVANQPAAEVQPVVAN  1054

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1055  QPVVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1105


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1066  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1125

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1126  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVIANQP  1176


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P + N  +  
Sbjct  952   NQPAAETQPEVANQPAAEVQPVVANQPAVETQPMVANQPVAEAQPVVETQPVVTNQPVAE  1011

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               P + ++P +   P+  + PA  ++P + + P     P + ++P +   P+
Sbjct  1012  VQPVVANQPAVETQPVVANQPAAETQPEVANQPAAEVQPVVANQPVVEAQPV  1063


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P   + PA+ ++P + N P+    P + ++P +    +  
Sbjct  1054  NQPVVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVA  1113

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1114  NQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1165


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 50/111 (45%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P   ++P +    +    PA+  +P + N      
Sbjct  1181  QPVVANQPVVETQPVIANQPAAEVQPVAANQPAVETQAVAANQPAVEDQPVVANQPAVET  1240

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  + P + ++P + + P+  D P + ++P     P+
Sbjct  1241  QPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPV  1291


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 56/117 (48%), Gaps = 6/117 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLK------YDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  316
              P+  + PA  ++P + N P+        + PA+ ++P + N P     P + ++P    
Sbjct  911   QPVVANQPAAEAQPVVTNQPVAEVQPEVANQPAVETQPVIANQPAAETQPEVANQPAAEV  970

Query  317   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               +  + PA+ ++P + N P+    P + ++P + + P+    P + ++P +   P+
Sbjct  971   QPVVANQPAVETQPMVANQPVAEAQPVVETQPVVTNQPVAEVQPVVANQPAVETQPV  1027


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 56/120 (47%), Gaps = 3/120 (3%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P+     + P+    P + ++P +   P+  +  A  ++P + N P+    P + ++P
Sbjct  1096  AQPVV---TNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQP  1152

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              +    +  + P + ++P + N P     P + ++P + + P+  + PA   +P   N P
Sbjct  1153  AVETQPVVANQPVVETQPVIANQPAAEVQPVVANQPVVETQPVIANQPAAEVQPVAANQP  1212



>ref|WP_039156382.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ57531.1| hypothetical protein IO45_11020, partial [Gallibacterium anatis]
Length=1049

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 57/118 (48%), Gaps = 1/118 (1%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGSPE  502
             + PA  ++P + N P+    P + ++P     P+  + PA+ ++P + N P +   PE
Sbjct  954   NQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPE  1011


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA  ++P + N P+    P + ++P      +  
Sbjct  930   NQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVA  989

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  990   NQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1041


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  ++P + N P     P + ++P + + P+  + PA   +P + N P
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQP  992


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 53/110 (48%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P   ++P + N P     P + ++P   + P+  + P + ++P + N P
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQP  980


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 53/110 (48%), Gaps = 6/110 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N      
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTN------  966

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  967   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1016


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P     P + ++P     P+  + PA  ++P + N P     P + ++P +    +  
Sbjct  918   NQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVA  977

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  978   NQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1029



>gb|KDA98464.1| cell wall anchor protein [Lactobacillus gasseri K7]
Length=1737

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 40/95 (42%), Gaps = 6/95 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EPT P+ P +   P    EPT P  P++   P    EPT P        PA  SEPT P 
Sbjct  1562  EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPG------KPAQPSEPTKPE  1615

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              P     PA  SEPT P      + P   +E   P
Sbjct  1616  EPTTPGKPAQPSEPTKPKEQTIPNKPNQSNETESP  1650


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 35/88 (40%), Gaps = 0/88 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   D P   S+PT P  P     P   SEPT P  P     PA  SEPT P        
Sbjct  1563  PTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPTTPGK  1622

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMP  421
             PA  SEPT P      + P   +E   P
Sbjct  1623  PAQPSEPTKPKEQTIPNKPNQSNETESP  1650


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 34/84 (40%), Gaps = 0/84 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+P+       P +   P    EPT P  P++   P    EPT P  P +   P    EP
Sbjct  1558  AKPVEPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEP  1617

Query  305   TMPNYHLKYDSPAMLSEPTMPNHP  376
             T P    +   P    E T+PN P
Sbjct  1618  TTPGKPAQPSEPTKPKEQTIPNKP  1641



>ref|WP_039946191.1| hypothetical protein, partial [Lactobacillus mucosae]
Length=186

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 54/124 (44%), Gaps = 0/124 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+P T      P K  +PA  +EP  P+ P K   PA  S P  P  P+   +P   +EP
Sbjct  13   AKPSTPAKPTEPAKPSTPAKPTEPAKPSAPTKPTEPAKPSTPNKPTEPVNPSTPEKPTEP  72

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P+   K   PA  S P  P  P K  +P   +EP  PS P K   PA  S P  P  P
Sbjct  73   AKPSTSAKPTEPAKPSTPEKPTEPAKPSTPNKPTEPAKPSTPEKPTEPAKPSTPNKPTEP  132

Query  485  LNGS  496
               S
Sbjct  133  ATPS  136


 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 50/114 (44%), Gaps = 0/114 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P K  +PA  +EP  P+ P K   PA  S PT P  P K  +P   +EP  P+   K  
Sbjct  11   EPAKPSTPAKPTEPAKPSTPAKPTEPAKPSAPTKPTEPAKPSTPNKPTEPVNPSTPEKPT  70

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             PA  S    P  P K  +P   +EP  PS P K   PA  S P  P  P   S
Sbjct  71   EPAKPSTSAKPTEPAKPSTPEKPTEPAKPSTPNKPTEPAKPSTPEKPTEPAKPS  124


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 56/133 (42%), Gaps = 6/133 (5%)
 Frame = +2

Query  116  SSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML  295
            S+ A+P        P K   PA  S PT P  P K  +P   +EP  P+ P K   PA  
Sbjct  16   STPAKPTEPAKPSTPAKPTEPAKPSAPTKPTEPAKPSTPNKPTEPVNPSTPEKPTEPAKP  75

Query  296  S------EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAML  457
            S      EP  P+   K   PA  S P  P  P K  +P   +EP  PS P K   PA  
Sbjct  76   STSAKPTEPAKPSTPEKPTEPAKPSTPNKPTEPAKPSTPEKPTEPAKPSTPNKPTEPATP  135

Query  458  SEPTMPNHPLNGS  496
            S P  P  P+  S
Sbjct  136  STPEKPTEPVTPS  148


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 66/162 (41%), Gaps = 4/162 (2%)
 Frame = +2

Query  17   IKPSFN*IPTAMASPSSRLTIGAFLLISHLLLNSSMARPITMMPNH--HPLKYDSPAMLS  190
             KPS    PT  A PS+          S     +  A+P T  PN    P+   +P   +
Sbjct  13   AKPSTPAKPTEPAKPSTPAKPTEPAKPSAPTKPTEPAKPST--PNKPTEPVNPSTPEKPT  70

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EP  P+   K   PA  S P  P  P K  +P   +EP  P+   K   PA  S P  P 
Sbjct  71   EPAKPSTSAKPTEPAKPSTPEKPTEPAKPSTPNKPTEPAKPSTPEKPTEPAKPSTPNKPT  130

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             P    +P   +EP  PS P K   PA  S P  P  P+N S
Sbjct  131  EPATPSTPEKPTEPVTPSTPEKPTEPATPSTPEEPTEPVNPS  172



>ref|WP_033032426.1| hypothetical protein, partial [Pseudoalteromonas citrea]
Length=113

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/101 (25%), Positives = 46/101 (46%), Gaps = 0/101 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+  + PA +  P +   P K ++PA+  +P     P   E PA +  P +     K 
Sbjct  11   EAPVVTEQPAKVEAPVVTEQPAKVEAPAVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKV  70

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
            ++PA+  +P     P+  + PA +  P +   P K ++P +
Sbjct  71   EAPAVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVV  111


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 6/111 (5%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA +  P +   P K ++P +         P K E+PA+  +P         + 
Sbjct  1    PVVTEQPAKVEAPVVTEQPAKVEAPVVT------EQPAKVEAPAVTEQPAKVEAPAVTEQ  54

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            PA +  P +   P K ++PA+  +P     P+  + PA +  P +   P  
Sbjct  55   PAKVEAPVVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAK  105



>ref|WP_001083114.1| alpha-L-fucosidase [Streptococcus oralis]
 gb|EFU64233.1| Gram-positive signal peptide protein, YSIRK family [Streptococcus 
oralis ATCC 49296]
Length=2041

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/101 (28%), Positives = 44/101 (44%), Gaps = 6/101 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             E   P  P + ++PA   +P  P  P + E+PA    P  P      + PA   +P  P 
Sbjct  1671  EAAQPEKPARPETPAQPEKPAQPEKPAQPETPAQPETPAQP------EQPAQPEKPAQPE  1724

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
              P + ++PA   +P  P  P + + PA   +P   + P  G
Sbjct  1725  TPAQPETPAQPEQPAQPEQPAQPEKPAQPEKPITSSSPEEG  1765


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/90 (29%), Positives = 40/90 (44%), Gaps = 0/90 (0%)
 Frame = +2

Query  179   AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  358
             A   +P  P  P + + PA   +P  P  P + E+PA   +P  P    + ++PA    P
Sbjct  1673  AQPEKPARPETPAQPEKPAQPEKPAQPETPAQPETPAQPEQPAQPEKPAQPETPAQPETP  1732

Query  359   TMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  448
               P  P + + PA   +P  P  P+   SP
Sbjct  1733  AQPEQPAQPEQPAQPEKPAQPEKPITSSSP  1762


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/91 (29%), Positives = 40/91 (44%), Gaps = 6/91 (7%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + ++PA   +P  P  P + ++PA    P  P  P + E PA    P  P      ++
Sbjct  1678  PARPETPAQPEKPAQPEKPAQPETPAQPETPAQPEQPAQPEKPAQPETPAQP------ET  1731

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHP  430
             PA   +P  P  P + + PA   +P   S P
Sbjct  1732  PAQPEQPAQPEQPAQPEKPAQPEKPITSSSP  1762



>ref|WP_039157809.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ66824.1| hypothetical protein IO49_03030 [Gallibacterium anatis]
Length=1800

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  972

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  973   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1023


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1008

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1009  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1059


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAET  1146

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              PA+ ++P + N P+    P + ++P     P+  + P   ++P + N P
Sbjct  1147  QPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQP  1196


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  961   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1020

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1021  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1071


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  937   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  996

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  997   QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1047


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P+    P + ++      P+    P + ++P + N      
Sbjct  1051  QPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1110

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  + PA+ ++P + + P+    PA+ ++P + N P+
Sbjct  1111  QPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPV  1161


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P+    P + ++P     P+    PA+ ++P +    +   
Sbjct  1153  QPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEA  1212

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              P ++++P     P+  D P + ++P   + P+  + PA+ ++P +
Sbjct  1213  QPVVVNQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVV  1258


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  884  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  943

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  944  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  987


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P + N P     P + ++P   + P+  + P + ++P +   P+
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  981


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  984   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1043

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  1044  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1095


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1020  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1079

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1080  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1130


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1027  QPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAET  1086

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1137


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  925   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  984

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  985   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1034


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  954   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1005



>ref|WP_021461970.1| hypothetical protein [Gallibacterium anatis]
 gb|ERF78007.1| hypothetical protein N561_08640 [Gallibacterium anatis 12656/12]
Length=1800

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVET  972

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  973   QPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1023


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P+    P + ++P + N P+    P + ++P      +  +
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1008

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  1009  QPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1059


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAET  1146

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              PA+ ++P + N P+    P + ++P     P+  + P   ++P + N P
Sbjct  1147  QPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQP  1196


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P +   P+  + P + ++P + N P     P + ++P +    +  +
Sbjct  961   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN  1020

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1021  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1071


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P     P + ++P +   P     P + ++P +    +  +
Sbjct  937   QPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVAN  996

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  997   QPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1047


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P+    P + ++      P+    P + ++P + N      
Sbjct  1051  QPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1110

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  + PA+ ++P + + P+    PA+ ++P + N P+
Sbjct  1111  QPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPV  1161


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P+    P + ++P     P+    PA+ ++P +    +   
Sbjct  1153  QPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEA  1212

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              P ++++P     P+  D P + ++P   + P+  + PA+ ++P +
Sbjct  1213  QPVVVNQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVV  1258


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P +  +P + N P+    P + ++P     P+    PA+ ++P + N  +    P + ++
Sbjct  884  PVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQ  943

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P     P+  + PA  ++P + + P+    P + ++P + N P+
Sbjct  944  PAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVANQPV  987


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P + N P     P + ++P   + P+  + P + ++P +   P+
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPV  981


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  984   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVA  1043

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + P + ++P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  1044  NQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1095


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1020  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1079

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1080  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1130


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1027  QPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAET  1086

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1087  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1137


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + N P     P + ++P     P+    P + ++P +    +  +
Sbjct  925   QPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVETQPEVATQPVVAN  984

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  985   QPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1034


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA  ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  954   NQPAAEAQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1005



>ref|WP_011328491.1| ribonuclease [Pseudoalteromonas haloplanktis]
 emb|CAI86888.1| RNase E: endoribonuclease for rRNA processing and mRNA degradation; 
member of the degradosome; involved in the production 
of deoxyribonucleotides via the formation of NDPs [Pseudoalteromonas 
haloplanktis TAC125]
Length=1071

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P++ + PA +  P +   P K ++P    EP     P+  E PA +  P +     K ++
Sbjct  865  PVQTEEPAKVETPVVTEEPAKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVET  924

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P +  EP     P+  + PA +  P +   P K ++P +  EPT    P+
Sbjct  925  PLVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPTKVETPV  974


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/120 (26%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A+  T +    P K ++P    EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  884   AKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVETPLVTEEPAKVEAPVVTEEP  943

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                   +  + PA +  P +   P K ++P +  EPT    P+  + PA +  P +   P
Sbjct  944   AKVETPVVTEEPAKVEAPVVTEEPTKVETPVVTEEPTKVEAPVVTEEPAKVETPVVTAAP  1003


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 48/110 (44%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA +  P     P K ++P    EP     P+  E PA +  P +     K ++
Sbjct  877  PVVTEEPAKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVETPLVTEEPAKVEA  936

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P +  EP     P+  + PA +  P +   P K ++P +  EPT    P+
Sbjct  937  PVVTEEPAKVETPVVTEEPAKVEAPVVTEEPTKVETPVVTEEPTKVEAPV  986


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA +  P     P K ++P +  EP     PL  E PA +  P +     K ++
Sbjct  889  PVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAKVETPLVTEEPAKVEAPVVTEEPAKVET  948

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P +  EP     P+  + P  +  P +   P K ++P +  EP     P+
Sbjct  949  PVVTEEPAKVEAPVVTEEPTKVETPVVTEEPTKVEAPVVTEEPAKVETPV  998


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/113 (25%), Positives = 50/113 (44%), Gaps = 0/113 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P+  + PA +  P +   P K ++P +  EP     P+  E PA +  P +     K ++
Sbjct  901   PVAAEEPAKVEAPVVTEEPAKVETPLVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVEA  960

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             P +  EPT    P+  + P  +  P +   P K ++P + + P +      GS
Sbjct  961   PVVTEEPTKVETPVVTEEPTKVEAPVVTEEPAKVETPVVTAAPHVKTAIAQGS  1013


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/101 (27%), Positives = 43/101 (43%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  LSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTM  364
            + EP     P K ++P +  EP     P+  E PA +  P       K ++P +  EP  
Sbjct  862  VEEPVQTEEPAKVETPVVTEEPAKVETPVAAEEPAKVETPVAAEEPAKVEAPVVTEEPAK  921

Query  365  PNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               PL  + PA +  P +   P K ++P +  EP     P+
Sbjct  922  VETPLVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVEAPV  962



>gb|EHJ52010.1| agglutinin receptor [Streptococcus macacae NCTC 11558]
Length=1153

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 3/109 (3%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            PLK  +P   +EP  P  P +  +P   +EP  P  P + E+P   +EP  P    + ++
Sbjct  636  PLKPVAPTAPTEPVAPTAPTEPVAPTAPTEPVAPTAPTEPEAPTAPTEPVAPTAPTEPEA  695

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P   +EP  P  P +  +P   +EP  P  PL   +P    +P  P  P
Sbjct  696  PTAPTEPVAPTAPTEPVAPTAPTEPVAPIEPL---APERAVDPEPPVAP  741


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +2

Query  212  PLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDS  391
            PLK  +P   +EP  P  P +  +P   +EP  P    + ++P   +EP  P  P + ++
Sbjct  636  PLKPVAPTAPTEPVAPTAPTEPVAPTAPTEPVAPTAPTEPEAPTAPTEPVAPTAPTEPEA  695

Query  392  PAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
            P   +EP  P+ P +  +P   +EP  P  PL  +PE+
Sbjct  696  PTAPTEPVAPTAPTEPVAPTAPTEPVAPIEPL--APER  731



>gb|AGL65247.2| Cell surface protein [Lactobacillus plantarum subsp. plantarum 
P-8]
Length=1377

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1136  PGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1195

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P    +P+ P  P   + P+   EP  P  P + + P    +P+ P  P
Sbjct  1196  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP  1244


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/112 (26%), Positives = 48/112 (43%), Gaps = 2/112 (2%)
 Frame = +2

Query  146   PNH--HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNY  319
             P H   P + + P    +P+ P  P   + P+   EP  P  P + E P    +P+ P  
Sbjct  1160  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1219

Query  320   HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
                 + P+   EP  P  P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1220  PGHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1271


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 45/109 (41%), Gaps = 0/109 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1148  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1207

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P    +P+ P  P   + P+   EP  P  P + + P    +P+ P  P
Sbjct  1208  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEP  1256


