BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016B02 657 bp,

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  131   3e-39   Solanum lycopersicum
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       133   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010269002.1|  PREDICTED: patatin-like protein 2 isoform X2       133   6e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  135   8e-39   Nicotiana sylvestris
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       133   1e-38   Nicotiana sylvestris
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       133   1e-38   Solanum lycopersicum
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         130   1e-38   Solanum tuberosum [potatoes]
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2       132   1e-38   Solanum lycopersicum
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2       133   1e-38   Nicotiana sylvestris
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  134   2e-38   Solanum tuberosum [potatoes]
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                  132   3e-38   
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  134   3e-38   Solanum lycopersicum
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        131   4e-38   Nicotiana tabacum [American tobacco]
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    129   5e-38   Vitis vinifera
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       131   5e-38   Nicotiana tomentosiformis
emb|CDP01332.1|  unnamed protein product                                133   5e-38   Coffea canephora [robusta coffee]
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  130   8e-38   Nicotiana sylvestris
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  131   2e-37   Nicotiana sylvestris
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       129   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       128   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK18751.1|  patatin-like protein                                    124   5e-37   Vigna unguiculata
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  131   5e-37   Solanum tuberosum [potatoes]
emb|CBI19558.3|  unnamed protein product                                128   6e-37   Vitis vinifera
ref|XP_004288052.1|  PREDICTED: patatin-like protein 1                  127   8e-37   Fragaria vesca subsp. vesca
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             127   9e-37   Phaseolus vulgaris [French bean]
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  127   1e-36   Nicotiana tomentosiformis
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                  128   1e-36   Vitis vinifera
ref|XP_003527713.1|  PREDICTED: patatin-like                            125   1e-36   Glycine max [soybeans]
emb|CAN68798.1|  hypothetical protein VITISV_008805                     127   1e-36   Vitis vinifera
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       124   1e-36   Glycine max [soybeans]
ref|XP_010089434.1|  Patatin group A-3                                  128   2e-36   Morus notabilis
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  127   2e-36   Solanum tuberosum [potatoes]
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  127   2e-36   Vitis vinifera
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             124   2e-36   Prunus persica
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  127   3e-36   
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    122   3e-36   
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  127   3e-36   Solanum tuberosum [potatoes]
emb|CBI19557.3|  unnamed protein product                                127   3e-36   Vitis vinifera
ref|XP_004291132.1|  PREDICTED: patatin-like protein 2                  123   3e-36   Fragaria vesca subsp. vesca
emb|CDP07844.1|  unnamed protein product                                125   3e-36   Coffea canephora [robusta coffee]
gb|EMT12540.1|  Patatin group A-3                                       122   3e-36   Aegilops tauschii
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         123   4e-36   Solanum tuberosum [potatoes]
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                     121   4e-36   Eucalyptus grandis [rose gum]
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  121   4e-36   Eucalyptus grandis [rose gum]
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                  125   5e-36   Tarenaya hassleriana [spider flower]
emb|CBI19549.3|  unnamed protein product                                127   5e-36   Vitis vinifera
gb|KHN12765.1|  Patatin group A-3                                       122   5e-36   Glycine soja [wild soybean]
gb|EMS50940.1|  Patatin group A-3                                       122   5e-36   Triticum urartu
emb|CBI19553.3|  unnamed protein product                                126   5e-36   Vitis vinifera
ref|XP_004310193.1|  PREDICTED: patatin-like protein 2                  124   5e-36   Fragaria vesca subsp. vesca
ref|XP_008339923.1|  PREDICTED: patatin-like protein 1 isoform X1       121   5e-36   Malus domestica [apple tree]
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    128   6e-36   
ref|XP_011099181.1|  PREDICTED: patatin-like protein 1                  125   6e-36   Sesamum indicum [beniseed]
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1       125   7e-36   Nicotiana sylvestris
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  125   7e-36   Vitis vinifera
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2       122   7e-36   Brachypodium distachyon [annual false brome]
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        121   7e-36   Nicotiana tabacum [American tobacco]
gb|KHN04516.1|  Patatin group A-3                                       123   8e-36   Glycine soja [wild soybean]
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                  122   8e-36   Vitis vinifera
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       122   8e-36   Brachypodium distachyon [annual false brome]
emb|CBI19560.3|  unnamed protein product                                127   8e-36   Vitis vinifera
ref|XP_009366942.1|  PREDICTED: patatin-like protein 1 isoform X1       123   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  123   9e-36   Nicotiana sylvestris
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             124   9e-36   Phaseolus vulgaris [French bean]
emb|CBI21444.3|  unnamed protein product                                122   1e-35   Vitis vinifera
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  126   1e-35   Vitis vinifera
emb|CDP02483.1|  unnamed protein product                                123   1e-35   Coffea canephora [robusta coffee]
emb|CDP04311.1|  unnamed protein product                                123   1e-35   Coffea canephora [robusta coffee]
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                  127   1e-35   
gb|ACU24007.1|  unknown                                                 122   1e-35   Glycine max [soybeans]
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  127   1e-35   Eucalyptus grandis [rose gum]
ref|XP_009797489.1|  PREDICTED: patatin-like protein 2 isoform X2       124   2e-35   Nicotiana sylvestris
gb|KFK30332.1|  hypothetical protein AALP_AA7G248200                    127   2e-35   Arabis alpina [alpine rockcress]
emb|CDP01335.1|  unnamed protein product                                124   2e-35   Coffea canephora [robusta coffee]
ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  124   2e-35   Sesamum indicum [beniseed]
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200          120   2e-35   Sorghum bicolor [broomcorn]
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                  124   2e-35   Cucumis sativus [cucumbers]
emb|CDP02475.1|  unnamed protein product                                122   2e-35   Coffea canephora [robusta coffee]
gb|KFK30330.1|  hypothetical protein AALP_AA7G247800                    123   2e-35   Arabis alpina [alpine rockcress]
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                  123   2e-35   Prunus mume [ume]
ref|XP_003589238.1|  Patatin-like protein                               126   2e-35   Medicago truncatula
ref|XP_003589236.1|  Patatin-like protein                               126   2e-35   Medicago truncatula
gb|KFK30333.1|  hypothetical protein AALP_AA7G248300                    124   2e-35   Arabis alpina [alpine rockcress]
ref|XP_002305891.2|  hypothetical protein POPTR_0004s08270g             123   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004148052.1|  PREDICTED: patatin group A-3-like                  122   2e-35   Cucumis sativus [cucumbers]
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  126   3e-35   Vitis vinifera
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  123   3e-35   Populus euphratica
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                  123   3e-35   Populus euphratica
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  124   3e-35   Vitis vinifera
ref|XP_006380710.1|  hypothetical protein POPTR_0007s11200g             122   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  120   3e-35   Nicotiana sylvestris
ref|XP_009606859.1|  PREDICTED: patatin-like protein 2                  123   3e-35   Nicotiana tomentosiformis
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                  123   3e-35   Cucumis melo [Oriental melon]
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       118   4e-35   Populus euphratica
ref|XP_002523555.1|  Patatin precursor, putative                        121   4e-35   Ricinus communis
ref|XP_002310732.1|  patatin family protein                             122   4e-35   Populus trichocarpa [western balsam poplar]
gb|KJB29508.1|  hypothetical protein B456_005G104200                    124   4e-35   Gossypium raimondii
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                  122   4e-35   Nicotiana tomentosiformis
emb|CDP01333.1|  unnamed protein product                                121   5e-35   Coffea canephora [robusta coffee]
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       118   5e-35   Populus euphratica
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  122   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003544453.1|  PREDICTED: patatin-05                              126   5e-35   Glycine max [soybeans]
ref|XP_003544451.1|  PREDICTED: patatin-05-like                         126   5e-35   Glycine max [soybeans]
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  120   5e-35   Glycine max [soybeans]
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             122   6e-35   Phaseolus vulgaris [French bean]
gb|KJB40252.1|  hypothetical protein B456_007G053800                    124   6e-35   Gossypium raimondii
ref|XP_009589750.1|  PREDICTED: patatin-like protein 2                  118   7e-35   Nicotiana tomentosiformis
gb|EMS66123.1|  Patatin group A-3                                       118   7e-35   Triticum urartu
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  121   7e-35   Pyrus x bretschneideri [bai li]
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  119   8e-35   Prunus mume [ume]
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       124   8e-35   Cicer arietinum [garbanzo]
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             121   9e-35   Prunus persica
gb|KFK30335.1|  hypothetical protein AALP_AA7G248500                    123   9e-35   Arabis alpina [alpine rockcress]
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       117   9e-35   Populus euphratica
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg             121   9e-35   Prunus persica
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   119   1e-34   Citrus sinensis [Valencia orange]
ref|XP_006360248.1|  PREDICTED: patatin-05-like                         120   1e-34   Solanum tuberosum [potatoes]
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       123   1e-34   Cicer arietinum [garbanzo]
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  124   1e-34   Solanum tuberosum [potatoes]
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       117   1e-34   Populus euphratica
ref|XP_010098699.1|  Patatin group A-3                                  123   1e-34   Morus notabilis
ref|XP_002301194.1|  patatin-like family protein                        119   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  120   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2       123   1e-34   
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       120   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  122   2e-34   Solanum lycopersicum
ref|XP_003603015.1|  Patatin-like protein                               124   2e-34   Medicago truncatula
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                  122   2e-34   Phoenix dactylifera
emb|CAN71271.1|  hypothetical protein VITISV_001907                     122   2e-34   Vitis vinifera
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                  117   2e-34   
gb|KDP38383.1|  hypothetical protein JCGZ_04308                         116   2e-34   Jatropha curcas
ref|XP_009133998.1|  PREDICTED: patatin-like protein 2                  119   2e-34   Brassica rapa
ref|XP_002880809.1|  hypothetical protein ARALYDRAFT_344337             120   2e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  122   2e-34   Vitis vinifera
emb|CDY21469.1|  BnaC03g27280D                                          119   2e-34   Brassica napus [oilseed rape]
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                      120   2e-34   Theobroma cacao [chocolate]
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1       119   2e-34   Vitis vinifera
emb|CDP07842.1|  unnamed protein product                                123   2e-34   Coffea canephora [robusta coffee]
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg             118   2e-34   Prunus persica
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  119   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                  120   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008776250.1|  PREDICTED: patatin-like protein 2                  117   2e-34   Phoenix dactylifera
gb|AFK35290.1|  unknown                                                 122   2e-34   Medicago truncatula
gb|AEF30538.1|  patatin-like phospholipase 1                            117   3e-34   Capsicum annuum
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1       121   3e-34   Prunus mume [ume]
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  121   3e-34   Phoenix dactylifera
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  121   3e-34   Phoenix dactylifera
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                  121   3e-34   Phoenix dactylifera
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  122   3e-34   Elaeis guineensis
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg             120   4e-34   Eutrema salsugineum
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                  114   4e-34   Cucumis melo [Oriental melon]
ref|XP_010548410.1|  PREDICTED: patatin-like protein 3 isoform X1       120   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  119   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006285520.1|  hypothetical protein CARUB_v10006962mg             117   4e-34   Capsella rubella
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  117   4e-34   Cucumis melo [Oriental melon]
ref|XP_010548412.1|  PREDICTED: patatin-like protein 3 isoform X3       120   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010269072.1|  PREDICTED: patatin-like protein 2 isoform X2       119   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             119   4e-34   Phaseolus vulgaris [French bean]
ref|XP_009780403.1|  PREDICTED: patatin-like protein 2                  117   4e-34   Nicotiana sylvestris
ref|XP_010269079.1|  PREDICTED: patatin-like protein 2 isoform X3       119   5e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010548411.1|  PREDICTED: patatin-like protein 3 isoform X2       120   5e-34   Tarenaya hassleriana [spider flower]
ref|XP_006660710.1|  PREDICTED: patatin-2-Kuras 2-like isoform X2       119   5e-34   
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                  121   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  120   5e-34   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  118   5e-34   Malus domestica [apple tree]
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             117   5e-34   Populus trichocarpa [western balsam poplar]
ref|XP_008444641.1|  PREDICTED: patatin-like protein 2 isoform X1       116   6e-34   Cucumis melo [Oriental melon]
emb|CDX83197.1|  BnaA03g23090D                                          117   6e-34   Brassica napus [oilseed rape]
ref|XP_004232051.1|  PREDICTED: patatin-like protein 3                  117   6e-34   Solanum lycopersicum
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  119   6e-34   Solanum tuberosum [potatoes]
gb|AAF98370.1|AF158254_1  patatin-like protein 2                        117   6e-34   Nicotiana tabacum [American tobacco]
ref|XP_004957049.1|  PREDICTED: patatin-05-like                         118   6e-34   
ref|XP_008444642.1|  PREDICTED: patatin-like protein 2 isoform X2       115   6e-34   Cucumis melo [Oriental melon]
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  117   6e-34   Elaeis guineensis
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             117   7e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010094388.1|  Patatin group A-3                                  119   7e-34   Morus notabilis
ref|XP_006425860.1|  hypothetical protein CICLE_v10027314mg             119   7e-34   Citrus clementina
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1       115   7e-34   Eucalyptus grandis [rose gum]
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         122   7e-34   Glycine max [soybeans]
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2       116   8e-34   
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2       114   8e-34   Eucalyptus grandis [rose gum]
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  116   8e-34   Nicotiana tomentosiformis
ref|XP_006425859.1|  hypothetical protein CICLE_v10027498mg             116   8e-34   Citrus clementina
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g             117   9e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3       119   1e-33   Vitis vinifera
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  116   1e-33   Eucalyptus grandis [rose gum]
ref|XP_006466737.1|  PREDICTED: patatin-14-like                         115   1e-33   
ref|NP_001063402.2|  Os09g0462400                                       117   1e-33   
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...    115   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002510258.1|  Patatin T5 precursor, putative                     117   1e-33   
gb|EEC84713.1|  hypothetical protein OsI_31673                          117   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_010064133.1|  PREDICTED: patatin-like protein 2                  120   1e-33   Eucalyptus grandis [rose gum]
ref|XP_006829694.1|  hypothetical protein AMTR_s00126p00050070          123   1e-33   Amborella trichopoda
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                  118   1e-33   Malus domestica [apple tree]
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  122   1e-33   Eucalyptus grandis [rose gum]
ref|XP_010437269.1|  PREDICTED: patatin-like protein 1 isoform X1       115   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004167584.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    115   1e-33   
ref|XP_004169210.1|  PREDICTED: patatin group A-3-like                  112   1e-33   
ref|XP_010432097.1|  PREDICTED: patatin-like protein 1                  115   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                  114   1e-33   
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                  117   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  116   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006829699.1|  hypothetical protein AMTR_s00126p00054960          119   1e-33   
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       120   1e-33   
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                  115   1e-33   Brassica rapa
gb|AAB08428.1|  patatin homolog                                         126   2e-33   Nicotiana tabacum [American tobacco]
ref|XP_006360228.1|  PREDICTED: patatin-3-Kuras 1-like                  115   2e-33   Solanum tuberosum [potatoes]
ref|XP_010437270.1|  PREDICTED: patatin-like protein 1 isoform X2       115   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700          120   2e-33   
ref|XP_009780402.1|  PREDICTED: patatin-like protein 2                  116   2e-33   Nicotiana sylvestris
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  115   2e-33   Eucalyptus grandis [rose gum]
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                  117   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009589751.1|  PREDICTED: patatin-like protein 1                  117   2e-33   Nicotiana tomentosiformis
gb|KJB58445.1|  hypothetical protein B456_009G210500                    117   2e-33   Gossypium raimondii
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       120   2e-33   Eucalyptus grandis [rose gum]
ref|XP_010317808.1|  PREDICTED: patatin-like protein 2 isoform X1       116   2e-33   Solanum lycopersicum
ref|XP_004234672.1|  PREDICTED: patatin-like protein 3 isoform X2       116   2e-33   Solanum lycopersicum
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                     115   2e-33   Eucalyptus grandis [rose gum]
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  116   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006473887.1|  PREDICTED: patatin-05-like                         115   2e-33   Citrus sinensis [Valencia orange]
ref|XP_011017230.1|  PREDICTED: patatin-like protein 2                  117   2e-33   Populus euphratica
ref|XP_006419185.1|  hypothetical protein CICLE_v10030450mg             116   2e-33   Citrus clementina
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  114   3e-33   Pyrus x bretschneideri [bai li]
gb|KCW66173.1|  hypothetical protein EUGRSUZ_F00009                     120   3e-33   Eucalyptus grandis [rose gum]
ref|XP_004973690.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       114   3e-33   Setaria italica
ref|XP_006488152.1|  PREDICTED: patatin-05-like                         115   3e-33   Citrus sinensis [Valencia orange]
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1       123   3e-33   Tarenaya hassleriana [spider flower]
gb|ACN25198.1|  unknown                                                 109   3e-33   Zea mays [maize]
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  117   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006829698.1|  hypothetical protein AMTR_s00126p00052810          119   3e-33   
ref|XP_006411935.1|  hypothetical protein EUTSA_v10025343mg             116   3e-33   Eutrema salsugineum
ref|XP_010101003.1|  Patatin group A-3                                  114   4e-33   Morus notabilis