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/108 (26%), Positives = 45/108 (42%), Gaps = 0/108 (0%)
 Frame = +2

Query  161   LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  340
             +K + P    +P+ P  P   + P+   EP  P  P + E P    +P+ P      + P
Sbjct  1131  IKPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQP  1190

Query  341   AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +   EP  P  P + + P    +P+ P  P   + P+   EP  P  P
Sbjct  1191  SQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQP  1238


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 48/115 (42%), Gaps = 2/115 (2%)
 Frame = +2

Query  146   PNH--HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNY  319
             P H   P + + P    +P+ P  P   + P+   EP  P  P + E P    +P+ P  
Sbjct  1148  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1207

Query  320   HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                 + P+   EP  P  P + + P    +P+ P  P +++ P+   EP     P
Sbjct  1208  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGQHEQPSQPEEPGQSEKP  1262


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 43/103 (42%), Gaps = 2/103 (2%)
 Frame = +2

Query  197   TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  376
             T     +K + P    +P+ P  P   E P+   EP  P    + + P    +P+ P  P
Sbjct  1125  TYKKSAIKPEEPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP  1184

Query  377   LKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
                + P+   EP  P  P + + P    +P+ P  P  G PEQ
Sbjct  1185  GHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEP--GHPEQ  1225


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 45/107 (42%), Gaps = 0/107 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P   + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1172  PGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1231

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             P    +P+ P  P +++ P+   EP     P +   P+  ++   P+
Sbjct  1232  PGHPEQPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQPADSEQPD  1278



>ref|WP_040539980.1| hypothetical protein, partial [Pedobacter arcticus]
Length=326

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = -1

Query  489  FKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FG  310
             KG  GI G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K   G
Sbjct  216  PKGTDGINGNDGATGPAGAKGADGINGNDGATGPAGPKGTDGINGNDGATGPAGPKGTDG  275

Query  309  IVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
            I G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K
Sbjct  276  INGNDGATGPAGPKGTDGINGNDGATGPAGAKGTDGINGNDGATGPAGPK  325


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  486  KG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGI  307
            KG  GI G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K   GI
Sbjct  199  KGIDGINGNDGAIGPAGPKGTDGINGNDGATGPAGAKGADGINGNDGATGPAGPKGTDGI  258

Query  306  VGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
             G+D   G +  KG  GI G+D   G +  KG  GI G+D   G +  K
Sbjct  259  NGNDGATGPAGPKGTDGINGNDGATGPAGPKGTDGINGNDGATGPAGAK  307



>gb|EPD62247.1| hypothetical protein HMPREF1211_03881 [Streptomyces sp. HGB0020]
Length=563

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            +P  P  P   D PA+  +P  P HP K + PA  ++P MP + +K D P+   +P MP+
Sbjct  467  KPAYPEKPAHPDKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPS  526

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
            HP+K D P+   +P MPSHP+K D+P+  S+P+M
Sbjct  527  HPMKPDMPSHPMKPDMPSHPMKPDTPSHPSKPSM  560


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            D PA+  +P  P HP K D PA  ++P MP HP+K + P+   +P MP++ +K D P+  
Sbjct  478  DKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPSHPMKPDMPSHP  537

Query  350  SEPTMPNHPLKYDSPAMLSEPTM  418
             +P MP+HP+K D+P+  S+P+M
Sbjct  538  MKPDMPSHPMKPDTPSHPSKPSM  560


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 21/133 (16%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY-  331
            +P K + PAM ++P  P +P K   PA  + P  P  P K E PA  ++P  P Y  K  
Sbjct  398  YPAKPEKPAMPAKPVKPAYPEKPAMPAKPAYPEKPAMPAKPEKPAYPAKPEKPAYPEKPA  457

Query  332  --------------------DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  451
                                D PA+  +P  P HP K D PA  ++P MP+HP+K D P+
Sbjct  458  APAYPAHPVKPAYPEKPAHPDKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPS  517

Query  452  MLSEPTMPNHPLN  490
               +P MP+HP+ 
Sbjct  518  HPMKPDMPSHPMK  530


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 12/119 (10%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPA------------MLSEPTMPNHPLKYESPAMLSEPTMP  313
            + PAM ++P  P +P K + PA               +P  P  P   + PA+  +P  P
Sbjct  430  EKPAMPAKPEKPAYPAKPEKPAYPEKPAAPAYPAHPVKPAYPEKPAHPDKPALPMKPDYP  489

Query  314  NYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             +  K D PA  ++P MP HP+K D P+   +P MPSHP+K D P+   +P MP+HP+ 
Sbjct  490  AHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPSHPMKPDMPSHPMKPDMPSHPMK  548


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            D PA    P  P HP+K + P+  ++P  P HP+K E PA   +P  P + +K + PA  
Sbjct  133  DHPAKPEHPVKPEHPVKPEHPSYPAKPEHPKHPVKPEYPAHPVKPEYPAHPVKPEYPAHP  192

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +P  P+ P+    P + + P  P HP+K   PAM  +P  P  P
Sbjct  193  VKPEYPSKPVYPAKPVLPAHPEKPVHPVKPKMPAMPVKPAYPVRP  237


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 61/132 (46%), Gaps = 21/132 (16%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSE------------  301
            P K   PA   +P MP  P   + PAM ++P  P +P K E PA   +            
Sbjct  408  PAKPVKPAYPEKPAMPAKPAYPEKPAMPAKPEKPAYPAKPEKPAYPEKPAAPAYPAHPVK  467

Query  302  ---------PTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
                     P  P   +K D PA  ++P  P HP K D PA   +P MPSHP+K D P+ 
Sbjct  468  PAYPEKPAHPDKPALPMKPDYPAHPAKPDYPAHPAKPDMPAHPMKPDMPSHPMKPDMPSH  527

Query  455  LSEPTMPNHPLN  490
              +P MP+HP+ 
Sbjct  528  PMKPDMPSHPMK  539



>ref|WP_033587337.1| hypothetical protein, partial [Streptococcus sp. GMD3S]
Length=335

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 60/136 (44%), Gaps = 4/136 (3%)
 Frame = +2

Query  83   AFLLISHLLLNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPN  262
            A   IS L      A+P        P++ ++P    +P  P +P++ + PA   +PT P 
Sbjct  86   ALEQISKL----EAAQPEKPAEPEKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPE  141

Query  263  HPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYD  442
             P + E PA   +PT P    + + PA   +PT P  P + + PA    P  P  P + +
Sbjct  142  TPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQPETPAQPEKPAQPETPAQPEKPAQPE  201

Query  443  SPAMLSEPTMPNHPLN  490
             PA    PT P  P  
Sbjct  202  KPAQPENPTQPETPAQ  217


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 6/114 (5%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             +P++ + PA   +PT P  P + + PA   +PT P  P + E PA   +PT P      
Sbjct  123  ENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQP------  176

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
            ++PA   +P  P  P + + PA   +P  P +P + ++PA   +P   + P  G
Sbjct  177  ETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEG  230



>ref|XP_001622881.1| predicted protein [Nematostella vectensis]
 gb|EDO30781.1| predicted protein, partial [Nematostella vectensis]
Length=148

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
            HP     P+++S P++ +HP     P+++S P++ +HP     P+++S P++        
Sbjct  1    HPSLISHPSLISHPSLISHPFLISHPSLISHPSLISHPSLISHPSLISHPSL------IS  54

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
             P+++S P++ +HP     P+++S P++ SHP     P+++S P++
Sbjct  55   HPSLISHPSLISHPSLISHPSLISHPSLISHPSLISHPSLISHPSL  100



>ref|WP_039490054.1| MULTISPECIES: ribonuclease [Pseudoalteromonas]
 gb|KHM46559.1| ribonuclease [Pseudoalteromonas flavipulchra NCIMB 2033 = ATCC 
BAA-314]
 gb|KID34166.1| ribonuclease [Pseudoalteromonas distincta]
Length=1073

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 44/110 (40%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K   PA +  P     P K ++P    EP     P+  E PA +  P       K ++
Sbjct  865  PVKAKEPAKVETPVATEEPTKVEAPVATEEPAKAETPVATEEPAKVETPVATEEPAKVET  924

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P    EP     P+  + PA +  P     P K ++PA   EP     P+
Sbjct  925  PVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPAATEEPAKAETPV  974


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 46/120 (38%), Gaps = 0/120 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+  T +    P K ++P    EP     P+  + PA +  P     P K E+P    EP
Sbjct  872  AKVETPVATEEPTKVEAPVATEEPAKAETPVATEEPAKVETPVATEEPAKVETPVATEEP  931

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                  +  + PA +  P     P K ++PA   EP     P+  + P  +  P     P
Sbjct  932  AKVETPVATEEPAKVETPVATEEPAKVETPAATEEPAKAETPVATEEPTKVETPVATEEP  991


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 40/98 (41%), Gaps = 0/98 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P K ++P    EP     P+  + PA +  P     P K E+P    EP      +  + 
Sbjct  895  PAKAETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEE  954

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  451
            PA +  P     P K ++P    EPT    P+  + PA
Sbjct  955  PAKVETPAATEEPAKAETPVATEEPTKVETPVATEEPA  992



>ref|XP_004916500.1| PREDICTED: salivary glue protein Sgs-4-like [Xenopus (Silurana) 
tropicalis]
Length=282

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P  +  P+M SEP+M + P  +  P+M SEP+M + P  +  P+M SEP+M       + 
Sbjct  176  PSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSM-----HSEP  230

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
            P+M SEP+M + P  +  P+M SEP+M S P  +  P+M SEP+M
Sbjct  231  PSMHSEPSMHSEPSMHSEPSMHSEPSMYSEPSMHSEPSMHSEPSM  275


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +2

Query  161  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  340
            +  + P+M SEP+M + P  +  P+M SEP+M + P  +  P+M SEP+M +    +  P
Sbjct  159  MHSEPPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEP  218

Query  341  AMLSEPTMPNHPLK-YDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
            +M SEP+M + P   +  P+M SEP+M S P  +  P+M SEP+M
Sbjct  219  SMHSEPSMHSEPPSMHSEPSMHSEPSMHSEPSMHSEPSMYSEPSM  263


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 15/120 (13%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM---PNYH--  322
            P  +  P+M SEP+M + P  +  P+M SEP+M + P  +  P+M SEP+M   P+ H  
Sbjct  5    PSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSE  64

Query  323  ----------LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
                      +  + P+M SEP+M + P  +  P+M SEP+M S P  +  P+M SEP+M
Sbjct  65   PPSMHSEPPSMHSEPPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSMHSEPSM  124



>ref|WP_014567818.1| mucin binding protein [Lactobacillus johnsonii]
 gb|AEB93885.1| putative mucin binding protein [Lactobacillus johnsonii DPC 6026]
Length=1534

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 48/121 (40%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P+       P K   P    +PT P  P+K   P    EPT P  P K   P    EP
Sbjct  1324  AEPVQPTKPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEP  1383

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    K   P    +PT P  P K   P    EPT P  P++   P   ++P  P  P
Sbjct  1384  TKPVEPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKP  1443

Query  485   L  487
             +
Sbjct  1444  V  1444


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 46/120 (38%), Gaps = 0/120 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P+       P K   P    +P  P  P K   P    +PT P  P K   P    EPT
Sbjct  1331  KPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEPTKPVEPT  1390

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P    K   P    EPT P  P K   P    EP  P+ P++   P   ++P  P  P+
Sbjct  1391  KPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKPVEPTKPV  1450



>ref|WP_021032005.1| RNase E [Pseudoalteromonas arctica]
 gb|ERG11248.1| RNase E [Pseudoalteromonas arctica A 37-1-2]
Length=1082

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+  T +    P K ++P +  EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  869  AKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEEP  928

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                  +  + PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  929  AKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  988


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 51/120 (43%), Gaps = 0/120 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+  T +    P K ++P    EP     P+  + PA +  P +   P K E+P +  EP
Sbjct  881  AKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  940

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                  +  + PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  941  AKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  1000


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 48/110 (44%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA +  P     P K ++P +  EP     P+  E PA +  P +     K ++
Sbjct  886  PVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVET  945

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P +  EP     P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  946  PVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPV  995


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P K ++P    EP     P+  + PA +  P     P K E+P +  EP      +  + 
Sbjct  868  PAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEE  927

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  928  PAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  976


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 0/106 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + PA +  P     P K ++P +  EP     P+  E PA +  P +     K ++P + 
Sbjct  866  EEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVT  925

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             EP     P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  926  EEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVVTEEPAKVETPV  971



>ref|WP_009013731.1| TolA domain protein [Streptococcus sp. C300]
 gb|EFX56219.1| LPXTG-motif cell wall anchor domain protein [Streptococcus sp. 
C300]
Length=558

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 55/113 (49%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P++ + PA   +PT P  P++ ++P    +P  P  P + E+PA   +P  P   ++ 
Sbjct  173  ETPVQPEKPAQSEKPTQPEKPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQP  232

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            + P    +P  P  P + ++PA   +P  P  P++ + PA   +P  P  P+ 
Sbjct  233  EKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQ  285


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 54/113 (48%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + + PA   +P  P  P++ + PA   +PT P  P++ E+P    +P  P    + 
Sbjct  155  EKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPEKPVQPETPTQPEKPAQPEKPAQP  214

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            ++PA   +P  P  P++ + P    +P  P  P + ++PA   +P  P  P+ 
Sbjct  215  ETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQ  267


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 56/122 (46%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+P T +    P + + PA   +P  P  P + + PA    P  P +P++ E PA   +P
Sbjct  260  AQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKP  319

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P    + ++PA   +P  P  P + + PA   +P  P  P + + PA   +PT P  P
Sbjct  320  AQPEKPAQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPEKPAQPEKPAQPEKPTQPEKP  379

Query  485  LN  490
              
Sbjct  380  AQ  381


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 53/113 (47%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + ++PA   +P  P  P + + PA   +P  P  P++ E PA   +PT P   ++ 
Sbjct  137  EKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPEKPVQP  196

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            ++P    +P  P  P + ++PA   +P  P  P++ + P    +P  P  P  
Sbjct  197  ETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQ  249


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 53/113 (47%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P++ ++P    +P  P  P + ++PA   +P  P  P++ E P    +P  P    + 
Sbjct  191  EKPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQP  250

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            ++PA   +P  P  P++ + PA   +P  P  P++ + PA   +P  P  P  
Sbjct  251  ETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQ  303


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 51/113 (45%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + ++PA   +P  P  P++ + PA   +P  P  P++ E PA   +P  P    + 
Sbjct  245  EKPAQPETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQP  304

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            ++P    +P  P  P + + PA    P  P  P + ++PA   +P  P  P  
Sbjct  305  ENPVQPEKPAEPEKPAQPEKPAQPETPAQPEKPAQPETPAQPEKPAQPEKPAQ  357


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 52/113 (46%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + ++PA   +P  P  P++ + P    +P  P  P + E+PA   +P  P   ++ 
Sbjct  209  EKPAQPETPAQPEKPAEPEKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQP  268

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            + PA   +P  P  P++ + PA   +P  P  P + ++P    +P  P  P  
Sbjct  269  EKPAQPEKPAQPEKPVQPEKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQ  321


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            E   P  P + ++PA   +P  P  P + E PA   +P  P   ++ + PA   +PT P 
Sbjct  132  EAAQPEKPAQPENPAQPEKPVQPEKPAQPEKPAQPEKPAQPETPVQPEKPAQSEKPTQPE  191

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             P++ ++P    +P  P  P + ++PA   +P  P  P+ 
Sbjct  192  KPVQPETPTQPEKPAQPEKPAQPETPAQPEKPAEPEKPVQ  231


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 50/113 (44%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P++ + P    +P  P  P + ++PA   +P  P  P++ E PA   +P  P   ++ 
Sbjct  227  EKPVQPEKPVQPEKPAQPEKPAQPETPAQPEQPAQPETPVQPEKPAQPEKPAQPEKPVQP  286

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            + PA   +P  P  P + ++P    +P  P  P + + PA    P  P  P  
Sbjct  287  EKPAQPEQPAQPETPAQPENPVQPEKPAEPEKPAQPEKPAQPETPAQPEKPAQ  339



>ref|WP_035425692.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=1006

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 40/95 (42%), Gaps = 6/95 (6%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EPT P+ P +   P    EPT P  P++   P    EPT P        PA  SEPT P 
Sbjct  831  EPTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPG------KPAQPSEPTKPE  884

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             P     PA  SEPT P      + P   +E   P
Sbjct  885  EPTTPGKPAQPSEPTKPKEQTIPNKPNQSNETESP  919


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 35/88 (40%), Gaps = 0/88 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P   D P   S+PT P  P     P   SEPT P  P     PA  SEPT P        
Sbjct  832  PTTPDKPTQPSKPTKPEEPTTPGKPVQPSEPTKPEEPTTPGKPAQPSEPTKPEEPTTPGK  891

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMP  421
            PA  SEPT P      + P   +E   P
Sbjct  892  PAQPSEPTKPKEQTIPNKPNQSNETESP  919



>gb|KGK34316.1| hypothetical protein JL09_g6537, partial [Pichia kudriavzevii]
Length=112

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (44%), Gaps = 0/82 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + D P  + EPT  + P   D P  + +PT  + P + + P  + +PT  +     
Sbjct  1    DEPTEVDDPTEVDEPTEVDDPTGVDDPTEVDDPTEVDDPTEVDDPTEVDDPTEVDDTTGV  60

Query  332  DSPAMLSEPTMPNHPLKYDSPA  397
            D P  + EPT  + P   D P 
Sbjct  61   DEPTEVDEPTGVDEPTGVDDPT  82


 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (44%), Gaps = 6/91 (7%)
 Frame = +2