ref|XP_011099197.1|  PREDICTED: patatin-like protein 2                  114   4e-33   Sesamum indicum [beniseed]
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                  120   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             118   4e-33   Phaseolus vulgaris [French bean]
ref|NP_849511.1|  patatin-related phospholipase A                       117   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233432.1|  PREDICTED: patatin-like protein 1                  114   4e-33   Solanum lycopersicum
ref|XP_010942709.1|  PREDICTED: patatin-like protein 2                  120   4e-33   Elaeis guineensis
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg             116   5e-33   Citrus clementina
gb|KHN12764.1|  Patatin group A-3                                       119   5e-33   Glycine soja [wild soybean]
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                    120   5e-33   Arabis alpina [alpine rockcress]
emb|CAA05628.1|  patatin-like protein                                   116   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                  117   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510255.1|  Patatin precursor, putative                        116   5e-33   Ricinus communis
ref|XP_003574632.1|  PREDICTED: patatin-like protein 2                  114   5e-33   
ref|XP_010101001.1|  Patatin group A-3                                  114   5e-33   Morus notabilis
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                  119   5e-33   Zea mays [maize]
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1       114   5e-33   Phoenix dactylifera
ref|XP_010548405.1|  PREDICTED: patatin-like protein 1 isoform X2       122   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_010446709.1|  PREDICTED: patatin-like protein 1 isoform X2       117   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                  114   5e-33   Prunus mume [ume]
dbj|BAK02816.1|  predicted protein                                      112   5e-33   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                  114   5e-33   Eucalyptus grandis [rose gum]
ref|NP_195423.1|  PATATIN-like protein 5                                116   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568015.1|  patatin-related phospholipase A                       116   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  118   6e-33   Eucalyptus grandis [rose gum]
gb|AAM64566.1|  patatin-like protein                                    116   6e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72620.1|  BnaC07g46420D                                          113   6e-33   Brassica napus [oilseed rape]
ref|XP_009773110.1|  PREDICTED: patatin-like protein 2                  115   6e-33   Nicotiana sylvestris
ref|XP_003603014.1|  Patatin-like protein                               119   6e-33   Medicago truncatula
ref|XP_010059758.1|  PREDICTED: patatin-like protein 2                  114   6e-33   Eucalyptus grandis [rose gum]
gb|KDO79284.1|  hypothetical protein CISIN_1g0425841mg                  113   6e-33   Citrus sinensis [Valencia orange]
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2       116   7e-33   
ref|XP_010446710.1|  PREDICTED: patatin-like protein 1 isoform X3       117   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002445640.1|  hypothetical protein SORBIDRAFT_07g023220          114   8e-33   Sorghum bicolor [broomcorn]
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg             115   8e-33   Citrus clementina
ref|XP_002510260.1|  Patatin T5 precursor, putative                     112   8e-33   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                  115   8e-33   Pyrus x bretschneideri [bai li]
ref|NP_001151190.1|  LOC100284823                                       108   8e-33   Zea mays [maize]
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    114   8e-33   
gb|ACG31156.1|  patatin T5 precursor                                    107   8e-33   Zea mays [maize]
ref|XP_002510259.1|  Patatin T5 precursor, putative                     114   8e-33   Ricinus communis
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  120   8e-33   Eucalyptus grandis [rose gum]
ref|XP_010064131.1|  PREDICTED: patatin-like protein 2                  114   8e-33   Eucalyptus grandis [rose gum]
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  113   9e-33   Malus domestica [apple tree]
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516             117   9e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_009785774.1|  PREDICTED: patatin-17-like                         127   9e-33   Nicotiana sylvestris
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 117   9e-33   Theobroma cacao [chocolate]
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  114   9e-33   Pyrus x bretschneideri [bai li]
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g             113   9e-33   
gb|KJB58441.1|  hypothetical protein B456_009G210000                    113   1e-32   
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  116   1e-32   
gb|AFK45431.1|  unknown                                                 112   1e-32   
ref|XP_008245283.1|  PREDICTED: patatin-like protein 2                  113   1e-32   
gb|AAB08427.1|  patatin homolog                                         124   1e-32   
ref|XP_008813727.1|  PREDICTED: patatin-like protein 2                  107   1e-32   
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                  114   1e-32   
ref|XP_010235203.1|  PREDICTED: patatin-like protein 2                  112   1e-32   
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             114   1e-32   
ref|XP_010680489.1|  PREDICTED: patatin-like protein 1                  119   1e-32   
ref|XP_004291128.2|  PREDICTED: patatin-like protein 2                  112   1e-32   
ref|XP_009370192.1|  PREDICTED: patatin-like protein 2                  113   1e-32   
ref|XP_009589752.1|  PREDICTED: patatin-like protein 2                  113   1e-32   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                  112   1e-32   
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                     113   1e-32   
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  113   1e-32   
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  116   1e-32   
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                  113   2e-32   
gb|KHG27256.1|  Patatin group M-3                                       114   2e-32   
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  116   2e-32   
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             114   2e-32   
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       114   2e-32   
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                  114   2e-32   
emb|CDX75621.1|  BnaA01g00810D                                          119   2e-32   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                  114   2e-32   
ref|XP_004291131.1|  PREDICTED: patatin-like protein 2                  114   2e-32   
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                  119   2e-32   
ref|NP_180224.1|  phospholipase A 2A                                    115   2e-32   
gb|AAM63157.1|  similar to latex allergen from Hevea brasiliensis       115   2e-32   
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       111   2e-32   
ref|XP_003611771.1|  Patatin-like protein                               113   2e-32   
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       111   2e-32   
gb|KDP38381.1|  hypothetical protein JCGZ_04306                         116   2e-32   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  113   2e-32   
gb|KCW66463.1|  hypothetical protein EUGRSUZ_F00261                     111   2e-32   
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...    108   2e-32   
emb|CDY42720.1|  BnaA03g53730D                                          111   2e-32   
ref|XP_010942710.1|  PREDICTED: patatin-like protein 2                  116   2e-32   
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            111   3e-32   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                  114   3e-32   
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             114   3e-32   
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  111   3e-32   
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  118   3e-32   
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                  113   3e-32   
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg             113   3e-32   
ref|XP_006434813.1|  hypothetical protein CICLE_v10001337mg             113   3e-32   
emb|CBI19552.3|  unnamed protein product                                114   3e-32   
ref|XP_008220197.1|  PREDICTED: patatin-like protein 2 isoform X2       113   3e-32   
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg             114   3e-32   
ref|XP_010101004.1|  Patatin group A-3                                  111   4e-32   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                     113   4e-32   
ref|XP_002869007.1|  PLA IVA/PLP1                                       114   4e-32   
ref|XP_002301195.2|  hypothetical protein POPTR_0002s12980g             113   4e-32   
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                  113   4e-32   
emb|CBI19544.3|  unnamed protein product                                114   4e-32   
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2       113   4e-32   
ref|XP_004148466.1|  PREDICTED: patatin group A-3-like                  110   4e-32   
ref|XP_009370195.1|  PREDICTED: patatin-like protein 2                  112   4e-32   
emb|CAN76066.1|  hypothetical protein VITISV_001725                     113   4e-32   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                  113   4e-32   
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                  110   5e-32   
ref|XP_009613240.1|  PREDICTED: patatin-like protein 2                  117   5e-32   
gb|KCW66169.1|  hypothetical protein EUGRSUZ_F000051                    111   5e-32   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg             111   5e-32   
ref|XP_007017308.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            111   5e-32   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  114   5e-32   
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                  109   5e-32   
gb|EAZ06806.1|  hypothetical protein OsI_29050                          112   6e-32   
ref|XP_008670246.1|  PREDICTED: patatin-like protein 2 isoform X1       112   6e-32   
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                  113   6e-32   
ref|XP_007047219.1|  Acyl transferase/acyl hydrolase/lysophosphol...    116   6e-32   
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                  113   6e-32   
gb|EMT18762.1|  Patatin group A-3                                       112   6e-32   
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                  113   6e-32   
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            114   6e-32   
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            114   6e-32   
ref|NP_001061678.1|  Os08g0376500                                       111   7e-32   
ref|XP_011458944.1|  PREDICTED: patatin-like protein 2                  115   7e-32   
ref|XP_008670247.1|  PREDICTED: patatin-like protein 2 isoform X2       111   7e-32   
ref|XP_004233945.1|  PREDICTED: patatin-like protein 2                  114   7e-32   
gb|EAZ07350.1|  hypothetical protein OsI_29600                          113   7e-32   
ref|XP_010446708.1|  PREDICTED: patatin-like protein 1 isoform X1       113   7e-32   
ref|XP_010256337.1|  PREDICTED: patatin-like protein 2 isoform X2       111   7e-32   
emb|CBI21441.3|  unnamed protein product                                112   7e-32   
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                     110   7e-32   
gb|KDP31913.1|  hypothetical protein JCGZ_12374                         117   8e-32   
ref|XP_008813728.1|  PREDICTED: patatin-like protein 2                  109   8e-32   
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                  110   8e-32   
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390          107   8e-32   
tpg|DAA40258.1|  TPA: hypothetical protein ZEAMMB73_846494              111   8e-32   
gb|KHN42072.1|  Patatin group A-3                                       113   8e-32   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                  113   8e-32   
ref|XP_006365363.1|  PREDICTED: patatin group M-2-like                  112   9e-32   
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230          113   9e-32   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                  112   9e-32   
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  110   9e-32   
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     117   9e-32   
ref|XP_008241848.1|  PREDICTED: patatin-like protein 2                  113   9e-32   
ref|XP_004288059.1|  PREDICTED: patatin-like protein 1                  112   1e-31   
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       110   1e-31   
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  117   1e-31   
gb|KJB58444.1|  hypothetical protein B456_009G210400                    115   1e-31   
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       110   1e-31   
emb|CAN80453.1|  hypothetical protein VITISV_028107                     114   1e-31   
ref|XP_002456787.1|  hypothetical protein SORBIDRAFT_03g042730          111   1e-31   
ref|XP_010256336.1|  PREDICTED: patatin-like protein 2 isoform X1       111   1e-31   
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g             110   1e-31   
gb|KDP31895.1|  hypothetical protein JCGZ_12356                         106   1e-31   
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      114   1e-31   
emb|CDX69271.1|  BnaC01g01820D                                          117   1e-31   
gb|KJB63811.1|  hypothetical protein B456_010G0176002                   111   1e-31   
gb|KJB58442.1|  hypothetical protein B456_009G210300                    115   1e-31   
ref|XP_009799856.1|  PREDICTED: patatin-like protein 2                  114   1e-31   
ref|XP_008671929.1|  PREDICTED: patatin-like protein 1                  106   1e-31   
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       123   1e-31   
ref|XP_008779684.1|  PREDICTED: patatin-like protein 2                  109   1e-31   
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg             114   1e-31   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         118   1e-31   
tpg|DAA42306.1|  TPA: patatin T5                                        106   1e-31   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1       108   1e-31   
ref|XP_003611772.1|  Patatin-like protein                               110   1e-31   
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380          104   2e-31   
ref|XP_006659497.1|  PREDICTED: patatin-3-Kuras 1-like                  108   2e-31   
emb|CAA73328.1|  patatin-like protein                                   106   2e-31   
emb|CDM80597.1|  unnamed protein product                                108   2e-31   
emb|CDY42719.1|  BnaA03g53720D                                          115   2e-31   
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    108   2e-31   
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                  108   2e-31   
emb|CDX75619.1|  BnaA01g00830D                                          112   2e-31   
gb|AAX99411.1|  patatin-like protein                                    114   2e-31   
ref|XP_002460354.1|  hypothetical protein SORBIDRAFT_02g026818          111   2e-31   
ref|NP_001140826.1|  uncharacterized protein LOC100272901               115   2e-31   
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       109   2e-31   
gb|EMT12539.1|  Patatin group A-3                                       107   2e-31   
ref|XP_004165471.1|  PREDICTED: patatin group A-3-like                  106   2e-31   
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       109   2e-31   
ref|XP_008457886.1|  PREDICTED: patatin-like protein 2                  110   2e-31   
emb|CDP01337.1|  unnamed protein product                                108   2e-31   
ref|XP_009139351.1|  PREDICTED: patatin-like protein 1 isoform X1       112   2e-31   
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                  110   2e-31   
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                  116   2e-31   
emb|CAN71270.1|  hypothetical protein VITISV_001906                     111   2e-31   
ref|XP_009139287.1|  PREDICTED: patatin-like protein 1                  106   2e-31   
ref|XP_004288050.1|  PREDICTED: patatin-like protein 1                  113   2e-31   
ref|XP_002523558.1|  Patatin precursor, putative                        114   2e-31   
ref|XP_010028264.1|  PREDICTED: patatin-like protein 1                  114   3e-31   
gb|EAZ07347.1|  hypothetical protein OsI_29596                          110   3e-31   
gb|AGS13487.1|  PLP protein                                             112   3e-31   
ref|XP_010907851.1|  PREDICTED: patatin-like protein 2                  109   3e-31   
ref|XP_009139399.1|  PREDICTED: patatin-like protein 1 isoform X2       112   3e-31   
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g             108   3e-31   
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    108   3e-31   
gb|EMS48649.1|  Patatin group A-3                                       112   3e-31   
emb|CBI19554.3|  unnamed protein product                                110   3e-31   
ref|XP_011099198.1|  PREDICTED: patatin-like protein 2                  111   3e-31   
ref|XP_008241846.1|  PREDICTED: patatin-like protein 1                  114   3e-31   
ref|XP_006829701.1|  hypothetical protein AMTR_s00126p00059430          115   4e-31   
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435              106   4e-31   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                  109   4e-31   
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g             108   4e-31   
ref|XP_006425839.1|  hypothetical protein CICLE_v10025791mg             108   4e-31   
ref|XP_009626816.1|  PREDICTED: patatin-like protein 3                  115   4e-31   
ref|XP_009799007.1|  PREDICTED: patatin-like protein 3                  112   4e-31   
ref|XP_003574631.1|  PREDICTED: patatin-like protein 2                  110   4e-31   
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  106   5e-31   
gb|EMS54202.1|  Patatin group A-3                                       106   5e-31   
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1       107   5e-31   
ref|XP_008393824.1|  PREDICTED: patatin-like protein 2                  108   5e-31   
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2       107   6e-31   
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             109   6e-31   
ref|XP_007160831.1|  hypothetical protein PHAVU_001G020200g             114   6e-31   
ref|XP_009367379.1|  PREDICTED: patatin-like protein 2                  110   6e-31   
emb|CDP11080.1|  unnamed protein product                                108   6e-31   
emb|CDX69269.1|  BnaC01g01840D                                          110   6e-31   
ref|XP_009605254.1|  PREDICTED: patatin-2-Kuras 1-like                  116   6e-31   
ref|XP_009370175.1|  PREDICTED: patatin-like protein 2                  108   7e-31   
emb|CDX69270.1|  BnaC01g01830D                                          105   7e-31   
ref|XP_004979723.1|  PREDICTED: uncharacterized protein LOC101762...    106   7e-31   
ref|XP_002523557.1|  Patatin class 1 precursor, putative                114   7e-31   
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  112   7e-31   
ref|XP_010270650.1|  PREDICTED: patatin-like protein 2                  110   7e-31   
ref|XP_009138466.1|  PREDICTED: patatin-like protein 1 isoform X1       112   8e-31   
ref|XP_010109903.1|  Patatin group A-3                                  107   9e-31   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg             110   9e-31   
ref|XP_009138467.1|  PREDICTED: patatin-like protein 1 isoform X2       112   9e-31   
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                         116   1e-30   
ref|NP_001151996.1|  patatin T5                                         103   1e-30   
ref|NP_001062043.1|  Os08g0477100                                       108   1e-30   
ref|NP_001141843.1|  hypothetical protein                               108   1e-30   
ref|XP_004980604.1|  PREDICTED: patatin-3-Kuras 1-like                  107   1e-30   
ref|XP_009366807.1|  PREDICTED: patatin-like protein 2                  105   1e-30   
ref|XP_009366946.1|  PREDICTED: patatin-like protein 1 isoform X2       123   1e-30   
gb|EMT32376.1|  Patatin group A-3                                       111   1e-30   
emb|CDX72619.1|  BnaC07g46410D                                          111   1e-30   
gb|ACR34670.1|  unknown                                                 109   1e-30   
ref|XP_010548402.1|  PREDICTED: patatin-like protein 1                  106   1e-30   
dbj|BAJ94292.1|  predicted protein                                      106   1e-30   
ref|XP_009367381.1|  PREDICTED: patatin-like protein 2                  110   1e-30   
ref|XP_004291130.1|  PREDICTED: patatin-like protein 2                  108   1e-30   
ref|XP_006425840.1|  hypothetical protein CICLE_v10025791mg             107   2e-30   
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  106   2e-30   
ref|XP_011085657.1|  PREDICTED: patatin-like protein 2                  108   2e-30   
ref|XP_006374973.1|  hypothetical protein POPTR_0014s03250g             106   2e-30   
ref|NP_001149326.1|  patatin class 1                                    105   2e-30   
ref|XP_010102581.1|  Patatin group A-3                                  109   2e-30   
tpg|DAA48471.1|  TPA: patatin class 1                                   105   2e-30   
ref|XP_007047188.1|  Phospholipase A 2A, IIA,PLA2A, putative            104   2e-30   
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  111   2e-30   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                  113   2e-30   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                  106   2e-30   
ref|XP_006425841.1|  hypothetical protein CICLE_v10025791mg             106   3e-30   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1       107   3e-30   
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     111   3e-30   
ref|NP_001274813.1|  patatin-like protein 1                             120   3e-30   
ref|XP_008339929.1|  PREDICTED: patatin-like protein 1 isoform X2       121   3e-30   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                  108   3e-30   
ref|XP_007202145.1|  hypothetical protein PRUPE_ppa007009mg             105   3e-30   
gb|EEE68866.1|  hypothetical protein OsJ_27669                          105   4e-30   
ref|NP_001062042.1|  Os08g0476900                                       105   4e-30   
ref|XP_002463192.1|  hypothetical protein SORBIDRAFT_02g039470          111   4e-30   