Query  206  NHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKY  385
            + P + D P  + EPT  + P   + P  + +PT      + D P  + +PT  + P + 
Sbjct  1    DEPTEVDDPTEVDEPTEVDDPTGVDDPTEVDDPT------EVDDPTEVDDPTEVDDPTEV  54

Query  386  DSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
            D    + EPT    P   D P  + +PT  +
Sbjct  55   DDTTGVDEPTEVDEPTGVDEPTGVDDPTADD  85


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 39/82 (48%), Gaps = 0/82 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            D P  + +PT  + P + D P  + +PT  + P + + P  + +PT  +   + D    +
Sbjct  1    DEPTEVDDPTEVDEPTEVDDPTGVDDPTEVDDPTEVDDPTEVDDPTEVDDPTEVDDTTGV  60

Query  350  SEPTMPNHPLKYDSPAMLSEPT  415
             EPT  + P   D P  + +PT
Sbjct  61   DEPTEVDEPTGVDEPTGVDDPT  82



>ref|WP_003642311.1| cell surface protein precursor [Lactobacillus plantarum]
 gb|EFK27998.1| LPXTG-motif cell wall anchor domain protein [Lactobacillus plantarum 
subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437]
Length=1357

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  P  P + + P    +P+ P  P + E P+   EP  P      + P+   EP  P 
Sbjct  1163  EPGQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGQP------EQPSQPEEPGHPE  1216

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQPEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 41/89 (46%), Gaps = 0/89 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + + 
Sbjct  1164  PGQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEE  1223

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1224  PGQPEQPSQPEEPGQSEKPGELQKPSQPA  1252



>ref|WP_004897948.1| mucin binding protein [Lactobacillus johnsonii]
 gb|EGP12982.1| internalin, putative [Lactobacillus johnsonii pf01]
Length=1534

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 48/121 (40%), Gaps = 0/121 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P+       P K   P    +PT P  P+K   P    EPT P  P K   P    EP
Sbjct  1324  AEPVQPTKPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEP  1383

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    K   P    +PT P  P K   P    EPT P  P++   P   ++P  P  P
Sbjct  1384  TKPVEPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKP  1443

Query  485   L  487
             +
Sbjct  1444  V  1444


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 46/120 (38%), Gaps = 0/120 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P+       P K   P    +P  P  P K   P    +PT P  P K   P    EPT
Sbjct  1331  KPVEPTKPVQPTKPVKPTKPVQPIKPVKPTKPVEPTKPVKPTKPVEPTKPVEPTKPVEPT  1390

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P    K   P    EPT P  P K   P    EP  P+ P++   P   ++P  P  P+
Sbjct  1391  KPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVEPVQPTKPIEPTKPVQPTKPVEPTKPV  1450



>gb|ACF42267.1| neurofilament triplet H1 protein [Soft-shelled turtle iridovirus]
Length=192

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 38/107 (36%), Gaps = 0/107 (0%)
 Frame = +2

Query  143  MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
            +    P+K  SP     P     P+K  SP     P     P+K +SP     P      
Sbjct  78   VKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSP  137

Query  323  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            +K  SP     P     P+K  SP     P     P+K  SPA   +
Sbjct  138  VKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAKRRQ  184


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 37/111 (33%), Gaps = 0/111 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K  SP     P     P+K  SP     P     P+K +SP     P      +K  S
Sbjct  71   PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKS  130

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            P     P     P+K  SP     P     P+K  SP     P     P  
Sbjct  131  PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAK  181


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/149 (23%), Positives = 51/149 (34%), Gaps = 10/149 (7%)
 Frame = +2

Query  74   TIGAFLLISHLLLNSSMARPITMMPNHHPLKYD----------SPAMLSEPTMPNHPLKY  223
            ++GA L    +  +S + +  +++    P+K            SP     P     P+K 
Sbjct  27   SLGAMLSAPVVRASSPVVKRKSLVKRKSPVKRSPLKKRSQTRTSPVKRKSPVKRKSPVKR  86

Query  224  DSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAML  403
             SP     P     P+K +SP     P      +K  SP     P     P+K  SP   
Sbjct  87   KSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKR  146

Query  404  SEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              P     P+K  SP     P     P+ 
Sbjct  147  KSPVKRKSPVKRKSPVKRKSPVKRKSPVK  175



>ref|WP_039167092.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ47170.1| hypothetical protein JL04_11255 [Gallibacterium anatis]
Length=1782

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/111 (23%), Positives = 53/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  D P + ++P +   P+    P    +P + N      
Sbjct  865  QPVTEDQPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVAN------  918

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P   + P+  + PA  ++P + N P+
Sbjct  919  QPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPV  969


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA+ ++P + N P+    P + ++P      +  
Sbjct  894   NQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVA  953

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA  ++P + N P+    P + ++P     P+  + PA+ ++P + N P+
Sbjct  954   NQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPV  1005


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P     P+  + PA  ++P + N P+    P + ++P      +  
Sbjct  930   NQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVA  989

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  990   NQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPV  1041


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  D P + ++P +   P+  + P    +P + N P     P + ++P      +  +
Sbjct  883  QPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVAN  942

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA  ++P + N P     P + ++P + + P+  + PA   +P + N P
Sbjct  943  QPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQP  992


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/110 (21%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P     P + ++P +   P+    PA+ ++P +    +   
Sbjct  1069  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAET  1128

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              PA+ ++P + N P+    P + ++P     P+  + P   ++P + N P
Sbjct  1129  QPAVEAQPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQP  1178


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 53/110 (48%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P + + P+  + P + ++P + N P+    P + ++P +    +  +
Sbjct  871  QPVVETQPEVATQPVVEDQPVVANQPVVETQPVVTNQPVAEVQPVVANQPAVETQPVVAN  930

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             P   ++P + N P     P + ++P   + P+  + P + ++P + N P
Sbjct  931  QPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVANQP  980


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P + N P+    P + ++P     P+    PA  ++P + N  +   
Sbjct  913   QPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEA  972

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P     P+  + PA+ ++P + + P+    P + ++P +   P+
Sbjct  973   QPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPV  1023


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 52/112 (46%), Gaps = 0/112 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P     P + ++P     P+  + PA  ++P + N P     P + ++P +    +  
Sbjct  918   NQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVTNQPVVEAQPVVA  977

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             + PA   +P + N P     P + ++P + + P   + PA+ ++P + N P+
Sbjct  978   NQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPV  1029


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P+    P + ++      P+    P + ++P + N      
Sbjct  1033  QPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVET  1092

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+  + PA+ ++P + + P+    PA+ ++P + N P+
Sbjct  1093  QPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVANQPV  1143


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/111 (22%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA  ++P + N P+    P + ++P     P+    PA+ ++P + N      
Sbjct  949   QPVVANQPAAEAQPVVTNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVAN------  1002

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  1003  QPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPV  1053


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P + ++P + N P+    P + ++P     P+    PA+ ++P +    +   
Sbjct  1135  QPVVANQPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEA  1194

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              P ++++P     P+  D P + ++P   + P+  + PA+ ++P +
Sbjct  1195  QPVVVNQPVAETQPIVKDQPVVANQPVTEAQPVVSNQPAVEAQPVV  1240


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 62/124 (50%), Gaps = 3/124 (2%)
 Frame = +2

Query  116   SSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML  295
             ++ A+P+     + P+    P + ++P     P+  + PA+ ++P + N P+    P + 
Sbjct  957   AAEAQPVV---TNQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVA  1013

Query  296   SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
             ++P +    +  + P + ++P + N P+    P + ++P + + P+  +  A  ++P + 
Sbjct  1014  NQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAETQPVVA  1073

Query  476   NHPL  487
             N P+
Sbjct  1074  NQPV  1077


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P   + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N      
Sbjct  1009  QPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVANQLAAET  1068

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P   + PA+ ++P + + P+    P + ++P +   P+
Sbjct  1069  QPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPV  1119


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + P + ++P + N P+    P + ++P +    +  
Sbjct  1002  NQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEAQPVVANQPVVETQPVVA  1061

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +  A  ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1062  NQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1112


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  152   HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             + P+    P + ++P +   P+  + P   ++P + N P     P + ++P      +  
Sbjct  906   NQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPAAEAQPVVANQPAAEAQPVVT  965

Query  332   DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             + P + ++P + N P     P + ++P + + P+  + P + ++P + N P
Sbjct  966   NQPVVEAQPVVANQPAAEVQPVVANQPAVEAQPVVANQPVVEAQPEVANQP  1016


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/117 (21%), Positives = 58/117 (50%), Gaps = 6/117 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPL------KYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPN  316
              P+  + PA+ ++P + N P+        + PA+ ++P + N P+    P + ++P +  
Sbjct  985   QPVVANQPAVEAQPVVANQPVVEAQPEVANQPAVETQPVVANQPVVEAQPVVTNQPVVEA  1044

Query  317   YHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               +  + P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  1045  QPVVANQPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1101


 Score = 49.3 bits (116),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P   + PA+ ++P + N P+    P + ++P +   P+    P   ++P +    +  +
Sbjct  1081  QPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVAETQPAVEAQPVVAN  1140

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              P + ++P + N P+    P + ++P   + P+  + PA+ ++P +
Sbjct  1141  QPVVETQPVVTNQPVAEVQPVVANQPVTEAQPVVSNQPAVEAQPVV  1186



>ref|XP_006659167.1| PREDICTED: uncharacterized protein LOC102702307 [Oryza brachyantha]
Length=331

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 60/131 (46%), Gaps = 3/131 (2%)
 Frame = +2

Query  104  LLLNSSMARPITMMPNHHP---LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLK  274
            + + S+ A+P+     H P   +    P  L+ P   N P   + P M S+PT  N PL+
Sbjct  194  VRMTSAHAQPMKTTTIHRPNSTITVTKPIGLNRPLQSNKPTGLNRPLMSSKPTGLNRPLQ  253

Query  275  YESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
               P  L+ P   N     + P   ++PT  N PL+ + P  L+ P M S P   + P  
Sbjct  254  SNKPTGLNRPLQSNKPTGLNRPLQSNKPTGLNRPLQSNKPTGLNRPLMSSKPTGLNRPMQ  313

Query  455  LSEPTMPNHPL  487
             ++PT  N PL
Sbjct  314  SNKPTGQNRPL  324



>ref|WP_039145306.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ41732.1| hypothetical protein JP30_03940, partial [Gallibacterium anatis 
IPDH697-78]
Length=660

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/110 (22%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P + ++P + N P     P + ++P +   P+    PA  ++P + N  +  +
Sbjct  7    QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTN  66

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA+ ++P + N P+    P + ++P + + P+    P + ++P + N P
Sbjct  67   QPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQP  116


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N     
Sbjct  60   NQPVVTNQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAE  119

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  120  TQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  171


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA  ++P + N P+  + PA+ ++P + N P+    P + ++P +    +   
Sbjct  43   QPVIANQPAAETQPVVANQPVVTNQPAVETQPVVANQPVVETQPVVANQPAVETQPVVAT  102

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P + N P     P + ++P + + P+    P + ++P +   P+
Sbjct  103  QPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPV  153


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P     P + ++P +   P+  + PA  ++P + N P+    PA+ ++P + N  +  
Sbjct  24   NQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPAVETQPVVANQPVVE  83

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P +   P+    P + ++P + + P     P + ++P + N P+
Sbjct  84   TQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPV  135


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            PA+ ++P + N P+    P + ++P +   P+    P + ++P + N       P + ++
Sbjct  2    PAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQ  61

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P + N P     P + ++P + + P+  + PA+ ++P +   P+
Sbjct  62   PVVTNQPAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPV  105


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P + ++P + N P     P + ++P +   P+    PA  ++P + N  +  +
Sbjct  73   QPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQPVVTN  132

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P    +P + N P     P + ++P + + P+  + P    +P + N P+
Sbjct  133  QPVAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVAEVQPVVANQPV  183


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P + N P     P + ++P + N P+    P + ++P +    +  +
Sbjct  97   QPVVATQPVVETQPVIANQPAAETQPVVANQPVVTNQPVAEVQPVVANQPAVETQPVVAN  156

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P + N P+    P + ++P + + P+    P   ++P + + P+
Sbjct  157  QPVVETQPVVTNQPVAEVQPVVANQPVVETQPVAETQPVAETQPVVEDQPV  207



>ref|WP_024002328.1| cell surface protein precursor [Lactobacillus plantarum]
 gb|ETF12868.1| cell surface protein precursor [Lactobacillus plantarum 4_3]
Length=1357

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             +P  P HP   + P+   EP  P  P + E P    +P+ P    + + P+   EP  P 
Sbjct  1160  KPEEPGHP---EQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGHPE  1216

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/90 (27%), Positives = 41/90 (46%), Gaps = 3/90 (3%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             HP   + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + +
Sbjct  1166  HP---EQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPE  1222

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
              P    +P+ P  P + + P  L +P+ P+
Sbjct  1223  EPGQHEQPSQPEEPGQSEKPGELQKPSQPA  1252


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/96 (24%), Positives = 41/96 (43%), Gaps = 0/96 (0%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  P  P + + P    +P+ P  P   E P+   EP  P    + + P    +P+ P 
Sbjct  1163  EPGHPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPE  1222

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
              P +++ P+   EP     P +   P+  ++   P+
Sbjct  1223  EPGQHEQPSQPEEPGQSEKPGELQKPSQPADSEQPD  1258



>gb|EMC77213.1| Ovarian abundant message protein, partial [Columba livia]
Length=190

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 47/110 (43%), Gaps = 1/110 (1%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML-SEPTMPNYHLKYD  334
            P     P +L  PT+  +P     P +L   T P HP     P +L   PT+  +     
Sbjct  81   PTVLGHPTLLGHPTLSGYPTLLRHPTILGHLTSPGHPTLLGHPTLLLGHPTLLGHPTSPG  140

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              A+L  PT+  HP     P +L  PT P HP     P +  +PT+  HP
Sbjct  141  HSAILGYPTVQRHPTLLGHPTILGHPTSPGHPTLLGHPTLSGQPTLLGHP  190


 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 45/105 (43%), Gaps = 6/105 (6%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             PT+  HP     P +L  PT P H      P +L  PT+   H     P +L  PT+  
Sbjct  1    HPTLLGHPTVLGHPTVLGHPTSPGHSTILGYPTVLEHPTLLGQH-----PTLLENPTLLE  55

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP-LNGSPE  502
            HP     P +L  P  P H      P +L  PT+  HP L+G P 
Sbjct  56   HPNVLGHPTILGHPASPGHSTILGDPTVLGHPTLLGHPTLSGYPT  100


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 47/110 (43%), Gaps = 1/110 (1%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHP-LKYESPAMLSEPTMPNYHLKY  331
            HP     P +L  PT+  HP       +L  PT+  HP L  + P +L  PT+  +    
Sbjct  1    HPTLLGHPTVLGHPTVLGHPTSPGHSTILGYPTVLEHPTLLGQHPTLLENPTLLEHPNVL  60

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
              P +L  P  P H      P +L  PT+  HP     P +L  PT+  H
Sbjct  61   GHPTILGHPASPGHSTILGDPTVLGHPTLLGHPTLSGYPTLLRHPTILGH  110


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 46/115 (40%), Gaps = 7/115 (6%)
 Frame = +2

Query  161  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNH------PLKYESPAMLSEPTMPNYH  322
            L    P +L  PT+  HP     P +L  P  P H      P     P +L  PT+  Y 
Sbjct  40   LLGQHPTLLENPTLLEHPNVLGHPTILGHPASPGHSTILGDPTVLGHPTLLGHPTLSGYP  99

Query  323  LKYDSPAMLSEPTMPNHPLKYDSPA-MLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                 P +L   T P HP     P  +L  PT+  HP      A+L  PT+  HP
Sbjct  100  TLLRHPTILGHLTSPGHPTLLGHPTLLLGHPTLLGHPTSPGHSAILGYPTVQRHP  154


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 45/119 (38%), Gaps = 13/119 (11%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNH-------------PLKYDSPAMLSEPTMPNHPLKYESPAML  295
            HP     P +L  PT P H              L    P +L  PT+  HP     P +L
Sbjct  7    HPTVLGHPTVLGHPTSPGHSTILGYPTVLEHPTLLGQHPTLLENPTLLEHPNVLGHPTIL  66

Query  296  SEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              P  P +      P +L  PT+  HP     P +L  PT+  H      P +L  PT+
Sbjct  67   GHPASPGHSTILGDPTVLGHPTLLGHPTLSGYPTLLRHPTILGHLTSPGHPTLLGHPTL  125



>gb|EFB22434.1| hypothetical protein PANDA_020193 [Ailuropoda melanoleuca]
Length=122

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             +P   + PT+P  P    +P  LS PT+P  P    +P + + PT+        +P +L
Sbjct  6    TAPGAPTAPTIPTAPTVPTAPTALSAPTIPTAPTILTAPTIPTAPTILTAPTIPTAPTIL  65

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            + PT+P  P    +P + + PT+ + P    +P +L+ PT+P  P
Sbjct  66   TAPTIPTAPTILTAPTIPTAPTILTAPTIPTAPTILTAPTIPTAP  110


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 54/105 (51%), Gaps = 6/105 (6%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
             +P  LS PT+P       +P +L+ PT+P  P    +P + + PT+        +P +L
Sbjct  24   TAPTALSAPTIPT------APTILTAPTIPTAPTILTAPTIPTAPTILTAPTIPTAPTIL  77

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            + PT+P  P    +P + + PT+ + P    +P +L+ PT+P  P
Sbjct  78   TAPTIPTAPTILTAPTIPTAPTILTAPTIPTAPTILTAPTIPTAP  122



>ref|WP_033037822.1| ribonuclease [Pseudoalteromonas sp. S3431]
 gb|KDC55995.1| ribonuclease [Pseudoalteromonas sp. S3431]
Length=1061

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 49/107 (46%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
            K ++P +  +PT    P+  + PA +  P +   P K E+PA+  +P      +  + PA
Sbjct  879  KIEAPVVTEQPTKVEAPVVTEQPAKVEAPAVTEQPAKVEAPAVTEQPAKVEAPVVTEQPA  938

Query  344  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             +  P +   P K ++P +  +P     P+  + PA +  P +   P
Sbjct  939  KVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQP  985


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +  P +   P K ++PA+  +P     P   E PA +  P +     K ++
Sbjct  883  PVVTEQPTKVEAPVVTEQPAKVEAPAVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKVEA  942

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
            P +  +P     P+  + PA +  P +   P K ++P +  +P
Sbjct  943  PVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQP  985



>ref|WP_000300357.1| hypothetical protein, partial [Streptococcus sp. GMD4S]
 gb|EKA08096.1| cell wall surface anchor family protein, partial [Streptococcus 
sp. GMD4S]
Length=459

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 56/115 (49%), Gaps = 0/115 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + + P    +PT P +P++ + PA   +P  P  P + E+PA   +P  P    + 
Sbjct  176  EKPAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQP  235

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
            ++PA   +PT P +P++ ++PA   +P  P  P + + P     P  P  P+  S
Sbjct  236  ETPAQPEKPTQPENPVQPETPAQPEKPAQPEKPAQPEKPTQPENPAQPEKPITSS  290


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + ++P    +P  P  P + + P    +PT P +P++ E PA   +P  P    + 
Sbjct  158  EKPTQPENPVQPEKPAQPEKPAQPEKPVQPEKPTQPENPVQPEKPAQPEKPAQPEKPTQP  217

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            ++PA   +P  P  P + ++PA   +PT P +P++ ++PA   +P  P  P
Sbjct  218  ETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQPETPAQPEKPAQPEKP  268


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (50%), Gaps = 6/113 (5%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + + PA   +PT P +P++ + PA   +P  P  P++ E       PT P   ++ 
Sbjct  146  EKPTQPEKPAQPEKPTQPENPVQPEKPAQPEKPAQPEKPVQPEK------PTQPENPVQP  199

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            + PA   +P  P  P + ++PA   +P  P  P + ++PA   +PT P +P+ 
Sbjct  200  EKPAQPEKPAQPEKPTQPETPAQPEKPAQPEKPTQPETPAQPEKPTQPENPVQ  252



>ref|WP_033615607.1| cell wall anchor protein [Lactobacillus plantarum]
Length=1357

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  P  P + + P    +P+ P  P + E P+   EP  P      + P+   EP  P 
Sbjct  1163  EPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQP------EQPSQPEEPGHPE  1216

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQPEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 41/89 (46%), Gaps = 0/89 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + + 
Sbjct  1164  PGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEE  1223

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1224  PGQPEQPSQPEEPGQSEKPGELQKPSQPA  1252



>ref|WP_025288912.1| hypothetical protein [Bibersteinia trehalosi]
Length=2322

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 39/141 (28%), Positives = 53/141 (38%), Gaps = 25/141 (18%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD-  334
            P +  +P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  194  PEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTT  253

Query  335  -----------------------SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDS  445
                                   +P   SEP  P  P +   P   +EP  P+ P +   
Sbjct  254  PEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSE  313

Query  446  PAMLSEPTMPNHPLNGS-PEQ  505
            P   SEP  P+ P   S PEQ
Sbjct  314  PEQPSEPEQPSEPEQPSEPEQ  334


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 53/141 (38%), Gaps = 28/141 (20%)
 Frame = +2

Query  167  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  346
            YD P    +P+ P  P + + P    +P+ P  P + E P+   +P+ P    + + P+ 
Sbjct  176  YDQPIEPEQPSEPEQPTEPEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  235

Query  347  LSEPTMPNHP---------------------------LKYDSPAMLSEPTMPSHPLKYDS  445
              +P+ P  P                            +  +P   SEP  P+ P +   
Sbjct  236  PEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSE  295

Query  446  PAMLSEPTMPNHPLNGS-PEQ  505
            P   +EP  P  P   S PEQ
Sbjct  296  PEQPTEPEQPTEPEQPSEPEQ  316


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 48/139 (35%), Gaps = 30/139 (22%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNH------------------------  265
            P +   P   SEP  P+ P +   P   SEP  P+                         
Sbjct  212  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSE  271

Query  266  ------PLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  427
                  P +   P   +EP  P+   +   P   +EP  P+ P +   P   SEP  PS 
Sbjct  272  PEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSEPEQPSEPEQPSEPEQPSE  331

Query  428  PLKYDSPAMLSEPTMPNHP  484
            P +  +P   SEP  P  P
Sbjct  332  PEQPTAPGQPSEPEQPTEP  350


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 41/147 (28%), Positives = 50/147 (34%), Gaps = 31/147 (21%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSE------------  301
            P +   P   SEP  P+ P +   P   SEP  P+ P +   P   SE            
Sbjct  200  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTTPEQPPE  259

Query  302  ------------------PTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  427
                              P  P+   +   P   SEP  P  P +   P   SEP  PS 
Sbjct  260  PEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSEPEQPSE  319

Query  428  PLKYDSPAMLSEPTMPNHPLNGS-PEQ  505
            P +   P   SEP  P  P   S PEQ
Sbjct  320  PEQPSEPEQPSEPEQPTAPGQPSEPEQ  346



>ref|WP_024593398.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1070

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 47/109 (43%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P K ++P +  EP     P+  + PA +  P     P K E+P +  EP      +  + 
Sbjct  868  PAKVETPVVTEEPAKVEAPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEE  927

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  928  PAKVETPVVTEEPTKVEAPVVTEEPAKVEAPVVTEEPAKVETPVVTEEP  976


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 47/110 (43%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA +  P     P K ++P    EP     P+  E PA +  P       K ++
Sbjct  874  PVVTEEPAKVEAPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVET  933

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P +  EPT    P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  934  PVVTEEPTKVEAPVVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVETPV  983


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA +  P     P K ++P +  EP     P+  E PA +  P +     K ++
Sbjct  886  PVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEEPAKVETPVVTEEPTKVEA  945

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
            P +  EP     P+  + PA +  P +   P K ++P +  EP
Sbjct  946  PVVTEEPAKVEAPVVTEEPAKVETPVVTEEPAKVETPVVTEEP  988



>ref|XP_002940580.2| PREDICTED: uncharacterized protein LOC100379885 [Xenopus (Silurana) 
tropicalis]
Length=8401

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 8/96 (8%)
 Frame = +2

Query  203   PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             P H  K ++PAM+S+   P    K+  PAM+S+   P    K++ PAM+S+   P    K
Sbjct  1633  PGHGRKLNNPAMVSQEAWPWK--KFNDPAMVSQEAWP--WKKFNDPAMVSQEAWPWK--K  1686

Query  383   YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             ++ PAM+S+   P    K++ PAM+S+   P   LN
Sbjct  1687  FNDPAMVSQEAWPWK--KFNDPAMVSQEAWPWKKLN  1720



>gb|AHG85653.1| hypothetical protein F544_4210 [Bibersteinia trehalosi USDA-ARS-USMARC-190]
Length=2315

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/141 (28%), Positives = 53/141 (38%), Gaps = 25/141 (18%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD-  334
            P +  +P   SEP  P+ P +   P   SEP  P+ P +   P   SEP  P+   +   
Sbjct  187  PEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTT  246

Query  335  -----------------------SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDS  445
                                   +P   SEP  P  P +   P   +EP  P+ P +   
Sbjct  247  PEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSE  306

Query  446  PAMLSEPTMPNHPLNGS-PEQ  505
            P   SEP  P+ P   S PEQ
Sbjct  307  PEQPSEPEQPSEPEQPSEPEQ  327


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 53/141 (38%), Gaps = 28/141 (20%)
 Frame = +2

Query  167  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAM  346
            YD P    +P+ P  P + + P    +P+ P  P + E P+   +P+ P    + + P+ 
Sbjct  169  YDQPIEPEQPSEPEQPTEPEQPTAPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSE  228

Query  347  LSEPTMPNHP---------------------------LKYDSPAMLSEPTMPSHPLKYDS  445
              +P+ P  P                            +  +P   SEP  P+ P +   
Sbjct  229  PEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSEPEQPTAPEQPSEPEQPTEPEQPSE  288

Query  446  PAMLSEPTMPNHPLNGS-PEQ  505
            P   +EP  P  P   S PEQ
Sbjct  289  PEQPTEPEQPTEPEQPSEPEQ  309


 Score = 49.7 bits (117),  Expect = 0.001, Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 48/139 (35%), Gaps = 30/139 (22%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNH------------------------  265
            P +   P   SEP  P+ P +   P   SEP  P+                         
Sbjct  205  PEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPSEPEQPTTPEQPPEPEQPSEPEQPSE  264

Query  266  ------PLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSH  427
                  P +   P   +EP  P+   +   P   +EP  P+ P +   P   SEP  PS 
Sbjct  265  PEQPTAPEQPSEPEQPTEPEQPSEPEQPTEPEQPTEPEQPSEPEQPSEPEQPSEPEQPSE  324

Query  428  PLKYDSPAMLSEPTMPNHP  484
            P +  +P   SEP  P  P
Sbjct  325  PEQPTAPGQPSEPEQPTEP  343



>gb|AHM26124.1| RGI orf47L-like protein [Frog virus 3]
Length=187

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 37/102 (36%), Gaps = 0/102 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K  SP     P     P+K  SP     P     P+K +SP     P      +K  S
Sbjct  78   PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKS  137

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            P     P     P+K  SP     P     P+K  SPA   +
Sbjct  138  PVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAKRRQ  179


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 38/114 (33%), Gaps = 1/114 (1%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               PLK  S  M + P     P+K  SP     P     P+K +SP     P      +K
Sbjct  64   KRSPLKKRS-QMRTSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVK  122

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP     P     P+K  SP     P     P+K  SP     P     P  
Sbjct  123  RKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPVKRKSPAK  176



>ref|WP_023599945.1| mucin binding protein [Lactobacillus johnsonii]
 gb|AHA97899.1| mucin binding protein [Lactobacillus johnsonii N6.2]
Length=1579

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 46/119 (39%), Gaps = 0/119 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P+       P K   P    EPT P  P K   P    +PT P  P+K   P    +PT
Sbjct  1331  KPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTKPVQPT  1390

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P   +K   P     PT P  P K   P    EPT P  P K   P    EPT P  P
Sbjct  1391  KPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEPTKPVQP  1449


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++   P   ++P  P  P++   P   ++P  P  P++   P   ++P  P   +K   
Sbjct  1326  PVQPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTK  1385

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  P  P+K   P   ++P  P+ P+K   P   ++P  P  P+
Sbjct  1386  PVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPI  1435


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++   P   ++P  P  P++   P   ++P  P  P+K   P   ++P  P   +K   
Sbjct  1344  PVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPTK  1403

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  P  P+K   P   ++P  P+ P++   P   ++P  P  P+
Sbjct  1404  PVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEPTKPVQPTKPV  1453


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 45/120 (38%), Gaps = 0/120 (0%)
 Frame = +2

Query  125   ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
             A P+       P K   P    +PT P  P K   P    EPT P  P K   P    +P
Sbjct  1324  AEPVQPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKP  1383

Query  305   TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             T P    K   P    +PT P  P K   P    +PT P  P K   P    EPT P  P
Sbjct  1384  TKPVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEP  1443


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 49/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P++   P   ++P  P  P+K   P   ++P  P  P+K   P   ++P  P   +K   
Sbjct  1362  PVEPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTK  1421

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  P  P++   P   ++P  P+ P++   P    +P  P  P+
Sbjct  1422  PVEPTKPVQPTKPIEPTKPVEPTKPVQPTKPVEPTKPVKSIKPVQPTKPV  1471


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 0/110 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P+K   P   ++P  P  P+K   P   ++P  P  P+K   P   ++P  P   ++   
Sbjct  1380  PVKPTKPVQPTKPVEPIKPVKPTKPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTK  1439

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P   ++P  P  P++   P    +P  P+ P+K   P   ++P     P+
Sbjct  1440  PVEPTKPVQPTKPVEPTKPVKSIKPVQPTKPVKPTKPVEPTKPVQTTKPV  1489


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 44/116 (38%), Gaps = 0/116 (0%)
 Frame = +2

Query  128   RPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPT  307
             +P+       P K   P    EPT P  P K   P    +PT P  P K   P    +PT
Sbjct  1343  KPVQPTKPVEPTKPVQPTKPVEPTKPVQPTKPVEPIKPVKPTKPVQPTKPVEPIKPVKPT  1402

Query  308   MPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              P    K   P    +PT P  P K   P    EPT P  P K   P    EPT P
Sbjct  1403  KPVRPTKPVEPTKPVKPTKPVEPTKPVQPTKPIEPTKPVEPTKPVQPTKPVEPTKP  1458



>gb|KFL87002.1| hypothetical protein LpDm1_2602 [Lactobacillus plantarum]
Length=1329

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  P  P + + P    +P+ P  P + E P+   EP  P      + P+   EP  P 
Sbjct  1135  EPGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQP------EQPSQPEEPGHPE  1188

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1189  QPSQPEEPGQPEQPSQPEEPGQSEKPGELQKPSQP  1223


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 41/89 (46%), Gaps = 0/89 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P+   EP  P  P + + P    +P+ P  P + E P+   EP  P    + + 
Sbjct  1136  PGQPEQPSQPEEPGHPEQPSQPEEPGQPEQPSQPEEPGQPEQPSQPEEPGHPEQPSQPEE  1195

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1196  PGQPEQPSQPEEPGQSEKPGELQKPSQPA  1224



>ref|XP_005531742.1| PREDICTED: collagen alpha-1(XXIV) chain-like [Pseudopodoces humilis]
Length=202

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 47/104 (45%), Gaps = 0/104 (0%)
 Frame = -1

Query  474  GIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSD  295
            GI G   I GES   G  G+ G   I GES  +G  GI G   I GES      GI G  
Sbjct  53   GIRGESGICGESGICGESGVHGKSGIHGESGIRGESGICGESGIHGESGIHGESGIRGES  112

Query  294  SIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
             I G+S   G  GI G     GES  +G  GI G   I GES  
Sbjct  113  RIHGESRIHGKSGIPGESGSRGESGIRGESGIRGESRIHGESRI  156


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 47/105 (45%), Gaps = 0/105 (0%)
 Frame = -1

Query  474  GIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSD  295
            G+ G   I GES  +G  GI G   I GES   G  GI G   I GES      GI G  
Sbjct  71   GVHGKSGIHGESGIRGESGICGESGIHGESGIHGESGIRGESRIHGESRIHGKSGIPGES  130

Query  294  SIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
               G+S  +G  GI G   I GES   G  GI G     GES  +
Sbjct  131  GSRGESGIRGESGIRGESRIHGESRIHGKSGIPGESGSRGESGIR  175


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 47/106 (44%), Gaps = 0/106 (0%)
 Frame = -1

Query  477  FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGS  298
             GI G   I G+S   G  GI G   I GES   G  G+ G   I GES  +   GI G 
Sbjct  34   LGICGESGIRGKSGVHGKSGIRGESGICGESGICGESGVHGKSGIHGESGIRGESGICGE  93

Query  297  DSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
              I G+S   G  GI G   I GES   G  GI G     GES  +
Sbjct  94   SGIHGESGIHGESGIRGESRIHGESRIHGKSGIPGESGSRGESGIR  139


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 52/114 (46%), Gaps = 1/114 (1%)
 Frame = -1

Query  498  GDPFK-G*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  322
            GDP   G  G VG+  I GES  +G  G+ G   I GES   G  GI G   + G+S   
Sbjct  20   GDPGSVGNLGSVGNLGICGESGIRGKSGVHGKSGIRGESGICGESGICGESGVHGKSGIH  79

Query  321  **FGIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
               GI G   I G+S   G  GI G   I GES   G   I G   I GES  +
Sbjct  80   GESGIRGESGICGESGIHGESGIHGESGIRGESRIHGESRIHGKSGIPGESGSR  133


 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 48/109 (44%), Gaps = 0/109 (0%)
 Frame = -1

Query  489  FKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FG  310
             +G  G+ G   I GES   G  GI G   + G+S   G  GI G   I GES      G
Sbjct  42   IRGKSGVHGKSGIRGESGICGESGICGESGVHGKSGIHGESGIRGESGICGESGIHGESG  101

Query  309  IVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
            I G   I G+S   G   I G   I GES  +G  GI G   I GES  
Sbjct  102  IHGESGIRGESRIHGESRIHGKSGIPGESGSRGESGIRGESGIRGESRI  150



>ref|WP_016085848.1| hypothetical protein [Bacillus cereus]
 gb|EOP14475.1| hypothetical protein ICS_00732 [Bacillus cereus BAG2O-3]
 gb|EOQ08019.1| hypothetical protein KQ3_04121 [Bacillus cereus B5-2]
Length=191

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+  + P +   P +P  P+    P +   P MP  P+  E P +   P MP   +  
Sbjct  57   EGPVLPEGPVLPEGPVLPEGPVIPVGPVLPEGPVMPEGPVLPEGPVLPEGPVMPEGPVLP  116

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P +   P MP  P+  + P +  +P MP  P+  + P +   P MP  P+
Sbjct  117  EGPVLPEGPVMPVDPVFPEGPVLPVDPVMPEGPVLPEGPVLPEGPVMPEGPV  168