>ref|XP_004233636.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=816

 Score =   131 bits (329),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS----AGIFEVVRDATSLLAGPK  488
            GGL+T ML+AP+K+KRPLYA KDI PFY EH PKIFP     +G+F    +   ++ GPK
Sbjct  72   GGLVTAMLAAPNKDKRPLYAAKDITPFYIEHSPKIFPQISCCSGLFAGAINLAKMINGPK  131

Query  489  YDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YDGKYLH++++  LG TRL  TLT +VIP FDIKT QP +F
Sbjct  132  YDGKYLHELIKRLLGGTRLHDTLTAVVIPTFDIKTLQPVIF  172


 Score = 57.4 bits (137),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +1

Query  136  GEYNAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVI  306
            GE +  ++PP   G +ITIL+IDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFD+I
Sbjct  7    GESSRVAMPPPNTGKLITILTIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLI  66

Query  307  AGTSPEG  327
            AGTS  G
Sbjct  67   AGTSTGG  73


 Score =   121 bits (303),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K KRPLYA KDI PFY EH PKIF    G F    + T +L  PKYDG
Sbjct  483  GGLVTAMLAAPNKAKRPLYAAKDITPFYLEHSPKIFHQIGGPFGGAINLTKMLNRPKYDG  542

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++  LG TRL  TLT +VIP FDIK  QP +F
Sbjct  543  KYLHTLIKGLLGGTRLHDTLTAVVIPTFDIKELQPVIF  580


 Score = 55.5 bits (132),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 3/61 (5%)
 Frame = +1

Query  154  SIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            ++PP   G +ITILSIDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFD+IAGTS  
Sbjct  424  AMPPPNKGKLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTSTG  483

Query  325  G  327
            G
Sbjct  484  G  484



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   133 bits (335),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++N RPL+A KDIVPFY E  PKIFP ++GIF    +   L+ GPKYDG
Sbjct  68   GGLVTAMLTAPNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++ +LGETRL QTLT+IVIP FDIK  QPT+F
Sbjct  128  KYLHSLVEKKLGETRLHQTLTNIVIPTFDIKRLQPTIF  165


 Score = 55.1 bits (131),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGG  69



>ref|XP_010269002.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score =   133 bits (334),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++N RPL+A KDIVPFY E  PKIFP ++GIF    +   L+ GPKYDG
Sbjct  68   GGLVTAMLTAPNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++ +LGETRL QTLT+IVIP FDIK  QPT+F
Sbjct  128  KYLHSLVEKKLGETRLHQTLTNIVIPTFDIKRLQPTIF  165


 Score = 55.1 bits (131),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGG  69



>ref|XP_009794733.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=410

 Score =   135 bits (341),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APDK  RPL+A KDIVPFY EHGPKIFP + G+   ++     L  PKYDG
Sbjct  70   GGLVTAMLTAPDKEGRPLFAAKDIVPFYLEHGPKIFPHNGGLLGSIKRMLKSLVRPKYDG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+V++++LGETRL +TLT+IVIP FDIK  QPTVF
Sbjct  130  KYLHKVIKEKLGETRLHETLTNIVIPTFDIKNLQPTVF  167


 Score = 52.0 bits (123),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            ++TILSIDGGGIRGIIP TI+ YLE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  20   LVTILSIDGGGIRGIIPATILEYLESQLQELDGKDARLADYFDVIAGTSTGG  71



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   133 bits (335),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 3/99 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF--EVVRDATSLLAGPKYD  494
            GGL+T ML+APDK+KRPL+A KDI PFY EHGPKIFP   +    +V+   SL+ GPKY+
Sbjct  71   GGLVTAMLTAPDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLI-GPKYN  129

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLHQV++++LGET L +TLT++VIP FDIK  QPT+F
Sbjct  130  GKYLHQVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIF  168


 Score = 53.9 bits (128),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+ YLE +LQ LDG DAR ADYFD+IAGTS  G
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGG  72



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   133 bits (334),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF---EVVRDATSLLAGPKY  491
            GGL+T ML+AP+K+KRP++A KDI PFY EHGPKIFP  G+     +++   SL+ GPKY
Sbjct  72   GGLVTAMLTAPNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLI-GPKY  130

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +GKYLHQV++++LGET L +TLT++VIP FDIK  QPT+F
Sbjct  131  NGKYLHQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIF  170


 Score = 53.9 bits (128),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP  I+ YLE +LQ LDG DAR ADYFD+IAGTS  G
Sbjct  16   PPTYGKLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGG  73



>ref|XP_006339914.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=405

 Score =   130 bits (327),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K+KRPLYA KDI PFY EH PKIFP  +G+F  V + T ++ GPKYDG
Sbjct  72   GGLVTAMLAAPNKDKRPLYAAKDITPFYIEHSPKIFPQISGLFAGVINLTKMMNGPKYDG  131

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH + +  LG TRL  TLT +VIP FDIKT QP +F
Sbjct  132  KYLHALTKRLLGGTRLHDTLTAVVIPTFDIKTLQPVIF  169


 Score = 56.6 bits (135),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +1

Query  136  GEYNAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVI  306
            GE +  ++PP   G +ITIL+IDGGGIRGIIPG I+AYLE +LQ LDG +AR ADYFDVI
Sbjct  7    GESSRVAMPPPNTGKLITILAIDGGGIRGIIPGVILAYLESQLQELDGENARIADYFDVI  66

Query  307  AGTSPEG  327
            AGTS  G
Sbjct  67   AGTSTGG  73



>ref|XP_010320347.1| PREDICTED: patatin-like protein 2 isoform X2 [Solanum lycopersicum]
Length=388

 Score =   132 bits (333),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF---EVVRDATSLLAGPKY  491
            GGL+T ML+AP+K+KRP++A KDI PFY EHGPKIFP  G+     +++   SL+ GPKY
Sbjct  72   GGLVTAMLTAPNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLI-GPKY  130

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +GKYLHQV++++LGET L +TLT++VIP FDIK  QPT+F
Sbjct  131  NGKYLHQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIF  170


 Score = 53.9 bits (128),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP  I+ YLE +LQ LDG DAR ADYFD+IAGTS  G
Sbjct  16   PPTYGKLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGG  73



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   133 bits (334),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 3/99 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF--EVVRDATSLLAGPKYD  494
            GGL+T ML+APDK+KRPL+A KDI PFY EHGPKIFP   +    +V+   SL+ GPKY+
Sbjct  71   GGLVTAMLTAPDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLI-GPKYN  129

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLHQV++++LGET L +TLT++VIP FDIK  QPT+F
Sbjct  130  GKYLHQVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIF  168


 Score = 53.5 bits (127),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+ YLE +LQ LDG DAR ADYFD+IAGTS  G
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGG  72



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   134 bits (338),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD+N RPLYA KDI PFY EH PKIFP  +G+F  +R+    L G KYDG
Sbjct  66   GGLVTAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKSGLFAPIRNIVQTLIGSKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+V++++L +TRLS T+T++VIP FDIK  QPT+F
Sbjct  126  KYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIF  163


 Score = 52.0 bits (123),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDV+AGTS  G
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGG  67



>ref|XP_006354907.1| PREDICTED: patatin-2-Kuras 4-like [Solanum tuberosum]
Length=384

 Score =   132 bits (332),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF---EVVRDATSLLAGPKY  491
            GGL+T ML+AP+K+KRP++A KDI PFY EHGPKIFP  G+     +V+   SL+ GPKY
Sbjct  68   GGLVTAMLTAPNKDKRPMFAAKDIKPFYLEHGPKIFPQKGMLFFGSIVKTLKSLI-GPKY  126

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +GKYLHQV++++LGET + +TLT++VIP FDIK  QPT+F
Sbjct  127  NGKYLHQVIKEKLGETYIHETLTNVVIPTFDIKNLQPTIF  166


 Score = 53.5 bits (127),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+ YLE +LQ LDG DAR ADYFD+IAGTS  G
Sbjct  12   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGG  69



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   134 bits (337),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+T ML+APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    L GPKYD
Sbjct  66   GGLVTAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLHQV++++L +TRLS T+T++VIP FDIK  QPT+F
Sbjct  126  GKYLHQVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIF  164


 Score = 51.6 bits (122),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG +AR ADYFDVIAGTS  G
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGKEARLADYFDVIAGTSTGG  67



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score =   131 bits (330),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+T ML+APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPKYD
Sbjct  72   GGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYD  131

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++L +TRLS T+T++VIP FDIK  QPT+F
Sbjct  132  GKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIF  170


 Score = 53.9 bits (128),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +1

Query  139  EYNAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            E  A+ I P   G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDVIA
Sbjct  8    ERKASQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIA  67

Query  310  GTSPEG  327
            GTS  G
Sbjct  68   GTSTGG  73



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   129 bits (325),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD  KRPL+A K+I+PFY EHGPKIFP   GIF  +      L GPKYDG
Sbjct  67   GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++++++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  127  KYLKRIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  164


 Score = 55.1 bits (131),  Expect(2) = 5e-38, Method: Composition-based stats.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A LE +LQA+DG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGSLVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGG  68



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   131 bits (329),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+T ML+APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPKYD
Sbjct  72   GGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYD  131

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++L +TRLS T+T++VIP FDIK  QPT+F
Sbjct  132  GKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIF  170


 Score = 53.5 bits (127),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +1

Query  139  EYNAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            E  A+ I P   G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDVIA
Sbjct  8    ERKASQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIA  67

Query  310  GTSPEG  327
            GTS  G
Sbjct  68   GTSTGG  73



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   133 bits (335),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T+ML+APD+NKRPL+A KDI PFY E+GPKIFP   G    VR A   + GPKYDG
Sbjct  69   GGLITSMLAAPDENKRPLFAAKDIKPFYLENGPKIFPQKWGRLASVRSALKAVFGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLHQV++++LGE RL +TLT+IV+P FDIK   PT+F
Sbjct  129  RYLHQVVREKLGEIRLHETLTNIVVPTFDIKNLHPTIF  166


 Score = 51.2 bits (121),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGIRG+IPG I+ YLE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  17   GNLITILSIDGGGIRGLIPGVILEYLESQLQELDGEDARLADYFDVIAGTSTGG  70



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   130 bits (327),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP---SAGIFEVVRDATSLLAGPKY  491
            GGL+T ML+AP K+KRPL+A KDI PFY EHGPKIFP   S  +F  V      L GPKY
Sbjct  71   GGLVTAMLTAPHKDKRPLFAAKDIKPFYLEHGPKIFPQKKSMILFGSVMKTLKSLMGPKY  130

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +GKYLHQV++++LGET+L +TLT++VIP FDIK  QP VF
Sbjct  131  NGKYLHQVIEEKLGETQLHETLTNVVIPTFDIKNLQPKVF  170


 Score = 53.9 bits (128),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+ YLE +LQ LDG DAR ADYFD+IAGTS  G
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGG  72



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   131 bits (329),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+T ML+APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPKYD
Sbjct  66   GGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++L +TRLS T+T++VIP FDIK  QPT+F
Sbjct  126  GKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIF  164


 Score = 52.0 bits (123),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLEAQLQELDGNDARLADYFDVIAGTSTGG  67



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   129 bits (323),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP+K KRPL+A KDIV FY ++ PKIFP  +AG+F    +    ++GPKYD
Sbjct  75   GGLVTAMLTAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKNAGLFNSALNLVGAVSGPKYD  134

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +++  LG+TRLSQTLT++VIP FDIK  QPT+F
Sbjct  135  GKYLHAIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIF  173


 Score = 53.5 bits (127),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 3/61 (5%)
 Frame = +1

Query  154  SIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            S PP   G  +T+L IDGGG+RG+IP TI+A+LE ELQ LDGP+AR ADYFDVIAGTS  
Sbjct  16   STPPPSFGKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVIAGTSTG  75

Query  325  G  327
            G
Sbjct  76   G  76



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   128 bits (321),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 77/103 (75%), Gaps = 6/103 (6%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP------SAGIFEVVRDATSLLAG  482
            GGL+T ML+AP+K KRPL+A KDIV FY ++ PKIFP      SAG+F    +    ++G
Sbjct  75   GGLVTAMLTAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKKFGCSAGLFNSALNLVGAVSG  134

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLH +++  LG+TRLSQTLT++VIP FDIK  QPT+F
Sbjct  135  PKYDGKYLHAIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIF  177


 Score = 53.5 bits (127),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 3/61 (5%)
 Frame = +1

Query  154  SIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            S PP   G  +T+L IDGGG+RG+IP TI+A+LE ELQ LDGP+AR ADYFDVIAGTS  
Sbjct  16   STPPPSFGKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVIAGTSTG  75

Query  325  G  327
            G
Sbjct  76   G  76



>gb|AAK18751.1| patatin-like protein [Vigna unguiculata]
 gb|AAK27797.1| patatin-like protein [Vigna unguiculata]
Length=400

 Score =   124 bits (312),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATS---LLAGPKY  491
            GGL+T ML+AP++N RPLYA KDI  FY EH PKIFP +  + ++  A      L GP+Y
Sbjct  65   GGLVTAMLTAPNENNRPLYAAKDIKDFYLEHTPKIFPQSSSWNLIATAMKKGRSLMGPQY  124

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH++++++LG T+L  TLT++VIPAFDIK  QP +F
Sbjct  125  DGKYLHKLVREKLGNTKLEHTLTNVVIPAFDIKNLQPAIF  164


 Score = 57.0 bits (136),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +IT+LSIDGGGIRGIIPG ++A+LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  13   GALITVLSIDGGGIRGIIPGILLAFLESELQKLDGADARLADYFDVIAGTSTGG  66



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   131 bits (330),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV--VRDATSLLAGPKYD  494
            GGL+T ML+AP+K+ RPL+A KDI PFY EHGPKIFP   +  +  +    + L GPKY+
Sbjct  67   GGLVTAMLTAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWTFLTGPKYN  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLHQV++++LGET+L +TLT++VIP FDIK  QPT+F
Sbjct  127  GKYLHQVIKEKLGETKLHETLTNVVIPTFDIKNIQPTIF  165


 Score = 50.1 bits (118),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRG+IP TI+ YLE +LQ LDG DAR ADYFD+I GTS  G
Sbjct  11   PPINGKFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIITGTSTGG  68



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   128 bits (322),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD  KRPL+A K+I+PFY EHGPKIFP   GIF  +      L GPKYDG
Sbjct  67   GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++++++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  127  KYLKRIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  164


 Score = 52.8 bits (125),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A LE +LQA+DG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGSLVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGG  68



>ref|XP_004288052.1| PREDICTED: patatin-like protein 1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   127 bits (319),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD+N RPL+A KDIVPFY ++ PKIFP S G+   V D   +L GPKYDG
Sbjct  70   GGLITAMLAAPDENNRPLFAAKDIVPFYLDNCPKIFPQSRGLCATVTDLVKVLIGPKYDG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++  +G+ RLSQTLT+++IP FDIKT  P +F
Sbjct  130  KYLHKLIRSIVGDKRLSQTLTNVIIPTFDIKTLLPVIF  167


 Score = 53.5 bits (127),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPG ++ YLE +LQ LDG DAR ADYFDVI+GTS  G
Sbjct  14   PPRYGNLITVLSIDGGGIRGIIPGVLLTYLESQLQHLDGEDARIADYFDVISGTSTGG  71



>ref|XP_007160832.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
 gb|ESW32826.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
Length=413

 Score =   127 bits (318),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF--EVVRDATSLLAGPKYD  494
            GGL+T ML+APD N RPL+A KDI PFY EHGPKIFP        ++ +    L GPKYD
Sbjct  69   GGLVTAMLTAPDNNHRPLFAAKDIKPFYLEHGPKIFPHHSGLGGTIIANLVRSLGGPKYD  128

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++LGE RL  TLT++VIP FDIK+ QP +F
Sbjct  129  GKYLHEVVREKLGEIRLHDTLTNVVIPTFDIKSMQPILF  167


 Score = 53.9 bits (128),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGP+AR ADYFDVI+GTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPEARLADYFDVISGTSTGG  70



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   127 bits (318),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K+KRPLYA KDI PFY EH PKIFP  +G    + + T  + GPKYDG
Sbjct  71   GGLVTAMLAAPNKDKRPLYAAKDITPFYLEHSPKIFPQISGPLAGIINLTKAMGGPKYDG  130

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++D LG TRL  TLT +VIP FDIK  QP +F
Sbjct  131  KYLHKLIKDILGGTRLHDTLTAVVIPTFDIKKLQPVIF  168


 Score = 53.5 bits (127),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +1

Query  136  GEYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            G    A  PP  G +ITIL+IDGGGIRGIIPG I++YLE +LQ LDG DAR ADYFD+IA
Sbjct  7    GSSRVAMPPPNTGTLITILAIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIA  66

Query  310  GTSPEG  327
            GTS  G
Sbjct  67   GTSTGG  72



>ref|XP_002277318.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21443.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   128 bits (321),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+ TML+AP++N RPLYA   I PFY E+GPKIFP  +GI   V +      GPKYDG
Sbjct  63   GGLIATMLTAPNENNRPLYAASGIKPFYLENGPKIFPQKSGILASVENLFKAFTGPKYDG  122

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+D+L +TRL QTLT++VIP FDIK  QPT+F
Sbjct  123  KYLHSLLKDKLRDTRLHQTLTNVVIPTFDIKELQPTIF  160