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+  + P +   P +P  P+  + P M   P +P  P+  E P M   P +P   +  
Sbjct  63   EGPVLPEGPVLPEGPVIPVGPVLPEGPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPVLP  122

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P M  +P  P  P+    P M   P +P  P+  + P M   P +P  P+
Sbjct  123  EGPVMPVDPVFPEGPVLPVDPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPV  174


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 51/112 (46%), Gaps = 6/112 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P M   P +P  P+  + P M   P +P  P+  E P M  +P  P      +
Sbjct  82   GPVLPEGPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPVLPEGPVMPVDPVFP------E  135

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             P +  +P MP  P+  + P +   P MP  P+  + P +  +P +P  PL+
Sbjct  136  GPVLPVDPVMPEGPVLPEGPVLPEGPVMPEGPVLPEGPVLPVDPVLPVGPLS  187



>ref|WP_024600481.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1056

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 46/109 (42%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P K  +P +  EP     P+  + PA +  P     P K E+P +  EP      +  + 
Sbjct  866  PAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVATEE  925

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA +  P +   P K ++P +  EP     P+  + PA +  P +   P
Sbjct  926  PAKVETPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPAKVETPVVTEEP  974


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 0/106 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + PA +  P +   P K ++P    EP     P+  E PA +  P +     K ++P   
Sbjct  864  EEPAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEAPVAT  923

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             EP     P+  + PA +  P +   P K ++P +  EP     P+
Sbjct  924  EEPAKVETPVVTEEPAKVETPVVTEEPAKVEAPVVTEEPAKVETPV  969



>ref|WP_016527324.1| adherence-associated mucus-binding protein,LPXTG-motif cell wall 
anchor [Lactobacillus plantarum]
 gb|AGO09071.1| adherence-associated mucus-binding protein,LPXTG-motif cell wall 
anchor [Lactobacillus plantarum 16]
Length=1357

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 6/95 (6%)
 Frame = +2

Query  191   EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
             EP  P  P + + P    +P+ P  P   E P+   EP  P      + P+   EP  P 
Sbjct  1163  EPGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHP------EQPSQPEEPGHPE  1216

Query  371   HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMP  475
              P + + P    +P+ P  P + + P  L +P+ P
Sbjct  1217  QPSQPEEPGQHEQPSQPEEPGQSEKPGELQKPSQP  1251


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 0/89 (0%)
 Frame = +2

Query  158   PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
             P + + P+   EP  P  P + + P    +P+ P  P   E P+   EP  P    + + 
Sbjct  1164  PGQPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEEPGHPEQPSQPEE  1223

Query  338   PAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
             P    +P+ P  P + + P  L +P+ P+
Sbjct  1224  PGQHEQPSQPEEPGQSEKPGELQKPSQPA  1252



>ref|WP_034092386.1| hypothetical protein, partial [Streptacidiphilus albus]
Length=144

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 53/103 (51%), Gaps = 3/103 (3%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            PA+ + PT+P  P     PA+ +EPT P  P     PA+ +EPT P        PA+ +E
Sbjct  27   PAVPTVPTVPAVPTAPTVPAVPTEPTEPTAPTAPTVPAVPTEPTEPTAPTAPTVPAVPTE  86

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PT P  P     PA+   PT+P+ P     PA+ + PT P+ P
Sbjct  87   PTEPTAPTAPTVPAV---PTVPTEPTARTVPAVPTAPTEPSAP  126


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            PA+ +EPT P  P     PA+ +EPT P  P     PA+ +EPT P        PA+   
Sbjct  45   PAVPTEPTEPTAPTAPTVPAVPTEPTEPTAPTAPTVPAVPTEPTEPTAPTAPTVPAV---  101

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PT+P  P     PA+ + PT PS P    +PA+ + PT+P  P
Sbjct  102  PTVPTEPTARTVPAVPTAPTEPSAP---TAPAVPTAPTVPAVP  141



>ref|WP_024601393.1| ribonuclease [Pseudoalteromonas atlantica]
Length=1064

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 38/100 (38%), Gaps = 0/100 (0%)
 Frame = +2

Query  164  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
            K + P    EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  851  KVEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEPV  910

Query  344  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
               EP     P+K + P    EP     P+K + P    E
Sbjct  911  KAEEPVKAEEPVKTEEPVKAEEPVKAEEPVKAEEPVKAEE  950


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 37/93 (40%), Gaps = 0/93 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  855  PVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEPVKAEE  914

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  436
            P    EP     P+K + P    EP     P+K
Sbjct  915  PVKAEEPVKTEEPVKAEEPVKAEEPVKAEEPVK  947


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 38/96 (40%), Gaps = 0/96 (0%)
 Frame = +2

Query  179  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  358
            A + EP     P+K + P    EP     P+K E P    EP      ++ + P    EP
Sbjct  850  AKVEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEP  909

Query  359  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
                 P+K + P    EP     P+K + P    EP
Sbjct  910  VKAEEPVKAEEPVKTEEPVKAEEPVKAEEPVKAEEP  945


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 36/92 (39%), Gaps = 0/92 (0%)
 Frame = +2

Query  212  PLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDS  391
            P+K + P    EP     P+K E P    EP      +K + P    EP     P+K + 
Sbjct  855  PVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAEEPVKAEEPVQTEEPVKAEEPVKAEE  914

Query  392  PAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P    EP     P+K + P    EP     P+
Sbjct  915  PVKAEEPVKTEEPVKAEEPVKAEEPVKAEEPV  946


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 40/111 (36%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
            H    D+   + +  +     K + P    EP     P+K E P    EP      +K +
Sbjct  830  HKTAVDASDAVEQNIVEEELAKVEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEEPVKAE  889

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P    EP     P+K + P    EP     P+K + P    EP     P+
Sbjct  890  EPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAEEPV  940



>ref|WP_007375272.1| ribonuclease E [Pseudoalteromonas sp. Bsw20308]
 gb|EKS14718.1| ribonuclease E [Pseudoalteromonas sp. Bsw20308]
Length=1061

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/105 (24%), Positives = 48/105 (46%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            ++P +  +PT    P+  + PA +  P +   P K E+PA+  +P      +  + PA +
Sbjct  881  EAPVVTEQPTKVEAPVVTEQPAKVEAPVVTEQPAKVEAPAVTEQPAKVEAPVVTEQPAKV  940

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P +   P K ++P +  +P     P+  + PA +  P +   P
Sbjct  941  EAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQPAKVEAPVVTEQP  985



>ref|WP_034371226.1| cell surface protein [Dermabacter hominis]
Length=1750

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/111 (29%), Positives = 44/111 (40%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P + + P    EP  P  P K + P    +P  P  P +   P    EP  P    + +
Sbjct  1605  QPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPGKPEQPGEPEQPGEPEQPGKPGQPE  1664

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P    +P  P  P K + P    +P  P  P K   PA  S+P+ P  PL
Sbjct  1665  EPGKPEQPGQPEEPGKPEQPGKPEQPGQPEQPAKPADPAHPSKPSKPGLPL  1715



>ref|WP_039085890.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ45061.1| hypothetical protein JP28_02600, partial [Gallibacterium anatis]
Length=832

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P   ++P + N P+  D P + ++P +   P+    PA+ ++P + N      
Sbjct  263  QPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVAN------  316

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P + N P+  D P + ++P   + P+  + PA+ ++P + N P+
Sbjct  317  QPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQPAVETQPVVANQPV  367


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/110 (24%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA+ ++P + N P+    P + ++P + + P+    PA+ ++P + N      
Sbjct  251  QPVVANQPAVETQPVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVAN------  304

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             PA+ ++P + N P+    P + ++P +   P+  + PA  ++P + N P
Sbjct  305  QPAIETQPVVANQPVVETQPVVANQPVVEDQPVVANQPAAKTQPVVANQP  354


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P +   P+  + P   ++P + N P+    P + ++P +    +  
Sbjct  208  NQPVVETQPEVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVA  267

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P   ++P + N P+  D P + ++P + + P+  + PA+ ++P + N P+
Sbjct  268  NQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQPAIETQPVVANQPV  319


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P + ++P +   P   + PA+ ++P + N P+    P + ++P      +  + PA+ ++
Sbjct  204  PVVANQPVVETQPEVANQPAVETQPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQ  263

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P + N P+    P + ++P +   P+  + PA+ ++P + N P
Sbjct  264  PVVANQPVAETQPVVANQPVVEDQPVVANQPAVETQPVVANQP  306


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + P   ++P + N P+    P + ++P +   P+    P   ++P + N  +  D
Sbjct  227  QPVVANQPVAETQPMVANQPVAEVQPVVANQPAVETQPVVANQPVAETQPVVANQPVVED  286

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             P + ++P +   P+  + PA+ ++P + + P+    P + ++P + + P+
Sbjct  287  QPVVANQPAVETQPVVANQPAIETQPVVANQPVVETQPVVANQPVVEDQPV  337



>ref|WP_039162097.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ23242.1| hypothetical protein JP33_10920, partial [Gallibacterium anatis 
CCM5995]
Length=1018

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+    P + ++P     P+  + PA  ++P + N P+    P + ++P +    +  +
Sbjct  905   QPVAETQPVVTNQPVAETQPVVANQPAAETQPVVANQPVVETQPVVANQPAVETQPVVAN  964

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P+    P + ++P + + P+    P + ++P     P+
Sbjct  965   QPVVETQPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPV  1015


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 50/108 (46%), Gaps = 0/108 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + N P     P + ++P +   P+    PA+ ++P + N  +   
Sbjct  911   QPVVTNQPVAETQPVVANQPAAETQPVVANQPVVETQPVVANQPAVETQPVVANQPVVET  970

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
              P + ++P +   P     P + ++P + + P+  + PA   +P + N
Sbjct  971   QPVVTNQPVVETQPEVATQPVVANQPVVEAQPVVANQPAAEVQPVVAN  1018


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 50/111 (45%), Gaps = 6/111 (5%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+    P   ++P + N P+    P + ++P     P+    P + ++P + N      
Sbjct  899   QPVAETQPVAETQPVVTNQPVAETQPVVANQPAAETQPVVANQPVVETQPVVAN------  952

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              PA+ ++P + N P+    P + ++P + + P     P + ++P +   P+
Sbjct  953   QPAVETQPVVANQPVVETQPVVTNQPVVETQPEVATQPVVANQPVVEAQPV  1003



>ref|WP_037886013.1| hypothetical protein, partial [Streptomyces viridochromogenes]
Length=157

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            PA  + P  P +P K   PA  ++P  P  P K   PA  + P  P Y  K   PA  ++
Sbjct  32   PAKPAYPVKPAYPAKPAKPAYPAKPAYPAKPAKPAYPAKPAYPAKPAYPAKPAYPAKPAK  91

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P  P HP K D PA   +P  P+HP K D PA  + P  P  P
Sbjct  92   PAYPAHPKKPDYPAHPKKPAYPAHPKKPDYPAKPAYPAHPKKP  134



>ref|WP_000300356.1| hypothetical protein, partial [Streptococcus sp. GMD4S]
 gb|EKA08052.1| cell wall surface anchor family protein, partial [Streptococcus 
sp. GMD4S]
Length=441

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (47%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P++ ++P    +P  P +P++ + PA   +PT P  P + E PA   +PT P    + 
Sbjct  152  EKPVQPENPTQPEKPAQPENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQP  211

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            + PA   +PT P  P + + PA    P  P  P + + PA    PT P  P  
Sbjct  212  EKPAQPEKPTQPETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQ  264


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 6/114 (5%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
             +P++ + PA   +PT P  P + + PA   +PT P  P + E PA   +PT P      
Sbjct  170  ENPVQPEKPAQPEKPTQPETPAQPEKPAQPEQPTQPETPAQPEKPAQPEKPTQP------  223

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNG  493
            ++PA   +P  P  P + + PA   +P  P +P + ++PA   +P   + P  G
Sbjct  224  ETPAQPEKPAQPETPAQPEKPAQPEKPAQPENPTQPETPAQPEKPITSSSPEEG  277



>gb|EMC77394.1| putative serine/threonine-protein kinase kinX [Columba livia]
Length=703

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 32/119 (27%), Positives = 47/119 (39%), Gaps = 0/119 (0%)
 Frame = +2

Query  131  PITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTM  310
            P+ ++    P+  + P  L EP     P+  + P  L EP     P+  E P  L EP  
Sbjct  139  PVGLVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVG  198

Query  311  PNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
                +  + P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  199  LEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  257


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 49/128 (38%), Gaps = 7/128 (5%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  196  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  255

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSP------  499
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+          
Sbjct  256  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLVG  315

Query  500  -EQ*SLWH  520
             E+ +LWH
Sbjct  316  LEELALWH  323


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  154  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  213

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  214  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  263


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  160  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  219

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  220  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  269


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  166  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  225

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  226  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  275


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  172  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  231

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  232  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  281


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  178  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  237

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  238  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  287


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  184  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  243

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  244  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  293


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  L EP     P+  + P  L EP     P+  E P  L EP      +  + 
Sbjct  190  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEE  249

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  L EP     P+  + P  L EP     P+  + P  L EP     P+
Sbjct  250  PVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPVGLEEPV  299



>gb|AIW68555.1| neurofilament triplet H1-like protein [Common midwife toad ranavirus]
Length=175

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 37/107 (35%), Gaps = 0/107 (0%)
 Frame = +2

Query  143  MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
            +    P+K  SP     P     P+K  SP     P     P+K  SP     P      
Sbjct  61   VKRKSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSP  120

Query  323  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
            +K  SP     P     P+K  SP     P     P+K  SPA   +
Sbjct  121  VKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPAKRRQ  167


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 36/113 (32%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  57   KRSPVKRKSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVK  116

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              SP     P     P+K  SP     P     P+K  SP     P      +
Sbjct  117  KRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPAKRRQQV  169


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 49/139 (35%), Gaps = 1/139 (1%)
 Frame = +2

Query  74   TIGAFLLISHLLLNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPT  253
            ++GA L    +  +S + +  +++    P+K  SP     P     P+K  SP     P 
Sbjct  27   SLGAMLSAPVVRASSPVRKRKSLVKRKSPVKR-SPVKRKSPVKKRSPVKKRSPVKKRSPV  85

Query  254  MPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPL  433
                P+K  SP     P      +K  SP     P     P+K  SP     P     P+
Sbjct  86   KKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPVKKRSPV  145

Query  434  KYDSPAMLSEPTMPNHPLN  490
            K  SP     P     P  
Sbjct  146  KKRSPVKKRSPVKKRSPAK  164



>ref|XP_008310536.1| PREDICTED: protein SPT2 homolog isoform X1 [Cynoglossus semilaevis]
Length=753

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 35/103 (34%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P + S+P MP  P     P M  EP MP  P   + P M   P M         P M   
Sbjct  530  PGLSSQPGMPQRPGIQQRPGMPQEPGMPQRPGMQQGPGMQQGPGMQQGPGMQQRPGMQQR  589

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P M   P     P M   P M   P     P M   P M   P
Sbjct  590  PGMQQRPGMQQRPGMQQRPGMQQRPGMQQGPGMQQRPGMQQRP  632



>ref|XP_007182705.1| PREDICTED: LOW QUALITY PROTEIN: G2/mitotic-specific cyclin-B3 
[Balaenoptera acutorostrata scammoni]
Length=1428

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  458   IALPENHTSKDDLASSAPIALPENHTLKDDLASSAPIALPENHTSNDNLASSAPIALQEI  279
             + L EN T++++     P+AL EN +++ ++     +AL E  TS        P+ALQE 
Sbjct  982   LTLQENLTTEEEAILKEPLALQENPSIEKEIILRESLALQEKPTSEKETLFEEPLALQEN  1041

Query  278   HTLKDDLASSAPIALPENHTLKDDLASSAPIALQENHT  165
              T++++     P+AL E  + + DL+S  P+ALQ+N T
Sbjct  1042  PTIEEEAILKEPLALQEKPSSEKDLSSKEPLALQKNLT  1079



>ref|XP_008310537.1| PREDICTED: protein SPT2 homolog isoform X2 [Cynoglossus semilaevis]
Length=752

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 35/103 (34%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P + S+P MP  P     P M  EP MP  P   + P M   P M         P M   
Sbjct  529  PGLSSQPGMPQRPGIQQRPGMPQEPGMPQRPGMQQGPGMQQGPGMQQGPGMQQRPGMQQR  588

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P M   P     P M   P M   P     P M   P M   P
Sbjct  589  PGMQQRPGMQQRPGMQQRPGMQQRPGMQQGPGMQQRPGMQQRP  631



>gb|ACB11439.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=250

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 37/113 (33%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K  SP     P      +K 
Sbjct  111  KSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKSRSPVKR  170

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             SP     P     P+K  SP     P     P+K  SP     P     PL 
Sbjct  171  KSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPLK  223


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 39/113 (35%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  117  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKSRSPVKRKSPVKT  176

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             SP     P     P+K  SP     P     P+K  SP     P     P+N
Sbjct  177  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPLKRKSPMN  229


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 38/113 (34%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  129  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKSRSPVKRKSPVKTRSPVKRKSPVKT  188

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             SP     P     P+K  SP     P     PLK  SP     P     PL 
Sbjct  189  RSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPLKRKSPMNKRSPVKRKSPLK  241


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  98   RKSPVKRKSPVNCKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVK  157

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  158  RKSPVKSRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVKTRSPVKRKSPVK  211



>gb|AJI79873.1| hypothetical protein CSING_11890 [Corynebacterium singulare]
Length=1947

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/104 (33%), Positives = 46/104 (44%), Gaps = 0/104 (0%)
 Frame = +2

Query  173   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  352
             +P    E T PN P +  +P    E T PN P +  +P    E T PN   +  +P    
Sbjct  1712  TPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPG  1771