 Score = 52.0 bits (123),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGI+GIIPG I+ +LE ELQ LDG DAR ADYFDV++GTS  G
Sbjct  7    PPAQGNLITVLSIDGGGIKGIIPGIILDFLESELQKLDGEDARLADYFDVVSGTSTGG  64



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   125 bits (315),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GG++T MLSAP+ N+RPL+A KDI PFY EH PKIFP  +G++  V      L GPKYDG
Sbjct  69   GGIVTAMLSAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLGSLGGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL +V++++LG+TRL +TLT+IVIP FDIKT QP +F
Sbjct  129  KYLKEVVREKLGQTRLHETLTNIVIPTFDIKTLQPIIF  166


 Score = 54.3 bits (129),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGG  70



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   127 bits (319),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD  KRPL+A K+I+PFY EHGPKIFP   GIF  +      L GPKYDG
Sbjct  61   GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMSIVRSLIGPKYDG  120

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++ +++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  121  KYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  158


 Score = 52.8 bits (125),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            ++ PP  G ++TILSIDGGGIRGIIP TI+A LE +LQ LDG DAR ADYFDVIAGTS  
Sbjct  2    SNTPPTYGSLVTILSIDGGGIRGIIPATILALLESQLQXLDGDDARIADYFDVIAGTSTG  61

Query  325  G  327
            G
Sbjct  62   G  62



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   124 bits (311),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS---AGIFEVVRDATSLLAGPKY  491
            GGL+T M++APD N RPL+A KDI PFY +H PKIFP     G   + +   SLL GPKY
Sbjct  69   GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKY  128

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH V++++LG+ RL +TLT++VIP FDIK+ QP +F
Sbjct  129  DGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIF  168


 Score = 55.5 bits (132),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGPDAR ADYFDVI+GTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVISGTSTGG  70



>ref|XP_010089434.1| Patatin group A-3 [Morus notabilis]
 gb|EXB37800.1| Patatin group A-3 [Morus notabilis]
Length=399

 Score =   128 bits (321),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD N RPL++ KDIVPFY EHGPKIFP + G F  V D    L GPKY+G
Sbjct  68   GGLVTAMLAAPDANNRPLFSAKDIVPFYIEHGPKIFPQTRGPFASVVDFVKELIGPKYNG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++++++LG+T L QTLT++VIP FD+K  QPT+F
Sbjct  128  KYLRKLVREKLGQTGLQQTLTNVVIPTFDLKKLQPTIF  165


 Score = 51.6 bits (122),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = +1

Query  157  IPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +PP  G VITILSIDGGGIRGIIPG I+ +LE  LQ LDG D R ADYFDVI GTS  G
Sbjct  11   LPPKYGNVITILSIDGGGIRGIIPGVILNFLESHLQELDGEDVRLADYFDVITGTSTGG  69



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   127 bits (319),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD+N RPLYA KDI PFY E+ PKIFP  +G+F  +R+    L G K DG
Sbjct  66   GGLVTAMLTAPDENNRPLYAAKDITPFYLENCPKIFPQKSGLFTPIRNIVQTLIGSKCDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+V++++L +TRLS T+T++VIP FDIK  QPT+F
Sbjct  126  KYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIF  163


 Score = 52.0 bits (123),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDV+AGTS  G
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGG  67



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   127 bits (319),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD  KRPL+A K+I+PFY EHGPKIFP + GIF  +      L GPKYDG
Sbjct  72   GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDG  131

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++ +++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  132  KYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  169


 Score = 52.0 bits (123),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  16   PPTYGSLVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGG  73



>ref|XP_007202991.1| hypothetical protein PRUPE_ppa019010mg [Prunus persica]
 gb|EMJ04190.1| hypothetical protein PRUPE_ppa019010mg [Prunus persica]
Length=407

 Score =   124 bits (312),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+ TML+AP+ N RPLYA KDIVPFY ++ PKIFP S+G+   V D   +L GPKYDG
Sbjct  69   GGLIATMLAAPNDNNRPLYAAKDIVPFYLDNCPKIFPQSSGLCAAVVDLVKVLTGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+++++ +G+ RL QTLT++VIP FD+K   P +F
Sbjct  129  KYLHKLIRNIVGDKRLDQTLTNVVIPTFDVKKLLPVIF  166


 Score = 54.7 bits (130),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPG ++AYLE +LQ LDG DAR ADYFDVI+GTS  G
Sbjct  13   PPKYGNLITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVISGTSTGG  70



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score =   127 bits (319),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            G L+T ML+APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    L G KYD
Sbjct  66   GSLVTAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGSKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++L +TRLS T+T++VIP FDIK  QPT+F
Sbjct  126  GKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIF  164


 Score = 52.0 bits (123),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTS  318
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDV+AGTS
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTS  64



>ref|XP_008354710.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 1 [Malus 
domestica]
Length=463

 Score =   122 bits (306),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+ TML AP++N RPL+A KDIVPFY  + PKIFP S+G+   V D    L GPKYDG
Sbjct  63   GGLIATMLVAPNENNRPLFAAKDIVPFYLSNCPKIFPRSSGLCATVNDLVKALTGPKYDG  122

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+++++ +G+ RL QTLT++V+P FDIK   P +F
Sbjct  123  KYLHKLVREIIGDKRLDQTLTNLVVPTFDIKKLLPVIF  160


 Score = 56.6 bits (135),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGIRGIIPG ++AYLE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  11   GNLITILSIDGGGIRGIIPGALLAYLESELQKLDGEDARLADYFDVISGTSTGG  64



>ref|XP_006354908.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=409

 Score =   127 bits (319),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV--VRDATSLLAGPKYD  494
            GGL+T ML+AP+K+ RPL+A KDI PFY EHGPKIFP   +  +  +      L GPKYD
Sbjct  67   GGLVTAMLTAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWRFLTGPKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYL +V++++LGET+L +TLT++VIP FDIK  QPT+F
Sbjct  127  GKYLREVIKEKLGETKLHETLTNVVIPTFDIKNIQPTIF  165


 Score = 51.6 bits (122),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRG+IP TI+ YLE +LQ LDG DAR ADYFD+IAGTS  G
Sbjct  11   PPINGKFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGG  68



>emb|CBI19557.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   127 bits (318),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GG++T ML+APD  KRPL+A KDI PFY EHGPKIFP + GIF  +      + GPKYDG
Sbjct  67   GGIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++++++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  127  KYLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  164


 Score = 52.0 bits (123),  Expect(2) = 3e-36, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TI SIDGGGIRGIIP TI+A LE  LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGG  68



>ref|XP_004291132.1| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=407

 Score =   123 bits (309),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP++N RPL++ KDI  FY  H PKIFP  S  +F   R     LAGPKYD
Sbjct  67   GGLVTAMLTAPNENNRPLFSAKDIKDFYLTHSPKIFPQKSGWLFPRARKIIKALAGPKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +++++LG+ +L+QTLT++VIPAFDIK+ QP +F
Sbjct  127  GKYLHGLVREKLGDKKLNQTLTNVVIPAFDIKSLQPAIF  165


 Score = 55.5 bits (132),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  11   PPTFGNLITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGG  68



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   125 bits (315),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPLYA K+I PFY  +GPKIFP  +GI  +++   + + GP YDG
Sbjct  69   GGLITAMLTAPNEKNRPLYAAKEIKPFYLGNGPKIFPQKSGILGLIKPVQNFIPGPLYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++L+++LG+TRL QTLT++VIP FD+K  QPT+F
Sbjct  129  KYLHKILKEKLGQTRLRQTLTNVVIPTFDVKYLQPTIF  166


 Score = 53.1 bits (126),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +1

Query  157  IPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +PP  G +ITILSIDGGGIRGIIP  I+ +LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  12   LPPTNGNLITILSIDGGGIRGIIPAAILDFLESQLQELDGEDARIADYFDVIAGTSTGG  70



>gb|EMT12540.1| Patatin group A-3 [Aegilops tauschii]
Length=390

 Score =   122 bits (305),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APDK+ RPL+  KD+  FY +  PKIFP  G IF  +  A +L  GPKYDG
Sbjct  65   GGLLTVMLAAPDKDGRPLFDAKDLAKFYIDESPKIFPQKGSIFSKIGSALALATGPKYDG  124

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+  LG+T+L   LTH+VIPAFDI   QPT+F
Sbjct  125  KYLHSLLRRHLGDTKLDGALTHVVIPAFDIAYLQPTIF  162


 Score = 57.0 bits (136),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            V+TILSIDGGG+RGIIP T++A+LE+ELQ LDGPDAR ADYFDV+AGTS  G
Sbjct  15   VVTILSIDGGGVRGIIPATVLAFLEKELQKLDGPDARIADYFDVVAGTSTGG  66



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   123 bits (308),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIF-PSAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K KRPLYA KDI PFY EH PKIF  + G F  V + T +L GPKYDG
Sbjct  69   GGLVTAMLAAPNKAKRPLYAAKDITPFYLEHSPKIFHQTGGPFGGVINLTKMLNGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++  LG TRL  TLT +VIP FDIK  QP +F
Sbjct  129  KYLHTLIKGLLGGTRLHDTLTAVVIPTFDIKELQPVIF  166


 Score = 55.5 bits (132),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 3/61 (5%)
 Frame = +1

Query  154  SIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            ++PP   G +ITILSIDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFD+IAGTS  
Sbjct  10   AMPPPTTGKLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTSTG  69

Query  325  G  327
            G
Sbjct  70   G  70



>gb|KCW66471.1| hypothetical protein EUGRSUZ_F00268 [Eucalyptus grandis]
Length=390

 Score =   121 bits (304),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  R L+A KDI  FY EH PKIFP   G++  VR+    L GPKYDG
Sbjct  65   GGLVTAMLTAPNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDG  124

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LGE RL  TLTH+VIP FD++  QPT+F
Sbjct  125  KYLHGLIREKLGEARLHDTLTHVVIPTFDVERLQPTIF  162


 Score = 57.0 bits (136),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+A+LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  9    PPTYGNIITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTSTGG  66



>ref|XP_010064191.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=422

 Score =   121 bits (304),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  R L+A KDI  FY EH PKIFP   G++  VR+    L GPKYDG
Sbjct  65   GGLVTAMLTAPNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDG  124

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LGE RL  TLTH+VIP FD++  QPT+F
Sbjct  125  KYLHGLIREKLGEARLHDTLTHVVIPTFDVERLQPTIF  162


 Score = 56.6 bits (135),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+A+LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  9    PPTYGNIITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTSTGG  66



>ref|XP_010547841.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=407

 Score =   125 bits (313),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+AG +I  FY EH PKIFP     F   ++    L+GPKYDG
Sbjct  66   GGLVTAMLTAPNKKGRPLFAGNEIKDFYLEHCPKIFPQDHFPFSSAKNLVKTLSGPKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLHQ+++++LG+TRL+QTLT++VIP FDIK  QPT+F
Sbjct  126  KYLHQLVKEKLGDTRLNQTLTNVVIPTFDIKRLQPTIF  163


 Score = 53.5 bits (127),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+A+LE E+Q LDG +AR ADYFDVIAGTS  G
Sbjct  10   PPTYGKLITILSIDGGGIRGIIPATILAFLEAEIQKLDGEEARLADYFDVIAGTSTGG  67



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   127 bits (320),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+  KRPL+A KDI PFY EHGPKIFP   GIF  + +    + GP YDG
Sbjct  67   GGLVTAMLTAPNDEKRPLFAAKDIKPFYLEHGPKIFPHRRGIFGWIMNIFRSIVGPNYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LG TRL QTLT +VIP FDIK+ QP++F
Sbjct  127  KYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIF  164


 Score = 50.8 bits (120),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDG GIRGIIP TI+A LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLVTILSIDGRGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGG  68



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   122 bits (307),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS---AGIFEVVRDATSLLAGPKY  491
            GGL+T M++APD N RPL+A KDI PFY +H PKIFP     G   + +   SLL GPKY
Sbjct  69   GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKVVKSLLGGPKY  128

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH V++++LG+ RL +TLT++VIP FDIK+ QP +F
Sbjct  129  DGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIF  168


 Score = 55.5 bits (132),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGPDAR ADYFDVI+GTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVISGTSTGG  70



>gb|EMS50940.1| Patatin group A-3 [Triticum urartu]
Length=336

 Score =   122 bits (305),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APDK+ RPL+  KD+  FY +  PKIFP  G IF  +  A +L  GPKYDG
Sbjct  65   GGLLTVMLAAPDKDGRPLFDAKDLAQFYIDESPKIFPQKGSIFSKIGSALALATGPKYDG  124

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L   LG+T+L   LTH+VIPAFDI   QPT+F
Sbjct  125  KYLHSLLHRHLGDTKLDGALTHVVIPAFDIAYLQPTIF  162


 Score = 56.6 bits (135),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            V+TILSIDGGG+RGIIP  ++A+LE+ELQ LDGPDAR ADYFDV+AGTS  G
Sbjct  15   VVTILSIDGGGVRGIIPAIVLAFLEKELQKLDGPDARIADYFDVVAGTSTGG  66



>emb|CBI19553.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   126 bits (316),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+  KRPL+A KDI PFY +HGPKIFP   GIF  + +    + GP YDG
Sbjct  113  GGLVTAMLTAPNDEKRPLFAAKDIKPFYLKHGPKIFPQRRGIFGWIMNIFRSIVGPNYDG  172