Query  353   EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             E T PN P +  +P    E T P+ P +  +P    E T PN P
Sbjct  1772  EETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKP  1815


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 43/96 (45%), Gaps = 0/96 (0%)
 Frame = +2

Query  197   TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  376
             T PN P +  +P    E T PN P +  +P    E T PN   +  +P    E T PN P
Sbjct  1711  TTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKP  1770

Query  377   LKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              +  +P    E T P+ P +  +P    E T PN P
Sbjct  1771  GEETTPNKPGEETTPNKPGEETTPNKPGEETTPNKP  1806



>gb|ACB11440.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=291

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 38/113 (34%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  117  KSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKR  176

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  177  KSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  229


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 36/107 (34%), Gaps = 0/107 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K +SP     P      +K
Sbjct  134  RKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  193

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
              SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  194  RKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPV  240


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 38/113 (34%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVK  211


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  80   RKSPVKKRSPVNRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVK  139

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  140  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  193


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 40/117 (34%), Gaps = 0/117 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K +SP     P      +K
Sbjct  128  RKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVK  187

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSP  499
              SP     P     P+K  SP     P     P+K  SP     P     P+  SP
Sbjct  188  TRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRSP  244



>ref|WP_024596135.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1085

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 42/110 (38%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K   PA    P     P+K ++P    EP     P+  E PA    P       K ++
Sbjct  865  PVKAKEPAKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVET  924

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P    EP     P+  + PA    P     P K ++PA   EP     P+
Sbjct  925  PVATEEPDKVETPVATEEPAKAETPVATKEPAKAETPAATEEPAKVETPV  974


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 45/120 (38%), Gaps = 0/120 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+  T +    P+K ++P    EP     P+  + PA    P     P K E+P    EP
Sbjct  872  AKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVETPVATEEP  931

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
                  +  + PA    P     P K ++PA   EP     P+  +  A    P +   P
Sbjct  932  DKVETPVATEEPAKAETPVATKEPAKAETPAATEEPAKVETPVATEESAKAETPVVTEEP  991



>ref|WP_039147361.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ36928.1| hypothetical protein JP30_11480, partial [Gallibacterium anatis 
IPDH697-78]
Length=994

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/105 (22%), Positives = 52/105 (50%), Gaps = 6/105 (6%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + PA  ++P + N P+    P + ++P +    +    PA+  +P + N H      A+ 
Sbjct  894  NQPAAEAQPVVTNQPVAEVQPVVANQPAVETQAVAANQPAVEDQPAVANQH------AVE  947

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  948  AQPVVANQPVVEAQPEVANQPAVEAQPVVANQPVVEAQPEVANQP  992



>ref|WP_010557308.1| ribonuclease [Pseudoalteromonas marina]
 gb|ERG24786.1| RNase E [Pseudoalteromonas marina mano4]
Length=1052

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/101 (25%), Positives = 41/101 (41%), Gaps = 0/101 (0%)
 Frame = +2

Query  161  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSP  340
            +K + P    EP     P++ + P    EP     P++ E P    EP      ++ + P
Sbjct  857  VKAEEPVKTEEPVKAEEPVQTEEPVQTEEPVQTEEPVQTEEPVKAEEPVQAEELVQAEEP  916

Query  341  AMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
                EP     P++ + P    EP      +K D PA+ +E
Sbjct  917  VQTEEPVQAEEPVQAEEPVKAEEPVKAEESVKADEPALEAE  957



>gb|EJP18773.1| LPXTG cell wall anchor domain protein, partial [Streptococcus 
oralis SK304]
Length=346

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (47%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEP  304
            A+P T +    P++ + PA   +P  P  P + + PA   +P  P  P + E+PA   +P
Sbjct  12   AQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKPAQPEKPTQPETPAQPEQP  71

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
              P    + ++PA   +P  P  P + ++P    +P  P  P + ++P    +PT P  P
Sbjct  72   AQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQPETPVQPEQPTEPETP  131

Query  485  LN  490
              
Sbjct  132  AQ  133


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 54/118 (46%), Gaps = 2/118 (2%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + ++P    +P  P  P + + PA   +P  P  P + E PA   +PT P    + 
Sbjct  9    EKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKPAQPEKPTQPETPAQP  68

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
            + PA   +P  P  P + + PA   +P  P  P++ + PA   +P  P  P+   PEQ
Sbjct  69   EQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQPETPVQ--PEQ  124


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 50/113 (44%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + + PA    P  P  P++ + PA   +P  P  P + E PA   +P  P    + 
Sbjct  3    EKPAQPEKPAQPETPVQPEKPVQPEKPAEPEKPAEPEKPAQPEKPAQPEKPAQPEKPTQP  62

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            ++PA   +P  P  P + ++PA   +P  P  P + ++P    +P  P  P  
Sbjct  63   ETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 51/113 (45%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + + PA   +P  P  P + ++PA   +P  P  P + E+PA   +P  P    + 
Sbjct  39   EKPAQPEKPAQPEKPAQPEKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQP  98

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            ++P    +P  P  P + ++P    +PT P  P + ++P    +P  P  P  
Sbjct  99   ETPVQPEKPAQPEKPAQPETPVQPEQPTEPETPAQPETPVQPEKPVQPEKPAQ  151


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 0/110 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P + ++PA   +P  P  P + ++PA   +P  P  P + E+P    +P  P    + 
Sbjct  57   EKPTQPETPAQPEQPAQPEKPAQPETPAQPEKPAQPEKPAQPETPVQPEKPAQPEKPAQP  116

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
            ++P    +PT P  P + ++P    +P  P  P + + PA   +P  P +
Sbjct  117  ETPVQPEQPTEPETPAQPETPVQPEKPVQPEKPAQSEKPAETEKPDQPEN  166



>gb|EMC89538.1| Collagen-like protein 2, partial [Columba livia]
Length=130

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 6/111 (5%)
 Frame = -1

Query  492  PFKG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**F  313
              +G   + G  S+ G+S  +G   + G  S+ G+S  +G  G+ G  S+ G+S  +   
Sbjct  17   SVQGNCSVQGDSSVQGDSNVQGDCSVQGDRSVQGDSSMQGDSGVQGDRSVQGDSSVQ---  73

Query  312  GIVGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
               G  S+ GDS  +G  G+ G  S+ G+S  +G   + G  S+ G+   +
Sbjct  74   ---GDSSVQGDSSMQGDSGVQGDHSVQGDSSVQGDSSVQGDSSVQGDCSVQ  121


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  486  KG*FGIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGI  307
            +G   + G+ S+ G    +G   + G  S+ G+S  +G   + G  S+ G+S  +   G+
Sbjct  1    RGNCSVQGNRSVQGNRSVQGNCSVQGDSSVQGDSNVQGDCSVQGDRSVQGDSSMQGDSGV  60

Query  306  VGSDSIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK  160
             G  S+ GDS  +G   + G  S+ G+S  +G   + G  S+ G+S  +
Sbjct  61   QGDRSVQGDSSVQGDSSVQGDSSMQGDSGVQGDHSVQGDSSVQGDSSVQ  109



>ref|WP_010188733.1| hypothetical protein, partial [Corynebacterium aurimucosum]
Length=264

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 0/99 (0%)
 Frame = +2

Query  188  SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  367
            +E T PN+P +  +P    E T PN P +  +P    E T PN   +  +P    E T P
Sbjct  9    TEETTPNNPGEETTPNEPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNQPGEETTP  68

Query  368  NHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            N+P +  +P    E T P++P +  +P    E T PN+P
Sbjct  69   NNPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNNP  107


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 49/110 (45%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P +  +P    E T PN P +  +P    E T PN+P +  +P    E T PN   +  
Sbjct  7    KPTEETTPNNPGEETTPNEPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNQPGEET  66

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            +P    E T PN P +  +P    E T P+ P +  +P    E T PN P
Sbjct  67   TPNNPGEETTPNQPGEETTPNNPGEETTPNQPGEETTPNNPGEETTPNEP  116



>ref|WP_032667851.1| hypothetical protein, partial [Mycobacterium kansasii]
Length=121

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 49/97 (51%), Gaps = 0/97 (0%)
 Frame = -1

Query  453  IAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSIAGDSY  274
            +AG +   G  G+ G+  +AG +   G  G+ G+  +AG +      G+ G+  +AG++ 
Sbjct  1    LAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAG  60

Query  273  FKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGESYF  163
              G  G+ G+  +AG +   G  G+ G+  +AG +  
Sbjct  61   LAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGL  97



>ref|WP_039141203.1| hypothetical protein [Gallibacterium anatis]
 gb|KGQ51116.1| hypothetical protein JL12_03840 [Gallibacterium anatis 10672-6]
Length=1476

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 49/99 (49%), Gaps = 0/99 (0%)
 Frame = +2

Query  188   SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  367
             ++P + N P+    P +  +P + N P+    P + ++P +    +  +  A  ++P + 
Sbjct  940   AQPVVVNQPVAETQPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQLAAETQPVVA  999

Query  368   NHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  1000  NQPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQP  1038


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + P   ++P + + P+  + P   ++P + N P+    P + ++       +  +
Sbjct  941   QPVVVNQPVAETQPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQLAAETQPVVAN  1000

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N P     P + ++P + + P+  + PA+ ++P +   P+
Sbjct  1001  QPVVETQPEVANQPAVETQPVVANQPVVETQPVVANQPAVETQPVVETQPV  1051


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/111 (19%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+    P +  +P + N P+    P + ++P +   P+  +     ++P + N  +   
Sbjct  893   QPVAETQPVVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAET  952

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P +  +P + N P+    P + ++P + + P+  +  A  ++P + N P+
Sbjct  953   QPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQLAAETQPVVANQPV  1003


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P+  + PA+ ++P +    +    P ++++P     P+  + P + ++P      +  +
Sbjct  917   QPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAETQPVVKDQPVVANQPVTETQPVVAN  976

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P + ++P + N       P + ++P + + P   + PA+ ++P + N P+
Sbjct  977   QPVVETQPVVANQLAAETQPVVANQPVVETQPEVANQPAVETQPVVANQPV  1027


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 46/98 (47%), Gaps = 0/98 (0%)
 Frame = +2

Query  188  SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  367
            ++P     P+  D P + ++P     P+    PA+ ++P +    +    P ++++P   
Sbjct  892  TQPVAETQPVVKDQPVVANQPVTEAQPVVSNQPAVEAQPVVEKQAVTEAQPVVVNQPVAE  951

Query  368  NHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
              P+  D P + ++P   + P+  + P + ++P + N 
Sbjct  952  TQPVVKDQPVVANQPVTETQPVVANQPVVETQPVVANQ  989



>ref|WP_018346332.1| hypothetical protein [Gallibacterium anatis]
Length=747

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  237  NQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVT  296

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  297  NQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPVVETQPVVANQPV  348


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P     P+  + PA  ++P + N P     P + ++P      +  +
Sbjct  202  QPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVAN  261

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  262  QPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPV  312


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 53/115 (46%), Gaps = 0/115 (0%)
 Frame = +2

Query  143  MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
            M  + P   D P + ++P +   P+    P + ++P + N P+    P + ++P      
Sbjct  174  MVANQPAVEDQPVVANQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVANQPAAETQP  233

Query  323  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               + PA   +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  234  EVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  288


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P     P + ++P     P+  + PA   +P + N P     P + ++P +    +  
Sbjct  225  NQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVT  284

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P + ++P + N P+    P + ++P + + P+  + PA+ ++P + N P+
Sbjct  285  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPV  336


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N  +   
Sbjct  256  QPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVET  315

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
             P + ++P +   P+  + P + ++P + + P+  D P + ++P +
Sbjct  316  QPVVTNQPAVETQPVVANQPVVETQPVVANQPVVEDQPEVATQPVV  361


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P     P   + PA   +P + N P     P + ++P +    +  
Sbjct  213  NQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVA  272

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  273  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQP  323



>ref|WP_028835759.1| ribonuclease [Pseudoalteromonas sp. 6BO_GOM-1096m]
Length=1072

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 38/100 (38%), Gaps = 0/100 (0%)
 Frame = +2

Query  164  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
            K + P    EP     P+K + P    EP     P+K E P    EP      +K + P 
Sbjct  859  KVEEPVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPV  918

Query  344  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
               EP     P++ + P    EP     P+K + P    E
Sbjct  919  KAEEPVKAEEPVQAEEPVKTEEPVKAEEPVKAEEPVKAEE  958


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/93 (28%), Positives = 36/93 (39%), Gaps = 0/93 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K + P    EP     P+K D P    EP     P++ E P    E       +K + 
Sbjct  863  PVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEPVKAEE  922

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  436
            P    EP     P+K + P    EP     P+K
Sbjct  923  PVKAEEPVQAEEPVKTEEPVKAEEPVKAEEPVK  955


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 37/96 (39%), Gaps = 0/96 (0%)
 Frame = +2

Query  179  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  358
            A + EP     P+K + P    EP   + P+K   P    EP      +K +      EP
Sbjct  858  AKVEEPVKAEEPVKAEEPVKTEEPVKTDEPVKTVEPVKAEEPVQAEEPVKAEELVKTEEP  917

Query  359  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
                 P+K + P    EP     P+K + P    EP
Sbjct  918  VKAEEPVKAEEPVQAEEPVKTEEPVKAEEPVKAEEP  953



>ref|XP_004646348.1| PREDICTED: G2/mitotic-specific cyclin-B3 [Octodon degus]
Length=1313

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 3/124 (2%)
 Frame = -2

Query  527  FHHAINFTA-PVIRLKDDLASSAPIALPENHTSKDDLASSAPIALPENHTLKDDLASSAP  351
            F   +N    P I  ++    + P+AL E    K +     P+AL E H+ K       P
Sbjct  857  FQECLNLQKNPTI--EEGTIFTEPLALQEKAGLKSEAILKEPLALQEKHSPKMKAVLEEP  914

Query  350  IALPENHTSNDNLASSAPIALQEIHTLKDDLASSAPIALPENHTLKDDLASSAPIALQEN  171
            +AL E  +S +    + P+A QE   L D + S  P+AL E  T  ++L+   P+ L+EN
Sbjct  915  LALEEKPSSEEEAIHNEPLAFQEKSDLDDKVISEEPLALDEKSTTGNELSFQEPLILEEN  974

Query  170  HTLK  159
             T K
Sbjct  975  PTEK  978



>gb|ETN66453.1| Unc-89 protein [Anopheles darlingi]
Length=5569

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 45/99 (45%), Gaps = 3/99 (3%)
 Frame = +2

Query  188   SEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMP  367
             S PT P    K   PA   EP  P    K  +P  ++EPT P    K  +PA  +EP  P
Sbjct  1348  SVPTKPAEQQKSAVPAKAVEPAKPTEQPKPATPTKVAEPTKPAEQPKPATPAKPAEPAKP  1407

Query  368   NHPLKYDSPAMLSE---PTMPSHPLKYDSPAMLSEPTMP  475
               P K   PA L+E     +P+ P++   PA  S+   P
Sbjct  1408  ATPTKVSEPAKLAEQAKTVVPTKPVEQPKPATPSKVVEP  1446



>ref|WP_024590363.1| MULTISPECIES: ribonuclease [Pseudoalteromonas]
Length=1043

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/109 (26%), Positives = 44/109 (40%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P K  +P +  EP     P+  + PA +  P     P K E+P    EP      +  + 
Sbjct  867  PAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEE  926

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA +  P     P K ++P +  EP     P+  ++PA    P +   P
Sbjct  927  PAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEAPAKTETPVVTKAP  975


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/106 (25%), Positives = 44/106 (42%), Gaps = 0/106 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + PA +  P +   P K ++P    EP     P+  E PA +  P       K ++P + 
Sbjct  865  EEPAKVGAPVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVT  924

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             EP     P+  + PA +  P +   P K ++P +   P     P+
Sbjct  925  EEPAKVEAPVATEEPAKVETPVVTEEPAKVETPVVTEAPAKTETPV  970


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/113 (25%), Positives = 46/113 (41%), Gaps = 0/113 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + PA +  P     P K ++P    EP     P+  E PA +  P +     K ++
Sbjct  873  PVVTEEPAKVETPVATEEPAKVETPVATEEPAKVETPVATEEPAKVETPVVTEEPAKVEA  932

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
            P    EP     P+  + PA +  P +   P K ++P +   P +      GS
Sbjct  933  PVATEEPAKVETPVVTEEPAKVETPVVTEAPAKTETPVVTKAPHVKTAVTQGS  985



>ref|WP_039152156.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ58243.1| hypothetical protein IE01_02485, partial [Gallibacterium anatis 
DSM 16844 = F 149]
Length=724

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/112 (20%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P     P + ++P     P+  + PA+ ++P + N P+    P + ++P +    +  
Sbjct  214  NQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVT  273

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  274  NQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPVVETQPVVANQPV  325


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/111 (21%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+    P + ++P     P+  + PA  ++P + N P     P + ++P      +  +
Sbjct  179  QPVVETQPVVANQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVAN  238

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
             PA+ ++P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  239  QPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPV  289


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/115 (21%), Positives = 53/115 (46%), Gaps = 0/115 (0%)
 Frame = +2

Query  143  MPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYH  322
            M  + P   D P + ++P +   P+    P + ++P + N P+    P + ++P      
Sbjct  151  MVANQPAVEDQPVVANQPAVEAQPVAETQPVVETQPVVANQPVAETQPVVANQPAAETQP  210

Query  323  LKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
               + PA   +P + N P     P + ++P + + P+  + P + ++P + N P+
Sbjct  211  EVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  265


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P     P + ++P     P+  + PA   +P + N P     P + ++P +    +  
Sbjct  202  NQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVANQPVVETQPVVT  261