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LG TRL QTLT +VIP FDIK+ QP++F
Sbjct  173  KYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIF  210


 Score = 52.0 bits (123),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  57   PPTYGNLVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGG  114



>ref|XP_004310193.1| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=407

 Score =   124 bits (312),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP++N RPL+A KDI  FY  H PKIFP  S  +F   R     LAGPKYD
Sbjct  67   GGLVTAMLTAPNENNRPLFAAKDIKDFYLTHSPKIFPQKSGWLFPRARKIIKALAGPKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +++++LG+ +L+QTLT++VIPAFDIK  QP +F
Sbjct  127  GKYLHGLVREKLGDKKLNQTLTNVVIPAFDIKNLQPAIF  165


 Score = 53.5 bits (127),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG +AR ADYFDVI+GTS  G
Sbjct  11   PPTFGNLITVLSIDGGGIRGIIPGTILAFLESELQMLDGENARLADYFDVISGTSTGG  68



>ref|XP_008339923.1| PREDICTED: patatin-like protein 1 isoform X1 [Malus domestica]
Length=379

 Score =   121 bits (304),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+ TML AP++N RPL+A KDIVPFY  + PKIFP S+G+   V D    L GPKYDG
Sbjct  63   GGLIATMLVAPNENNRPLFAAKDIVPFYLSNCPKIFPRSSGLCATVNDLVKALTGPKYDG  122

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+++++ +G+ RL QTLT++V+P FDIK   P +F
Sbjct  123  KYLHKLVREIIGDKRLDQTLTNLVVPTFDIKKLLPVIF  160


 Score = 56.6 bits (135),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGIRGIIPG ++AYLE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  11   GNLITILSIDGGGIRGIIPGALLAYLESELQKLDGEDARLADYFDVISGTSTGG  64



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score =   128 bits (322),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+T ML+APD+N RP YA KDI PFY EH PKIFP    G+F  +R     L GPKYD
Sbjct  66   GGLVTAMLTAPDENNRPFYAAKDITPFYLEHCPKIFPQNKCGLFASMRKMVQALIGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++L ++ LS T+T++VIP FDIK  QPT+F
Sbjct  126  GKYLHEVIKEKLKDSLLSNTITNVVIPTFDIKKLQPTIF  164


 Score = 49.7 bits (117),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  IT+LSIDGGGIRGIIP TI+++LE +LQ  DG DAR A+YFDVIAGTS  G
Sbjct  10   PPTYGDFITVLSIDGGGIRGIIPATILSFLESQLQEFDGKDARLAEYFDVIAGTSTGG  67



>ref|XP_011099181.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=399

 Score =   125 bits (313),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 9/102 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-----AGIFEVVRDATSLLAGP  485
            GGL+TTML+APD N RPLYA KDIVPFY EH PKIFP      AG+  ++R       GP
Sbjct  70   GGLVTTMLTAPDTNNRPLYAAKDIVPFYLEHSPKIFPQPRGPFAGLISMMRG----FHGP  125

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYDGKYLH + ++ LG TRL QTLT++V+  FDIK  QP +F
Sbjct  126  KYDGKYLHSLTREMLGNTRLHQTLTNVVLTTFDIKKLQPAIF  167


 Score = 52.8 bits (125),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGG+RGIIP  ++AYLE +LQ LDG D R ADYFDVIAGTS  G
Sbjct  14   PPNKGNLITILSIDGGGVRGIIPAVLLAYLESQLQELDGEDVRIADYFDVIAGTSTGG  71



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score =   125 bits (313),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 9/102 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-----GIFEVVRDATSLLAGP  485
            GGL+T ML+AP+K+KRPL+A KDI PFY EHGP+IFP       GI  + +  T    GP
Sbjct  71   GGLVTAMLTAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFGIGTMWKSVT----GP  126

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KY GKYLH+V++++LGET L +TLT++VIPAFDIK  QPT+F
Sbjct  127  KYGGKYLHKVIKEKLGETHLHETLTNVVIPAFDIKNMQPTIF  168


 Score = 52.8 bits (125),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRG+IPGTI+ Y E +LQALDG DAR ADYFDVIAGTS  G
Sbjct  15   PPTCGNFITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVIAGTSTGG  72



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   125 bits (315),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP+  KRPL+A KDI PFY +HGPKIFP    GIF  + +    + GP YD
Sbjct  67   GGLVTAMLTAPNDEKRPLFAAKDIKPFYLKHGPKIFPQRRWGIFGWIMNIFRSIVGPNYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +++++LG TRL QTLT +VIP FDIK+ QP++F
Sbjct  127  GKYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIF  165


 Score = 52.0 bits (123),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGG  68



>ref|XP_010238242.1| PREDICTED: patatin-like protein 2 isoform X2 [Brachypodium distachyon]
Length=399

 Score =   122 bits (307),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K++RPL+A KDI  FY +H PKIFP   G F  +      L+GP YDG
Sbjct  68   GGLVTAMLTAPNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+V++ +LG  RL QTLT++VIP FDIK  QPT+F
Sbjct  128  KYLHEVVRKKLGSIRLHQTLTNVVIPTFDIKRLQPTIF  165


 Score = 55.1 bits (131),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +1

Query  139  EYNAASIPPGGV--ITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAG  312
            ++N    PP  V  IT+LSIDGGGIRGII    +A+LE ELQ LDG +AR ADYFDVIAG
Sbjct  5    KHNLCRQPPTYVNLITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAG  64

Query  313  TSPEG  327
            TS  G
Sbjct  65   TSTGG  69



>gb|AAF98369.1|AF158253_1 patatin-like protein 3 [Nicotiana tabacum]
Length=411

 Score =   121 bits (303),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLY  KDI  FY EHGP+IFP +     VR  T+L  GPKYDGK
Sbjct  82   GGLITTMLTAPNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGK  141

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + QTLT+ +IP FDIK  QP +F
Sbjct  142  YLRSIINSILGNLTMKQTLTNTIIPTFDIKRLQPIIF  178


 Score = 56.2 bits (134),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  148  AASIPPGGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            A ++  G ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  24   AFAVTKGKMVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTGG  83



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   123 bits (309),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GG++T ML+AP+ N+RPL+A KDI PFY EH PKIFP  +G++  V      L GPKY+G
Sbjct  69   GGIVTAMLTAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLRSLGGPKYNG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL +V+++++GETRL +TLT+IVIP FDIKT QP +F
Sbjct  129  KYLQEVVREKVGETRLHETLTNIVIPTFDIKTLQPIIF  166


 Score = 54.3 bits (129),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGG  70



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score =   122 bits (306),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPLYA   I PFY E+ PKIFP  +GIF  + +   +L GPKYDG
Sbjct  70   GGLITAMLTAPNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L++ LG+ RL QTLT++VIP FDIK  QPT+F
Sbjct  130  KYLHNLLKNVLGDKRLHQTLTNVVIPTFDIKKLQPTIF  167


 Score = 55.1 bits (131),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%), Gaps = 5/69 (7%)
 Frame = +1

Query  136  GEYNAASI---PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFD  300
            GE  ++S+   PP  G +ITILSIDGGG+RGIIPG I+A+LE ELQ LDG DAR ADYFD
Sbjct  3    GETTSSSLQIKPPARGNLITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFD  62

Query  301  VIAGTSPEG  327
            VIAGTS  G
Sbjct  63   VIAGTSTGG  71



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   122 bits (307),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K++RPL+A KDI  FY +H PKIFP   G F  +      L+GP YDG
Sbjct  68   GGLVTAMLTAPNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+V++ +LG  RL QTLT++VIP FDIK  QPT+F
Sbjct  128  KYLHEVVRKKLGSIRLHQTLTNVVIPTFDIKRLQPTIF  165


 Score = 55.1 bits (131),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +1

Query  139  EYNAASIPPGGV--ITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAG  312
            ++N    PP  V  IT+LSIDGGGIRGII    +A+LE ELQ LDG +AR ADYFDVIAG
Sbjct  5    KHNLCRQPPTYVNLITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAG  64

Query  313  TSPEG  327
            TS  G
Sbjct  65   TSTGG  69



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   127 bits (320),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD  KRPL+A K+I+PFY EHGPKIFP + GIF  +      L GPKYDG
Sbjct  98   GGLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDG  157

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++ +++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  158  KYLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  195


 Score = 49.7 bits (117),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            ++TILSIDGGGIRGIIP TI+A LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  48   LVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGG  99



>ref|XP_009366942.1| PREDICTED: patatin-like protein 1 isoform X1 [Pyrus x bretschneideri]
Length=379

 Score =   123 bits (308),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+ TML AP++N RPL+A KDIVPFY  + PKIFP S+G+   V+D    L GPKYDG
Sbjct  63   GGLIATMLVAPNENNRPLFAAKDIVPFYHSNCPKIFPQSSGLCATVKDLVKALTGPKYDG  122

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+++++ +G+ RL QTLT++V+P FDIK   P +F
Sbjct  123  KYLHKLVREIIGDKRLDQTLTNLVVPTFDIKILLPVIF  160


 Score = 54.3 bits (129),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++TILSIDGGGIRGIIPG ++ YLE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  11   GNLVTILSIDGGGIRGIIPGVLLTYLESELQKLDGEDARLADYFDVISGTSTGG  64



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   123 bits (309),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K+KRPLYA KDI PFY EH PKIFP   G    + + T  + GPKYDG
Sbjct  70   GGLVTAMLAAPNKDKRPLYAAKDITPFYLEHSPKIFPQMGGPLAGIINLTKAMGGPKYDG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++  LG TRL  TLT +VIP FDIK  QP +F
Sbjct  130  KYLHKLIKGILGGTRLHDTLTAVVIPTFDIKKLQPVIF  167


 Score = 53.9 bits (128),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +1

Query  136  GEYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            G    A  PP  G +ITIL+IDGGGIRGIIPG I++YLE +LQ LDG DAR ADYFD+IA
Sbjct  6    GSSRVAMPPPNTGTLITILTIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIA  65

Query  310  GTSPEG  327
            GTS  G
Sbjct  66   GTSTGG  71



>ref|XP_007160830.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
 gb|ESW32824.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
Length=407

 Score =   124 bits (311),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSL---LAGPKY  491
            GGL+T ML+AP++N RPLYA KDI  FY EH PKIFP    + ++     L   L GP+Y
Sbjct  70   GGLVTAMLTAPNENNRPLYAAKDIKDFYLEHTPKIFPQNKGWNLISSVMKLSRTLLGPQY  129

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH +++++LG+ +L QTLT++VIPAFDIK  QPT+F
Sbjct  130  DGKYLHNLVREKLGDIKLHQTLTNVVIPAFDIKHLQPTIF  169


 Score = 53.1 bits (126),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPG I+ +LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  18   GHMVTLLSIDGGGIRGIIPGVILGFLESELQKLDGDDARLADYFDVIAGTSTGG  71



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   122 bits (305),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPLYA   I PFY E+ PKIFP  +GIF  + +   +L GPKYDG
Sbjct  70   GGLITAMLTAPNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L++ LG+ RL QTLT++VIP FDIK  QPT+F
Sbjct  130  KYLHNLLKNVLGDKRLHQTLTNVVIPTFDIKKLQPTIF  167


 Score = 55.1 bits (131),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%), Gaps = 5/69 (7%)
 Frame = +1

Query  136  GEYNAASI---PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFD  300
            GE  ++S+   PP  G +ITILSIDGGG+RGIIPG I+A+LE ELQ LDG DAR ADYFD
Sbjct  3    GETTSSSLQIKPPARGNLITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFD  62

Query  301  VIAGTSPEG  327
            VIAGTS  G
Sbjct  63   VIAGTSTGG  71



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   126 bits (316),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GG++T ML+APD  KRPL+A KDI PFY EHGPKIFP + GIF  +      + GPKYDG
Sbjct  67   GGIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++++++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  127  KYLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  164


 Score = 50.8 bits (120),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A LE  LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLVTILSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGG  68



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   123 bits (309),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++N RPLYA KDIVPFY E+ PKIFP   G F  V +A   L GP YDG
Sbjct  71   GGLITAMLAAPNENHRPLYAAKDIVPFYLENSPKIFPQIGGPFGGVVNAFKTLIGPGYDG  130

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KY+ Q+++  LG TRL QTLT IV+P FDIK  QP +F
Sbjct  131  KYVQQLIKSNLGSTRLHQTLTSIVVPTFDIKILQPVIF  168


 Score = 53.9 bits (128),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIPG I+AYLE +LQ LDG +AR ADYFDVIAGTS  G
Sbjct  15   PPNCGNLVTILSIDGGGIRGIIPGVILAYLESQLQELDGEEARIADYFDVIAGTSTGG  72



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   123 bits (309),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++N RPLYA KDI  FY E+ PKIFP    F    +    LL+GPKYDG
Sbjct  67   GGLVTAMLAAPNENNRPLYAAKDIKDFYLENCPKIFPQESNFLGQAQQELRLLSGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +LQ ++G+T+L QTLT++VIP FDIK  QPT+F
Sbjct  127  KYLHNLLQQKVGKTKLHQTLTNVVIPTFDIKLLQPTIF  164


 Score = 53.9 bits (128),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  +TILSIDGGGIRGIIP  I+ +LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  15   GNTVTILSIDGGGIRGIIPSVILGFLESELQKLDGKDARLADYFDVIAGTSTGG  68



>ref|XP_008808514.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=477

 Score =   127 bits (319),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+KN RPL+A  DI  FY E+ PKIFP   GIF    +  +++ GPKYDG
Sbjct  143  GGLVTAMLTAPNKNNRPLFAADDITKFYLENSPKIFPQKTGIFSSTCNLFTVVTGPKYDG  202

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH ++++ LGETRL Q LT+IVIP FDIK  QPT+F
Sbjct  203  KYLHSIIRELLGETRLHQALTNIVIPTFDIKLLQPTIF  240


 Score = 49.7 bits (117),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            A+ PP  G ++T+LSIDGGG+RGIIPGTI+A+LE +L  LDG DAR ADYFDV+AGTS  
Sbjct  84   ANSPPSKGSLVTVLSIDGGGVRGIIPGTILAFLESKLHDLDGEDARIADYFDVVAGTSTG  143

Query  325  G  327
            G
Sbjct  144  G  144



>gb|ACU24007.1| unknown [Glycine max]
Length=188

 Score =   122 bits (307),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS---AGIFEVVRDATSLLAGPKY  491
            GGL+T M++APD N RPL+A KDI PFY +H PKIFP     G   + +   SLL GPKY
Sbjct  69   GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKY  128

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH V++++LG+ RL +TLT++VIP FDIK+ QP +F
Sbjct  129  DGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIF  168


 Score = 53.9 bits (128),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ +LE  LQ LDGPDAR ADYFDVI+GTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESRLQELDGPDARLADYFDVISGTSTGG  70



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score =   127 bits (318),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+A KDI  FY EH PKIFP   G++  VR+    L GPKYDG
Sbjct  65   GGLVTAMLTAPNEKNRPLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDG  124

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++D+LGE RL  TLTH++IP FDI+  QPT+F
Sbjct  125  KYLHGLIKDKLGEARLHDTLTHVIIPTFDIERLQPTIF  162


 Score = 50.1 bits (118),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGG+RGII  TI+A LE EL+ LDG DAR ADYFDVI GTS  G
Sbjct  9    PPTDGNIITILSIDGGGVRGIIAATILASLESELEELDGEDARLADYFDVIGGTSTGG  66



>ref|XP_009797489.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=333

 Score =   124 bits (311),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 9/102 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-----GIFEVVRDATSLLAGP  485
            GGL+T ML+AP+K+KRPL+A KDI PFY EHGP+IFP       GI  + +  T    GP
Sbjct  71   GGLVTAMLTAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFGIGTMWKSVT----GP  126

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KY GKYLH+V++++LGET L +TLT++VIPAFDIK  QPT+F
Sbjct  127  KYGGKYLHKVIKEKLGETHLHETLTNVVIPAFDIKNMQPTIF  168


 Score = 52.4 bits (124),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRG+IPGTI+ Y E +LQALDG DAR ADYFDVIAGTS  G
Sbjct  15   PPTCGNFITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVIAGTSTGG  72



>gb|KFK30332.1| hypothetical protein AALP_AA7G248200 [Arabis alpina]
Length=639

 Score =   127 bits (319),  Expect(2) = 2e-35, Method: Composition-based stats.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGLMT ML+ PD+  RP +A KDIVPFY EH PKIFP   G+F ++     LL+GPKYDG
Sbjct  305  GGLMTAMLTVPDETGRPHFAAKDIVPFYLEHSPKIFPQPEGLFALLPKLPKLLSGPKYDG  364

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGETRL QTLT++VIP FDIK  QPT+F
Sbjct  365  KYLKNLLSQFLGETRLHQTLTNVVIPTFDIKKLQPTIF  402


 Score = 49.3 bits (116),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  232  VAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +AYLE++LQ LDG D R ADYFDV+AGTS  G
Sbjct  275  LAYLEKQLQELDGEDVRLADYFDVVAGTSTGG  306



>emb|CDP01335.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   124 bits (310),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++NKRPLYA KDI  FY E  PKIFP +  +F  +      + GP YDG
Sbjct  90   GGLVTAMLTAPNENKRPLYAAKDIKDFYLEECPKIFPQSNHLFSCIERVVKSMTGPTYDG  149

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+++LG+TRL  TLT++VIPAFD+K  QPT+F
Sbjct  150  KYLHSMLREKLGQTRLHDTLTNVVIPAFDVKLSQPTIF  187


 Score = 52.4 bits (124),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  +TILSIDGGGIRGIIPG I+ YLE ELQ LDG DAR A YFDVIAGTS  G
Sbjct  38   GNCVTILSIDGGGIRGIIPGVILGYLETELQKLDGSDARLAGYFDVIAGTSTGG  91



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   124 bits (311),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD N RPLYA KDI  FY +HGPKIFP   G+   +      L  PKY G
Sbjct  67   GGLVTAMLTAPDANNRPLYAAKDIAAFYVKHGPKIFPHKGGVIGSLESMVVQLGRPKYKG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++D LG+TRL  TLT++VIP FDI+  QPTVF
Sbjct  127  KYLHKLIRDNLGQTRLHDTLTNVVIPTFDIRNLQPTVF  164


 Score = 52.4 bits (124),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP  I+  LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPVNGNLITILSIDGGGIRGIIPAKILESLESELQKLDGQDARIADYFDVIAGTSTGG  68



>ref|XP_002445638.1| hypothetical protein SORBIDRAFT_07g023200 [Sorghum bicolor]
 gb|EES15133.1| hypothetical protein SORBIDRAFT_07g023200 [Sorghum bicolor]
Length=438

 Score =   120 bits (300),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 13/103 (13%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA------GIFEVVRDATSLLAG  482
            GGL+T ML+AP+K+ RPL+A KDI  FY EH PKIFPS       G+F+        +AG
Sbjct  101  GGLVTAMLTAPNKDGRPLFAAKDINDFYLEHCPKIFPSGSSGGPLGLFKS-------MAG  153

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLH ++++ LGETR+SQ L +IVIP FDIK  QPTVF
Sbjct  154  PKYDGKYLHSIVRELLGETRVSQALQNIVIPTFDIKLLQPTVF  196


 Score = 56.2 bits (134),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  SIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            S PP  G ++T+LSIDGGG+RGIIPGTI+ +LEE+LQ LDGPDAR ADYFDVIAGTS  G
Sbjct  43   SPPPAYGSIVTVLSIDGGGVRGIIPGTILGFLEEKLQELDGPDARLADYFDVIAGTSTGG  102



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score =   124 bits (310),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T M+SAPD+N RPL++ KDI  FY +H PKIFP   I+ + R    LL+GPKYDGK
Sbjct  66   GGLVTAMISAPDQNNRPLFSAKDINQFYLDHCPKIFPQNRIWPIGR-IVKLLSGPKYDGK  124

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL ++++++LG+T+L QTLT++VIP FDIK  QPT+F
Sbjct  125  YLRKLVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIF  161


 Score = 52.0 bits (123),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPGTI+ +LE ELQ LDG + R ADYFDVIAGTS  G
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRVADYFDVIAGTSTGG  67



>emb|CDP02475.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   122 bits (307),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLYA KDI  FY ++ P+IFP +   +VV+  T+LL GPKYDGK
Sbjct  82   GGLVTTMLTAPNKDSRPLYAAKDITSFYLQNSPQIFPESSRKDVVKSLTNLLGGPKYDGK  141

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH +++  LG   +  TLT +VIP FDIK  QP +F
Sbjct  142  YLHSLIKRLLGNLTMENTLTDVVIPTFDIKRLQPIIF  178


 Score = 53.5 bits (127),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  SIPPGGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +I  G + T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  26   AITKGRLATVLSIDGGGIRGIIPGTILAFLEAKLQELDGPNARIADYFDVVAGTSTGG  83



>gb|KFK30330.1| hypothetical protein AALP_AA7G247800 [Arabis alpina]
Length=401

 Score =   123 bits (308),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDA-TSLLAGPKYDG  497
            GGLMT ML+ PDK  RP +AGKDIVPFY EH PKIFP  G +   +   T  L GPKYDG
Sbjct  68   GGLMTAMLTLPDKTGRPTFAGKDIVPFYLEHAPKIFPQPGFWSPWKPKFTKSLYGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  ++    GE RL  TLT++VIP FDIK FQPT+F
Sbjct  128  KYLRNLISKLTGEARLRDTLTNVVIPTFDIKKFQPTIF  165


 Score = 53.1 bits (126),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGGIRGII G ++AYLE++LQ LDG + R ADYFDVIAGTS  G
Sbjct  12   PPSCGNLVTILSLDGGGIRGIIAGVVLAYLEKQLQELDGENVRLADYFDVIAGTSTGG  69



>ref|XP_008220192.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=417

 Score =   123 bits (309),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLL---AGPKY  491
            GGL+T ML+ PD+N RPL+A KDI  FY EH PKIFP    + ++ DA  ++   +GPKY
Sbjct  73   GGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGDAMDMVKAVSGPKY  132

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH+++++ LG+ RLS TLT+++IP FDIK  QP VF
Sbjct  133  DGKYLHKIVKEILGDIRLSDTLTNVIIPTFDIKRLQPMVF  172


 Score = 52.4 bits (124),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+ +LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  21   GNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGG  74



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   126 bits (316),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 10/103 (10%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP------SAGIFEVVRDATSLLAG  482
            GGL+T ML+APDKN RPL+A KDI PFY EH PKIFP      +  + +V+R     L G
Sbjct  70   GGLVTAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRS----LGG  125

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLHQV++++LG+ RL +TLT+IV+P FDIKT QP +F
Sbjct  126  PKYDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIF  168


 Score = 49.7 bits (117),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR ADYFDVI+GTS  G
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGG  71



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   126 bits (316),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 10/103 (10%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP------SAGIFEVVRDATSLLAG  482
            GGL+T ML+APDKN RPL+A KDI PFY EH PKIFP      +  + +V+R     L G
Sbjct  70   GGLVTAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRS----LGG  125

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLHQV++++LG+ RL +TLT+IV+P FDIKT QP +F
Sbjct  126  PKYDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIF  168


 Score = 49.7 bits (117),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR ADYFDVI+GTS  G
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGG  71



>gb|KFK30333.1| hypothetical protein AALP_AA7G248300 [Arabis alpina]
Length=411

 Score =   124 bits (310),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGLMT ML+ PD+  RP +A KDIVP Y EH PKIFP   G+F  +     LL+GPKYDG
Sbjct  68   GGLMTAMLTVPDETGRPQFAAKDIVPVYLEHSPKIFPQPEGLFARLPKLPKLLSGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGET+L QTLT+IVIP FDIK  QPT+F
Sbjct  128  KYLKNLLSKVLGETKLHQTLTNIVIPTFDIKKLQPTIF  165


 Score = 52.4 bits (124),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RGII G I+AYLE++LQ LDG D R ADYFDV+AGTS  G
Sbjct  12   PPSCGNLVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDMRLADYFDVVAGTSTGG  69



>ref|XP_002305891.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
 gb|EEE86402.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
Length=409

 Score =   123 bits (308),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  G  F    +    L GPKYDG
Sbjct  72   GGLVTAMLAAPNKQNRPLFAAKDINDFYLENSPKIFPQDGSPFASAENLIMTLKGPKYDG  131

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH +++++LG+TRL QTLT+IVIP FDIK  QPT+F
Sbjct  132  KFLHSIVKEKLGDTRLHQTLTNIVIPTFDIKNLQPTIF  169


 Score = 53.1 bits (126),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  16   PPTYGSQITILSIDGGGIRGIIPGTILSFLESELQKLDGADARLADYFDVISGTSTGG  73



>ref|XP_004148052.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004169209.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=394

 Score =   122 bits (305),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPKYDG  497
            GGL+T+ML+APD+N RPLYA KD+  FY EHGPKIFP    F   V D    + GPKYDG
Sbjct  61   GGLVTSMLTAPDENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSVMDIFGKVTGPKYDG  120

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  ++ + LG+T L +TLT ++IPAFDIK  QP +F
Sbjct  121  KYLRTLINNLLGDTTLKETLTQVIIPAFDIKRLQPVIF  158


 Score = 53.9 bits (128),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPD R ADYFDVI+GTS  G
Sbjct  9    GKRITILSIDGGGIRGIIPGTILAFLESKLQELDGPDVRIADYFDVISGTSTGG  62



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   126 bits (316),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GG++T ML+APD  KRPL+A KDI PFY EHGPKIFP + GIF  +      + GPKYDG
Sbjct  67   GGIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++++++LG TRL +TLT +VIP FDIK+ QPT+F
Sbjct  127  KYLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIF  164


 Score = 49.7 bits (117),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TI SIDGGGIRGIIP TI+A LE  LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGG  68



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   123 bits (308),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++ +RPL+  KDIVPFY  + PKIFP ++G+F   ++    ++GPKYDG
Sbjct  68   GGLITAMLAAPNEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++D L +TRL QTLT++VIP FDIK  QP +F
Sbjct  128  KYLHKLVRDILKDTRLQQTLTNVVIPTFDIKKIQPVIF  165