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + P + ++P + N P+    P + ++P + + P+  + PA+ ++P + N P+
Sbjct  262  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPAVETQPVVANQPV  313


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/106 (20%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P+  + PA+ ++P + N P+    P + ++P +   P+    P + ++P + N  +   
Sbjct  233  QPVVANQPAVETQPVVANQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVET  292

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
             P + ++P +   P+  + P + ++P + + P+  D P + ++P +
Sbjct  293  QPVVTNQPAVETQPVVANQPVVETQPVVANQPVVEDQPEVATQPVV  338


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P     P   + PA   +P + N P     P + ++P +    +  
Sbjct  190  NQPVAETQPVVANQPAAETQPEVANQPAAEVQPVVANQPAAEVQPVVANQPAVETQPVVA  249

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            + P + ++P + N P+    P + ++P + + P+  + P + ++P + N P
Sbjct  250  NQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQPVVETQPVVTNQP  300



>ref|WP_042132036.1| hypothetical protein [Paenibacillus sp. FSL R5-0345]
 gb|AIQ34959.1| hypothetical protein R50345_10300 [Paenibacillus sp. FSL R5-0345]
Length=497

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = -1

Query  474  GIVGSDSIAGESYFKG*LGIVGSDSIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSD  295
            G VG+  +AG +   G  G VG+  +AG +   G  G VG+  +AG +      G VG+ 
Sbjct  140  GAVGAPGVAGATGVTGAPGAVGAPGVAGATGATGAPGAVGTPGVAGATGATGAPGAVGTP  199

Query  294  SIAGDSYFKG*FGIVGSDSIAGESYFKG*FGIVGSDSIAGES  169
             +AG +   G  G+ G+  +AG +   G  G VG+  +AG +
Sbjct  200  GVAGATGVTGAPGVAGAPGVAGATGVTGAPGAVGAPGVAGAT  241



>gb|KDS93254.1| surface protein [Dermabacter hominis 1368]
Length=1384

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 32/111 (29%), Positives = 44/111 (40%), Gaps = 0/111 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P + + P    EP  P  P K + P    +P  P  P +   P    EP  P    + +
Sbjct  1239  QPGEPEQPGQPEEPGKPGQPGKPEQPGKPGQPEQPGKPEQPGEPEQPGEPEQPGKPGQPE  1298

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              P    +P  P  P K + P    +P  P  P K   PA  S+P+ P  PL
Sbjct  1299  EPGKPEQPGQPEEPGKPEQPGKPEQPGQPEQPAKPADPAHPSKPSKPGLPL  1349



>ref|XP_011194718.1| PREDICTED: uncharacterized protein LOC105220036, partial [Bactrocera 
cucurbitae]
Length=879

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/107 (30%), Positives = 51/107 (48%), Gaps = 6/107 (6%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + P + ++PT P+ P +  +P+   +PT P  P+   +P   +EP+ P        P+  
Sbjct  697  EPPVIPTDPTEPSKPTEPTTPSEPEKPTEPTTPIDPGTPVEPTEPSDPT------EPSQP  750

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            +EPT P+ P K  +P    EPT P  P K   P     P  P  P++
Sbjct  751  TEPTTPSEPEKPVTPEQPKEPTQPVIPEKPAEPETPKTPEQPTKPID  797



>gb|AGC91524.1| putative biofilm-associated protein [Staphylococcus warneri SG1]
Length=2922

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/121 (29%), Positives = 54/121 (45%), Gaps = 3/121 (2%)
 Frame = +2

Query  113   NSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAM  292
             N+S +   T++ +  P+    P   ++P  P  P     P    +PT P+HP    +P  
Sbjct  2713  NTSPSTDGTVIDDGKPVDPSQPTDPTDPGKPTDPSHPTDPTDPGKPTDPSHPTDPTNPGE  2772

Query  293   LSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTM  472
              ++P+ P        P   S+PT P +P +   P   +EPT P  P +   PA   EPT 
Sbjct  2773  PTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTEPGQPTEPTNPGEPTEPGQPA---EPTN  2829

Query  473   P  475
             P
Sbjct  2830  P  2830



>ref|WP_035427023.1| cell wall anchor protein, partial [Lactobacillus gasseri]
Length=1015

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 30/62 (48%), Gaps = 6/62 (10%)
 Frame = +2

Query  299   EPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPN  478
             EPT P      D PA  SEPT P  P   D PA  +EPT P  P   D PA  SEP  P 
Sbjct  956   EPTTP------DKPAQPSEPTKPEEPTTPDKPARPTEPTKPEEPTTPDKPAQPSEPIKPE  1009

Query  479   HP  484
              P
Sbjct  1010  EP  1011



>ref|WP_011824199.1| hypothetical protein [Prochlorococcus marinus]
 gb|ABM76190.1| Hypothetical protein NATL1_16331 [Prochlorococcus marinus str. 
NATL1A]
Length=190

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/132 (20%), Positives = 56/132 (42%), Gaps = 0/132 (0%)
 Frame = +2

Query  95   ISHLLLNSSMARPITMMPNHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLK  274
            +S +  +S  +  I  +    P++ D P    +P   + P++ D P    +P   + P++
Sbjct  55   VSQIFTSSDSSSSIDNIVEIKPIEEDKPVEEDKPVEEDKPVEEDKPVEEDKPVEEDKPVE  114

Query  275  YESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAM  454
             + P    +P   +  ++ D P    +P   + P++ D P    +P     P++ D P  
Sbjct  115  EDKPVEEDKPVEEDKPVEEDKPVEEDKPVEEDKPVEEDKPVEEDKPVEEDKPVEEDKPVE  174

Query  455  LSEPTMPNHPLN  490
              +P   + P+ 
Sbjct  175  EDKPVEEDKPVE  186



>gb|KEK46499.1| LPXTG cell wall anchor domain protein, partial [Staphylococcus 
warneri Lyso 1 2011]
Length=1859

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             HP    +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1610  HPTDPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1669

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              P   + P  P  P +   P    EPT PS P +  +P   ++P+ P  P N
Sbjct  1670  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTN  1721


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             HP     P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1595  HPTDPTDPGKPTDPSHPTDPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1654

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              P   + P  P  P +   P    EPT PS P +  +P   ++P+ P  P N
Sbjct  1655  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTN  1706


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 48/112 (43%), Gaps = 0/112 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P +  +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1640  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1699

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              P   + P  P  P +   P    EPT PS P +  +P   +EP  P  P N
Sbjct  1700  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTEPGQPTEPTN  1751


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/112 (29%), Positives = 49/112 (44%), Gaps = 0/112 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
              P +  +P   ++P+ P  P     P   S+PT P +P +   P+  +EPT P       
Sbjct  1625  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1684

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              P   + P  P  P +   P    EPT PS P +  +P   ++P+ P  P N
Sbjct  1685  QPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTN  1736


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 33/114 (29%), Positives = 52/114 (46%), Gaps = 0/114 (0%)
 Frame = +2

Query  155   HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             +P +   P+  +EPT P  P     P   + P  P  P +   P    EPT P+   +  
Sbjct  1616  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPT  1675

Query  335   SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
             +P   ++P+ P  P     P   S+PT P++P +   P+  +EPT P  P + S
Sbjct  1676  NPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPSQPTEPTNPGEPTDPS  1729



>ref|WP_036322739.1| hypothetical protein, partial [Microbacterium gubbeenense]
Length=125

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 50/108 (46%), Gaps = 3/108 (3%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAML---SEPTMPNYHLKYDSPAM  346
            PA  SEP  P  P +   PA  +EPT P  P +   PA     +EPT P        P+ 
Sbjct  5    PAEPSEPAEPGEPAEPTDPAEPAEPTDPAEPTEPTEPAEPTEPAEPTDPAEPTDPTEPSE  64

Query  347  LSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
             +EPT P  P +   PA  +EPT P+ P     P   +EPT P  P +
Sbjct  65   PAEPTEPTDPAEPTGPAEPAEPTSPAEPTGPAEPTSPAEPTDPAEPTD  112



>gb|EPQ06187.1| Sialidase, partial [Myotis brandtii]
Length=175

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P++  +P+  +EP  P+ P   + P   S P+ PN P++  +P+  +EP  P+     
Sbjct  8    NEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAP  67

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
            + P   S P+ PN P++  +P+  +EP  PS P   + P   S P+ PN P+  S
Sbjct  68   NEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPSAPSAPNEPIEPS  122



>ref|XP_007812695.1| Neurofilament triplet H protein [Metarhizium acridum CQMa 102]
 gb|EFY87643.1| Neurofilament triplet H protein [Metarhizium acridum CQMa 102]
Length=467

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/113 (20%), Positives = 56/113 (50%), Gaps = 0/113 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  327  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  386

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGS  496
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P++ +
Sbjct  387  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHAN  439


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  9    PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  68

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  69   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  118


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  15   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  74

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  75   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  124


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  21   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  80

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  81   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  130


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  27   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  86

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  87   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  136


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  33   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  92

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  93   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  142


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  39   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  98

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  99   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  148


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  45   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  104

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  105  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  154


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  51   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  110

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  111  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  160


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  57   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  116

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  117  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  166


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  63   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  122

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  123  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  172


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  69   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  128

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  129  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  178


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  75   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  134

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  135  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  184


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  81   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  140

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  141  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  190


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  87   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  146

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  147  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  196


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  93   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  152

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  153  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  202


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  99   PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  158

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  159  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  208


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  105  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  164

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  165  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  214


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  111  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  170

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  171  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  220


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  117  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  176

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  177  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  226


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  123  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  182

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  183  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  232


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  129  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  188

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  189  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  238


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  135  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  194

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  195  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  244


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  141  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  200

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  201  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  250


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  147  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  206

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  207  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  256


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  153  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  212

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  213  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  262


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  159  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  218

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  219  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  268


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  165  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  224

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  225  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  274


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  171  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  230

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  231  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  280


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  177  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  236

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  237  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  286


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  183  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  242

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  243  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  292


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  189  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  248

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  249  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  298


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  195  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  254

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  255  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  304


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  201  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  260

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  261  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  310


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  207  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  266

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  267  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  316


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  213  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  272

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  273  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  322


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  219  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  278

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  279  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  328


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  225  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  284

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  285  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  334


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  231  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  290

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  291  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  340


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  237  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  296

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  297  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  346


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  243  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  302

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  303  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  352


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  249  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  308

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  309  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  358


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  255  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  314

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  315  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  364


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  261  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  320

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  321  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  370


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  267  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  326

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  327  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  376


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  273  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  332

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  333  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  382


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  279  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  338

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  339  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  388


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  285  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  344

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  345  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  394


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  291  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  350

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  351  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  400


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  297  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  356

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  357  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  406


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  303  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  362

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  363  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  412


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  309  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  368

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  369  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  418


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  315  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  374

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  375  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  424


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 54/110 (49%), Gaps = 0/110 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  321  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  380

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P+
Sbjct  381  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPV  430


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/116 (20%), Positives = 56/116 (48%), Gaps = 0/116 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+  + P  +++P   N P+  + P  +++P   N P+    P  +++P   N  +  + 
Sbjct  333  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVND  392

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
            P  +++P   N P+  + P  +++P   + P+  + P  +++P   N P   + ++
Sbjct  393  PVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHVNDPVHANGPACATKQE  448



>ref|WP_033102701.1| MULTISPECIES: ribonuclease [Alteromonadales]
 gb|KGK02706.1| ribonuclease, Rne/Rng family [Pseudoalteromonas sp. ND6B]
Length=1059

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 37/95 (39%), Gaps = 0/95 (0%)
 Frame = +2

Query  179  AMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEP  358
            A + EP     P+K + P    EP     P+K E P    EP      ++ + P    EP
Sbjct  851  AKVEEPVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAEEPVQAEEPVQTEEPVQTEEP  910

Query  359  TMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
                 P+K + P    EP     P+K + P    E
Sbjct  911  VQTEEPVKAEEPVKAEEPVKTEEPVKTEEPVKTEE  945


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 0/91 (0%)
 Frame = +2

Query  164  KYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPA  343
            K + P    EP     P+K + P    EP     P+K E P    EP      ++ + P 
Sbjct  852  KVEEPVKAEEPVKAEEPVKAEEPVKTEEPVKAEEPVKAEEPVQAEEPVQTEEPVQTEEPV  911

Query  344  MLSEPTMPNHPLKYDSPAMLSEPTMPSHPLK  436
               EP     P+K + P    EP     P+K
Sbjct  912  QTEEPVKAEEPVKAEEPVKTEEPVKTEEPVK  942



>ref|WP_041896497.1| hypothetical protein, partial [Marine Group II euryarchaeote 
SCGC AB-629-J06]
Length=237

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 1/137 (1%)
 Frame = -1

Query  582  LDGARGIEIALDSLLLNTVSPCHKLHCSGDPFKG*FGIVGSDSIAGESYFKG*LGIVGSD  403
            +DG  G   +     L  V   +  + S    KG  G+ G+D   G++  KG  GI G++
Sbjct  19   VDGTNGTNGSKGQKGLTGVDGTNGTNGS-KGQKGLTGVDGTDGAKGDTGLKGIAGIDGTN  77

Query  402  SIAGESYFKG*FGIVGSDSIAGESYFK**FGIVGSDSIAGDSYFKG*FGIVGSDSIAGES  223
               G    KG  GI G++   G    K   GI G+D + GD+  KG  GI G D   G+ 
Sbjct  78   GTNGSKGQKGLGGIDGTNGTNGSKGQKGLTGIDGTDGVKGDTGLKGVAGIDGIDGTKGQK  137

Query  222  YFKG*FGIVGSDSIAGE  172
               G  G  G++   GE
Sbjct  138  GLGGIDGTNGTNGTKGE  154



>ref|WP_040802052.1| hypothetical protein, partial [Staphylococcus simiae]
Length=108

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P+   EP +P++P   + P    EP +P++P     P+   EP +P+     + P    E
Sbjct  3    PSTPGEPDVPSNPDTPNDPGTPGEPDVPSNPDTPNDPSTPGEPDVPSNPDTPNDPGTPGE  62

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P +P++P   + P   SEP +PS+P   ++P    E  +P++P
Sbjct  63   PNVPSNPDTPNDPGTPSEPDVPSNPDTPNNPGTPGESDVPSNP  105



>gb|ACB11433.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
 gb|ACB11436.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
 gb|ACB11444.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=273

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 36/106 (34%), Gaps = 0/106 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVNCKSPVKRKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
             SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPV  204


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  80   RKSPVKKRSPVNRKSPVNCKSPVKRKSPVNCKSPVKRKSPVKTRSPVKRKSPVKRKSPVK  139

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  140  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  193



>ref|WP_014940697.1| signal peptide protein [Lactobacillus buchneri]
 gb|AFS01238.1| hypothetical protein LBUCD034_2264 [Lactobacillus buchneri CD034]
Length=614

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 70/154 (45%), Gaps = 26/154 (17%)
 Frame = +2

Query  47   AMASPSSRLTIGAFLLISHLLLNSSMARPITMMPNHHPLKYDSPAML--------SEPTM  202
            A AS S +  +G    + H ++ + +          +P+  D P ++        ++PT 
Sbjct  365  AAASVSGQSIVGDIGQLFHSVVTTILGEL------QYPILSDVPGIILWVTPSTPNQPTG  418

Query  203  PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
            PN P + + P   ++PT PN P +   P   ++PT PN            +PT PN P +
Sbjct  419  PNQPTEPNQPTQPNQPTQPNQPTQPNQPTQPNQPTQPN------------QPTQPNQPTQ  466

Query  383  YDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
             + P   ++PT P+ P K + P   ++P  PN P
Sbjct  467  PNQPTQPNQPTQPNQPNKPNKPNRPNQPNKPNKP  500



>gb|ELT92048.1| hypothetical protein CAPTEDRAFT_227575 [Capitella teleta]
Length=1981

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/155 (25%), Positives = 73/155 (47%), Gaps = 19/155 (12%)
 Frame = +2

Query  101   HLLLNSSMARPITMMPNHHPL---------------KYDSPAMLSEPTMPNHPLKYDSPA  235
               L  + +++P  +   HHPL               ++   A+LS+P       +  + A
Sbjct  1496  QFLAAALLSQPAQLALQHHPLAAALLSQPAQLALQHQFLVAALLSQPAQLALQHRLLAAA  1555

Query  236   MLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPT  415
             +LS+P  P    ++ + A+LS+P       ++ + A+LS+P  P    ++ + A+LS+P 
Sbjct  1556  LLSQPAQPALQHQFLAAALLSQPAQSALQHQFLAAALLSQPAQPALQHQFLAAALLSQPA  1615

Query  416   MPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ*SLWH  520
              P+   ++ + A+LS+P  P       P Q +L H
Sbjct  1616  QPALQHRFLAAALLSQPAQPAR----QPAQSALQH  1646



>gb|ACB11441.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=237

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 36/106 (34%), Gaps = 0/106 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
             SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTKSPVKRKSPVKRKSPV  204


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  80   RKSPVKKRSPVNRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVK  139

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  140  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTKSPVK  193



>gb|ACB11429.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=249

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 38/114 (33%), Gaps = 1/114 (1%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K +SP     P      +K
Sbjct  128  RKSPVKRKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  187

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP     P     PLK  SP     P     PLK  SP     P     PL 
Sbjct  188  RKSPVKRKSPVK-RSPLKRKSPVNKRSPVKRKSPLKRKSPVNKRSPVKRKSPLK  240



>gb|EWZ85759.1| hypothetical protein FOWG_10855 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=682

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 40/109 (37%), Gaps = 0/109 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P   + PA  SEP     P     PA  + P   N P     PA  SEP   N       
Sbjct  256  PATQNGPATQSEPATQTLPATQSEPATQTLPATQNGPATQSEPATQSEPATENGPATQTG  315

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA  + P   N P     PA  + P   + P+    PA  SEP   N P
Sbjct  316  PATQTLPATQNGPATQSEPATQNGPATQTLPVTQSEPATQSEPATQNGP  364



>ref|WP_039139264.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ24584.1| hypothetical protein JP31_08525, partial [Gallibacterium anatis]
Length=746

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P +   P+  + PA+ ++P + N P     P + ++P      +  
Sbjct  124  NQPVVEAQPVVTNQPAVETQPVVANQPAVETQPVVANQPAAEVQPVVTNQPVAEVQPVVA  183

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + PA+ ++P + N P+    P + ++P +   P+  + P   ++P + N P+
Sbjct  184  NQPAVEAQPVVANQPVVEAQPEVATQPVVEDQPVVANQPVTEAQPVVVNQPV  235


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/112 (21%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
            + P+    P + ++P +   P+  +  A  ++P + N P+    P + ++P +    +  
Sbjct  88   NQPVAEAQPVVANQPAVETQPVVANQSAAETQPEVANQPVVEAQPVVTNQPAVETQPVVA  147

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            + PA+ ++P + N P     P + ++P     P+  + PA+ ++P + N P+
Sbjct  148  NQPAVETQPVVANQPAAEVQPVVTNQPVAEVQPVVANQPAVEAQPVVANQPV  199



>gb|EXA35697.1| hypothetical protein FOVG_12852 [Fusarium oxysporum f. sp. pisi 
HDV247]
Length=739

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 35/104 (34%), Positives = 39/104 (38%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLS  352
            +PA  + P     P     PA  SEP   N P     PA  SEP   N       PA  S
Sbjct  312  TPATQNGPATQTLPATQSEPATQSEPATQNGPATQSEPATQSEPATQNGPATQTLPATQS  371

Query  353  EPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            EP   + P      A  SEP   S P     PA  SEP   + P
Sbjct  372  EPVTQSKPATQSESATQSEPATQSEPATQSEPATQSEPATQSEP  415


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 41/159 (26%), Positives = 61/159 (38%), Gaps = 1/159 (1%)
 Frame = +2

Query  23   PSFN*IPTAMASPSSRLTIGAFLLISHLLLNSSMARPITMMPNHHPLKYDSPAMLSEPTM  202
            P+   +P   + P+++       L +     ++ + P T    + P     PA  SEP  
Sbjct  274  PATQTLPATQSEPATQNGPATQTLPATQSEPATQSEPATPATQNGPATQTLPATQSEPAT  333

Query  203  PNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLK  382
             + P   + PA  SEP   + P     PA  + P   +  +    PA  SE    + P  
Sbjct  334  QSEPATQNGPATQSEPATQSEPATQNGPATQTLPATQSEPVTQSKPATQSESATQSEPAT  393

Query  383  YDSPAMLSEPTMPSHPLKYDSPAMLSEP-TMPNHPLNGS  496
               PA  SEP   S P     PA  + P T  N P  G+
Sbjct  394  QSEPATQSEPATQSEPATQSEPATQNGPSTATNAPNQGT  432



>ref|WP_036903336.1| hypothetical protein, partial [Propionibacterium sp. KPL1844]
Length=98

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 0/90 (0%)
 Frame = +2

Query  197  TMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHP  376
            T P+ P K    +  ++P  P  P K  +PA  ++PT P   ++  +P   + P  P+ P
Sbjct  9    TKPSTPGKSTKTSKQAKPRTPARPAKPSTPAKPAKPTTPTKPVRPSTPVAPTTPARPSTP  68

Query  377  LKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
             K  +PA  S PT P+HP K   P+  ++P
Sbjct  69   AKATTPAKPSTPTKPTHPTKPAKPSTPAKP  98



>ref|WP_024604127.1| ribonuclease [Pseudoalteromonas haloplanktis]
Length=1062

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/97 (28%), Positives = 39/97 (40%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P+K   PA    P     P+K ++P    EP     P+  E PA    P       K ++
Sbjct  865  PVKAKEPAKAETPVATEEPVKVETPVATEEPAKVETPVATEEPAKAETPVATEEPAKVET  924

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSP  448
            PA   EP     P+  + PA +  P     P K ++P
Sbjct  925  PAATEEPAKVETPVATEEPAKVETPVATEEPAKVETP  961



>gb|ACB11434.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=273

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 36/106 (34%), Gaps = 0/106 (0%)
 Frame = +2

Query  152  HHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKY  331
              P+K  SP     P     P+K  SP     P     P+K +SP     P      +K 
Sbjct  99   KSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVKR  158

Query  332  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPT  469
             SP     P     P+K  SP     P     P+K  SP     P 
Sbjct  159  KSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPV  204


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 37/114 (32%), Gaps = 0/114 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+K  SP     P      +K
Sbjct  80   RKSPVKKRSPVNRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVK  139

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
              SP     P     P+K  SP     P     P+K  SP     P     P+ 
Sbjct  140  RKSPVNCKSPVKTRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVK  193



>ref|WP_008126344.1| ribonuclease [Pseudoalteromonas sp. BSi20480]
 dbj|GAA73643.1| ribonuclease E [Pseudoalteromonas sp. BSi20480]
Length=1040

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/91 (30%), Positives = 38/91 (42%), Gaps = 6/91 (7%)
 Frame = +2

Query  191  EPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPN  370
            EP     P+K + P    EP     P+K E P    EP      +K + P    EP    
Sbjct  861  EPVQTEEPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEP------VKAEEPVQAEEPVKAE  914

Query  371  HPLKYDSPAMLSEPTMPSHPLKYDSPAMLSE  463
             P+K + P    EP     P+K + PA+ +E
Sbjct  915  EPVKAEEPVKAEEPVKAEEPVKAEEPALEAE  945


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/84 (29%), Positives = 36/84 (43%), Gaps = 0/84 (0%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P++ + P    EP     P+K + P    EP     P+K E P    EP      +K + 
Sbjct  862  PVQTEEPVKAEEPVQTEEPVKAEEPVKAEEPVKAEEPVKAEEPVQAEEPVKAEEPVKAEE  921

Query  338  PAMLSEPTMPNHPLKYDSPAMLSE  409
            P    EP     P+K + PA+ +E
Sbjct  922  PVKAEEPVKAEEPVKAEEPALEAE  945



>ref|WP_039161440.1| hypothetical protein, partial [Gallibacterium anatis]
 gb|KGQ24862.1| hypothetical protein JP33_07780, partial [Gallibacterium anatis 
CCM5995]
Length=594

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            PA+ ++P + N P+    P + ++P +   P+    P + ++P + N       P + ++
Sbjct  2    PAVETQPVVANQPVVETQPVVANQPAVETQPVVATQPVVETQPVIANQPAAETQPVVANQ  61

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
            P + N P+    P + ++P + + P+  + P + ++P + N P+
Sbjct  62   PVVTNQPVAEVQPVVANQPAVETQPVVANQPVVETQPVVTNQPV  105



>gb|KFY21541.1| hypothetical protein V493_07318, partial [Pseudogymnoascus pannorum 
VKM F-4281 (FW-2241)]
Length=874

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 1/95 (1%)
 Frame = +2

Query  206  NHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKY  385
              P+     A   EP + N     E P  + EP +     K + PA + EPT    P   
Sbjct  571  EEPVTASEVAEAKEPVVANEAAAVEEPTKVEEPAVVEEITKVEEPAAIQEPTKVEEPAAV  630

Query  386  DSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLN  490
            + P+ + EPT  +   K D+P +  E T    P++
Sbjct  631  EEPSSIKEPTA-AEQAKVDAPVVSEEATKAEEPVS  664



>gb|EGU75460.1| hypothetical protein FOXB_14029 [Fusarium oxysporum Fo5176]
Length=670

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 45/115 (39%), Gaps = 2/115 (2%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P     PA  + P   + P   + PA  SEP   N P     PA  SEP   N       
Sbjct  256  PATQSEPATQNGPATQSEPATQNGPATQSEPATQNGPATQTLPATQSEPATQNGPATQTL  315

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPE  502
            PA  SEP   + P   + PA  SEP   S P   + P+  +    PN     +P+
Sbjct  316  PATQSEPATQSEPATQNGPATQSEPATQSEPATQNGPS--TATNAPNQGTTTAPQ  368


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 37/109 (34%), Positives = 42/109 (39%), Gaps = 6/109 (6%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P     PA  + P   + P   + PA  SEP   N       PA  SEP   N       
Sbjct  244  PTTQRGPATQTLPATQSEPATQNGPATQSEPATQN------GPATQSEPATQNGPATQTL  297

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            PA  SEP   N P     PA  SEP   S P   + PA  SEP   + P
Sbjct  298  PATQSEPATQNGPATQTLPATQSEPATQSEPATQNGPATQSEPATQSEP  346



>gb|ACX55818.1| Aap [Staphylococcus epidermidis]
Length=114

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 42/109 (39%), Gaps = 3/109 (3%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P K   P   +EP  P  P     P   +EP  P  P K   P   +EP  P    K  
Sbjct  9    EPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGKPAEPGKPAEPGKPA  68

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNH  481
             P   +EP  P  P K   PA   +P  P  P++  +PA    P  PN 
Sbjct  69   EPGTPAEPGTPAEPGK---PAESGKPVEPGKPVEPGTPAQSGAPEQPNR  114



>ref|WP_003657303.1| Hypothetical protein, partial [Lactobacillus gasseri]
 gb|EJN53460.1| Hypothetical protein A131_138851, partial [Lactobacillus gasseri 
CECT 5714]
Length=179

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 36/79 (46%), Gaps = 6/79 (8%)
 Frame = +2

Query  245  EPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPS  424
            EPT P+ P +   P    EPT P      D PA  SEP  P  P   D PA  SEPT P 
Sbjct  4    EPTTPDKPARPTEPTKPEEPTTP------DKPAQPSEPIKPEEPTTPDKPAQPSEPTEPK  57

Query  425  HPLKYDSPAMLSEPTMPNH  481
             P   D P   SEPT P  
Sbjct  58   EPTTPDKPTQPSEPTKPEE  76



>ref|XP_011244138.1| PREDICTED: endochitinase A-like [Mus musculus]
 ref|XP_011243012.1| PREDICTED: endochitinase A-like [Mus musculus]
Length=248

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 56/113 (50%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
            +  P     PA+ +EP +   P+   +PA+ +EP +   P    +PA+ +EP +    + 
Sbjct  15   STEPAVSTEPAVSTEPAVSTEPMVSTAPAVSTEPMVSTEPAVSTAPAVSTEPAVSTEPMV  74

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
              +PA+ + P +   P+    PA+ +EP + + P+    P + +EP +   P+
Sbjct  75   STAPAVSTAPAVSTEPMVSTEPAVSTEPAVSTEPVVSTEPMVSTEPVVSTEPM  127



>ref|XP_002736705.2| PREDICTED: uncharacterized protein C1orf173-like [Saccoglossus 
kowalevskii]
Length=1336

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 3/118 (3%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDS  337
            P + + P+ + EPT    P K + P+ + EP+    P + E P+ + EP+      + + 
Sbjct  776  PSQDEEPSGVDEPTRVEEPSKVEEPSGVEEPSQVEGPSRVEEPSQVEEPSQDEEPSQDEE  835

Query  338  PAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP---LNGSPE  502
            P+   EP+      + + P+ + EPT    P +  +P  + EP +       ++GSPE
Sbjct  836  PSQDEEPSQDEERSRVEEPSGVEEPTRVEEPSQVQTPFQIEEPRLNEEKVSIVSGSPE  893



>ref|WP_007585714.1| ribonuclease [Pseudoalteromonas sp. BSi20429]
 dbj|GAA69088.1| ribonuclease E [Pseudoalteromonas sp. BSi20429]
Length=1044

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 0/99 (0%)
 Frame = +2

Query  170  DSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAML  349
            + PA +  P +   P K ++P +  EP     P+  E  A +  P +     K ++P + 
Sbjct  864  EEPAKVETPVVTEEPAKVETPVVTEEPAKVETPVATEEQAKVEAPVVTEEPAKVETPVVT  923

Query  350  SEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEP  466
             EP     P+  + PA +  P +   P K ++P +  EP
Sbjct  924  EEPAKVETPVVTEEPAKVEAPVVTEEPAKVETPVVTEEP  962



>ref|XP_010871682.1| PREDICTED: sporozoite surface protein 2-like [Esox lucius]
Length=253

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 52/116 (45%), Gaps = 11/116 (9%)
 Frame = +2

Query  158  PLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMP------NHPLKYESPAMLSEPTMPNY  319
            PL+ + P   ++P   N P +    A  ++PT P      N P +   PA  ++PT P +
Sbjct  140  PLQTNQPTQPAQPAQTNQPTQPAQSAQTNQPTQPAPPLQTNQPTQPAQPAQTNQPTQPAH  199

Query  320  HLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPL  487
                + P   ++P+  N P +   P   ++PT P+ P K        +P  PN P+
Sbjct  200  PAITNQPTQPAQPSQTNRPTQPAQPVQTNQPTQPAQPAK-----QACQPAQPNKPV  250



>gb|ACX55817.1| Aap [Staphylococcus epidermidis]
 gb|ACX55822.1| Aap [Staphylococcus epidermidis]
Length=120

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 45/117 (38%), Gaps = 2/117 (2%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P K   P   +EP  P  P K   P   +EP  P  P     P   +EP  P    K  
Sbjct  3    EPGKPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGTPAEPGKPAEPGKPAEPGKPA  62

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSPEQ  505
             P   +EP  P  P K   P   +EP  P+   K   P    EP  P    +G+PEQ
Sbjct  63   EPGKPAEPGTPAEPGKPAEPGTPAEPGKPAESGKPVEPGKPVEPGTPAQ--SGAPEQ  117



>ref|WP_035756719.1| hypothetical protein, partial [Granulicoccus phenolivorans]
Length=128

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 51/120 (43%), Gaps = 21/120 (18%)
 Frame = +2

Query  188  SEPTMPNHPLKYDSPAMLSEPTMPNHPLK---------------------YESPAMLSEP  304
            +EP+ P+ P +   P   S+PT P+ P +                        P   S+P
Sbjct  3    TEPSQPSQPTQPSQPTQPSQPTQPSQPSQPTEPSQPSQPSQPSQPSQPTQPTEPTQPSQP  62

Query  305  TMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            T P    +   P+  +EPT P+ P +   P   S+PT PS P +   P+  ++PT P  P
Sbjct  63   TQPTEPTQPSQPSQPTEPTQPSQPSQPTQPTEPSQPTQPSQPSQPTEPSQPTQPTEPTQP  122


 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 53/128 (41%), Gaps = 24/128 (19%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLS---------------------EPTMPNHPL  271
             P +   P   S+PT P+ P +   P+  +                     EPT P+ P 
Sbjct  4    EPSQPSQPTQPSQPTQPSQPTQPSQPSQPTEPSQPSQPSQPSQPSQPTQPTEPTQPSQPT  63

Query  272  KYESPAMLSEPTMPNYHLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPA  451
            +   P   S+P+ P    +   P+  S+PT P  P +   P+  S+PT PS P +   P 
Sbjct  64   QPTEPTQPSQPSQPTEPTQ---PSQPSQPTQPTEPSQPTQPSQPSQPTEPSQPTQPTEPT  120

Query  452  MLSEPTMP  475
              SEPT P
Sbjct  121  QPSEPTQP  128



>ref|XP_002780730.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER12525.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=659

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 52/115 (45%), Gaps = 5/115 (4%)
 Frame = +2

Query  155  HPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYD  334
             P +   P   +EPT P  P +   P   +EPT P  P +   P   +EPT P    +  
Sbjct  83   KPTRPTKPTRPTEPTRPTKPTRPTKPTRPTEPTRPTKPTRPTKPTRPTEPTRPTKPTRPT  142

Query  335  SPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP--LNG  493
             P   ++PT P  P +   P M + PTMP+ P     P M + PTMP  P   NG
Sbjct  143  EPTRPTKPTRPTEPTR---PTMPTRPTMPTRPTMPTRPTMPTRPTMPTRPHCKNG  194



>gb|ACB11427.1| neurofilament triplet H1-like protein, partial [Ambystoma tigrinum 
virus]
Length=277

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 39/117 (33%), Gaps = 0/117 (0%)
 Frame = +2

Query  149  NHHPLKYDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLK  328
               P+K  SP     P     P+K  SP     P     P+  +SP     P      +K
Sbjct  104  RKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRKSPVNCKSPVKTRSPVNCKSPVK  163

Query  329  YDSPAMLSEPTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHPLNGSP  499
              SP     P     P+K  SP     P     P+K  SP     P     P+  SP
Sbjct  164  TRSPVKRKSPVNCKSPVKRKSPVKRKSPVNCKSPVKTRSPVKRKSPVKRKSPVKRSP  220



>gb|EHJ07815.1| accumulation-associated protein [Staphylococcus simiae CCM 7213]
Length=154

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  PAMLSEPTMPNHPLKYDSPAMLSEPTMPNHPLKYESPAMLSEPTMPNYHLKYDSPAMLSE  355
            P+   EP +P++P   + P    EP +P++P     P+   EP +P+     + P    E
Sbjct  3    PSTPGEPDVPSNPDTPNDPGTPGEPDVPSNPDTPNDPSTPGEPDVPSNPDTPNDPGTPGE  62

Query  356  PTMPNHPLKYDSPAMLSEPTMPSHPLKYDSPAMLSEPTMPNHP  484
            P +P++P   + P   SEP +PS+P   ++P    E  +P++P
Sbjct  63   PNVPSNPDTPNDPGTPSEPDVPSNPDTPNNPGTPGESDVPSNP  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660