 Score = 52.8 bits (125),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRGI+PG I+AYLE +LQALDG DAR ADYFDVI+GTS  G
Sbjct  12   PPVYGSKITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGG  69



>ref|XP_011007290.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   123 bits (308),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++ +RPL+  KDIVPFY  + PKIFP ++G+F   ++    ++GPKYDG
Sbjct  68   GGLITAMLAAPNEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++D L +TRL QTLT++VIP FDIK  QP +F
Sbjct  128  KYLHKLVRDILKDTRLQQTLTNVVIPTFDIKKIQPVIF  165


 Score = 52.8 bits (125),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRGI+PG I+AYLE +LQALDG DAR ADYFDVI+GTS  G
Sbjct  12   PPVYGSKITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGG  69



>ref|XP_002281798.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21445.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   124 bits (310),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+TTML+AP++N RPLYA  +I PF  EH PKIFP  +GI   V +   +L GPKYDG
Sbjct  69   GGLITTMLAAPNQNNRPLYAASEIKPFLFEHSPKIFPPRSGIIGSVVNFFKILTGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH  +   LG T+L QTLT++VIP FDIK  QPT+F
Sbjct  129  KYLHSQINKLLGNTKLDQTLTNVVIPTFDIKNLQPTIF  166


 Score = 52.0 bits (123),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 5/69 (7%)
 Frame = +1

Query  136  GEYNAASI---PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFD  300
            GE  ++S+   PP  G +ITILSIDGGG+RGII G I+A LE ELQ LDG DAR +DYFD
Sbjct  2    GEGTSSSLQIKPPSRGSLITILSIDGGGVRGIISGIILASLESELQKLDGEDARLSDYFD  61

Query  301  VIAGTSPEG  327
            VIAGTS  G
Sbjct  62   VIAGTSSGG  70



>ref|XP_006380710.1| hypothetical protein POPTR_0007s11200g [Populus trichocarpa]
 gb|ERP58507.1| hypothetical protein POPTR_0007s11200g [Populus trichocarpa]
Length=353

 Score =   122 bits (306),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++ +RPL+  KDIVPFY  + PKIFP ++GIF    +    ++GPKYDG
Sbjct  68   GGLITAMLAAPNEQQRPLFDAKDIVPFYLNNSPKIFPQTSGIFAWPTNVWKAISGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++D L +TRL QTLT++VIP FDIK  QP +F
Sbjct  128  KYLHKLVRDILKDTRLHQTLTNVVIPTFDIKKIQPVIF  165


 Score = 53.1 bits (126),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRGI+PG I+AYLE +LQALDG DAR ADYFDVI+GTS  G
Sbjct  12   PPVYGSKITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGG  69



>ref|XP_009781952.1| PREDICTED: patatin-like protein 3 [Nicotiana sylvestris]
Length=411

 Score =   120 bits (302),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLY  KDI  FY EHGP+IFP +     VR  T+L  GPKYDGK
Sbjct  82   GGLITTMLTAPNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGK  141

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + QTLT+ +IP FDIK  QP +F
Sbjct  142  YLRSMINSILGNLTMKQTLTNTIIPTFDIKRLQPVIF  178


 Score = 54.7 bits (130),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  30   GKMVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTGG  83



>ref|XP_009606859.1| PREDICTED: patatin-like protein 2, partial [Nicotiana tomentosiformis]
Length=161

 Score =   123 bits (308),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GG++T ML+APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPKYD
Sbjct  66   GGVVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQP  602
            GKYLH+V++++L +TRLS T+T++VIP FDIK  QP
Sbjct  126  GKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQP  161


 Score = 52.4 bits (124),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGKDARLADYFDVIAGTSTGG  67



>ref|XP_008444643.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=416

 Score =   123 bits (309),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T M++APD+N RPL++ KDI  FY +H PKIFP    + + R    LL+GPKYDGK
Sbjct  66   GGLVTAMIAAPDQNNRPLFSAKDINQFYLDHCPKIFPQNRTWPLGR-IVKLLSGPKYDGK  124

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH++++++LG+T+L QTLT++VIP FDIK  QPT+F
Sbjct  125  YLHKLVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIF  161


 Score = 52.0 bits (123),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPGTI+ +LE ELQ LDG + R ADYFDVIAGTS  G
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRLADYFDVIAGTSTGG  67



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   118 bits (296),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  S+  F    +    L GPKYD
Sbjct  69   GGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYD  128

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GK+LH +++++LG+T L QTLT+IVIP FDIK  QPT+F
Sbjct  129  GKFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIF  167


 Score = 57.0 bits (136),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI+GTS  G
Sbjct  17   GNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGG  70



>ref|XP_002523555.1| Patatin precursor, putative [Ricinus communis]
 gb|EEF38750.1| Patatin precursor, putative [Ricinus communis]
Length=405

 Score =   121 bits (304),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+ TML AP++ +RPLYA  DIVPFY E+ PKIFP + GIF  + D    L GPKY+G
Sbjct  67   GGLIATMLVAPNEEERPLYAANDIVPFYLENCPKIFPETKGIFACIIDLWKALTGPKYNG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLH +++  L +T+L QTLT++VIPAFDIK  QPT+F
Sbjct  127  RYLHSLIRSILKDTKLHQTLTNLVIPAFDIKKMQPTLF  164


 Score = 53.5 bits (127),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPG I+ YLE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLITILSIDGGGIRGIIPGVILDYLESKLQELDGEDARLADYFDVIAGTSTGG  68



>ref|XP_002310732.1| patatin family protein [Populus trichocarpa]
 gb|EEE91182.1| patatin family protein [Populus trichocarpa]
Length=407

 Score =   122 bits (306),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++ +RPL+  KDIVPFY  + PKIFP ++GIF    +    ++GPKYDG
Sbjct  68   GGLITAMLAAPNEQQRPLFDAKDIVPFYLNNSPKIFPQTSGIFAWPTNVWKAISGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++D L +TRL QTLT++VIP FDIK  QP +F
Sbjct  128  KYLHKLVRDILKDTRLHQTLTNVVIPTFDIKKIQPVIF  165


 Score = 52.8 bits (125),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRGI+PG I+AYLE +LQALDG DAR ADYFDVI+GTS  G
Sbjct  12   PPVYGSKITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGG  69



>gb|KJB29508.1| hypothetical protein B456_005G104200 [Gossypium raimondii]
Length=401

 Score =   124 bits (310),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 9/102 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-----AGIFEVVRDATSLLAGP  485
            GGL+TTML++P++  RPL+A KDI  FY EHGPKIFP      +G+ ++++     + GP
Sbjct  67   GGLLTTMLTSPNEKNRPLFAAKDIKAFYFEHGPKIFPQRRFPFSGVTKIIQS----VMGP  122

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYDGKYLH VL+++LG TRL+QTLT++VIP FDIK  QP +F
Sbjct  123  KYDGKYLHGVLKERLGNTRLNQTLTNVVIPTFDIKKLQPIIF  164


 Score = 51.2 bits (121),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPG I+++LE ELQ LD  +AR ADYFDVIAGTS  G
Sbjct  11   PPCHGDLITVLSIDGGGIRGIIPGIILSFLESELQKLDSEEARIADYFDVIAGTSTGG  68



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score =   122 bits (306),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI----FEVVRDATSLLAGPK  488
            GGL+T ML+AP+K+KRPL+A KDI PFY EHGP+IFP   +       + +   L  GPK
Sbjct  71   GGLVTAMLAAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTMNWFGIGTITNMWKLATGPK  130

Query  489  YDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            Y GKYLH+V++++LG T L +TLT++VIP FDIK  QPT+F
Sbjct  131  YAGKYLHKVIKEKLGGTHLHETLTNVVIPTFDIKNMQPTIF  171


 Score = 52.8 bits (125),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRG+IPGTI+ +LE +LQALDG DAR ADYFDVIAGTS  G
Sbjct  15   PPTCGNLITILSIDGGGIRGLIPGTILEFLESQLQALDGVDARLADYFDVIAGTSTGG  72



>emb|CDP01333.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   121 bits (303),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG--IFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP+++KRPLYA KDI  FY E  PKIFP     +F  V      + GPKYD
Sbjct  66   GGLVTAMLTAPNESKRPLYAAKDIKDFYLEECPKIFPQEKPHLFSGVESLVKSVTGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH ++Q++LG+TRL  TLT++VIPAFD+K  QPT+F
Sbjct  126  GKYLHSMVQEKLGQTRLHDTLTNVVIPAFDVKLSQPTIF  164


 Score = 53.9 bits (128),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  +TILSIDGGGIRGIIPG ++ YLE ELQ LDG D R ADYFDVIAGTS  G
Sbjct  14   GNCVTILSIDGGGIRGIIPGVVLGYLETELQKLDGSDVRLADYFDVIAGTSTGG  67



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   118 bits (295),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  S+  F    +    L GPKYD
Sbjct  69   GGLVTAMLAAPNKQNRPLFAAKDINEFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYD  128

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GK+LH +++++LG+T L QTLT+IVIP FDIK  QPT+F
Sbjct  129  GKFLHGIVKEKLGDTWLQQTLTNIVIPTFDIKRLQPTIF  167


 Score = 57.0 bits (136),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI+GTS  G
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGG  70



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   122 bits (305),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+   RPLYA KDI  FY  H PKIFP S+  F         + GP+YDG
Sbjct  68   GGLVTAMLTAPNMQNRPLYAAKDIKEFYLNHSPKIFPQSSWPFNTAAKVIRAIIGPRYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++  LGETRL QTLT++VIP FDIK  QPT+F
Sbjct  128  KYLHELIRRNLGETRLHQTLTNVVIPTFDIKRLQPTIF  165


 Score = 53.1 bits (126),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGI+GIIP TI+A+LE ELQ LDG DAR ADYFD +AGTS  G
Sbjct  16   GNLITILSIDGGGIKGIIPATILAFLESELQKLDGEDARLADYFDAMAGTSTGG  69



>ref|XP_003544453.1| PREDICTED: patatin-05 [Glycine max]
Length=408

 Score =   126 bits (316),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS---AGIFEVVRDATSLLAGPKY  491
            GGL+T ML+AP++N RPLYA KDI  FY EH PKIFP      +F  +   T  L GP+Y
Sbjct  68   GGLVTAMLTAPNENNRPLYAAKDIKNFYLEHTPKIFPQNKCWNLFSSMVKFTRTLFGPQY  127

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +GKYLH++++++LGET+L QTLT++VIPAFDIK  QPT+F
Sbjct  128  NGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIF  167


 Score = 48.9 bits (115),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPG I+ +LE ELQ LDG   R ADYFDVIAGTS  G
Sbjct  16   GHLVTVLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFDVIAGTSTGG  69



>ref|XP_003544451.1| PREDICTED: patatin-05-like [Glycine max]
Length=408

 Score =   126 bits (316),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA---GIFEVVRDATSLLAGPKY  491
            GGL+T ML+AP++N RPLYA KDI  FY EH PKIFP      +F  +   T  L GP+Y
Sbjct  68   GGLVTAMLTAPNENNRPLYAAKDIKNFYLEHTPKIFPQNKCWNLFSSMVKFTRTLFGPQY  127

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +GKYLH++++++LGET+L QTLT++VIPAFDIK  QPT+F
Sbjct  128  NGKYLHRLIREKLGETKLHQTLTNVVIPAFDIKRLQPTIF  167


 Score = 48.9 bits (115),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPG I+ +LE ELQ LDG   R ADYFDVIAGTS  G
Sbjct  16   GHLVTVLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFDVIAGTSTGG  69



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   120 bits (301),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF--EVVRDATSLLAGPKYD  494
            GGL+T M++APD N RPL+A KDI PFY +H PKIFP        ++      L GPKYD
Sbjct  69   GGLVTAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKMIRSLGGPKYD  128

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++LG+ RL +TLT++VIP FDIK+ QP +F
Sbjct  129  GKYLHEVVKEKLGDIRLHETLTNVVIPTFDIKSLQPIIF  167


 Score = 54.3 bits (129),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGP+AR ADYFDVI+GTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIGFLESQLQELDGPEARLADYFDVISGTSTGG  70



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   122 bits (305),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T MLSAP+ ++RPL+A KDI PFY +H PKIFP  + I+  ++     L GPKYD 
Sbjct  69   GGLVTAMLSAPNDHQRPLFAAKDIRPFYLDHSPKIFPQRSSIWGWIQKLLRSLGGPKYDA  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  V++++LGETRL +TLT+IVIP FDIKT QP +F
Sbjct  129  KYLQGVVREKLGETRLHETLTNIVIPTFDIKTLQPIIF  166


 Score = 52.8 bits (125),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIR IIP TI+A+LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRAIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGG  70



>gb|KJB40252.1| hypothetical protein B456_007G053800 [Gossypium raimondii]
Length=397

 Score =   124 bits (311),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD++ RPL+A KDIVPFY ++GP+IFP  +GI       T  L GP+YDG
Sbjct  68   GGLITAMLAAPDESGRPLFAAKDIVPFYVKNGPQIFPQPSGILAWASTITKALTGPRYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL+++++D LG T+L QTLT I IP FDIK  QPT+F
Sbjct  128  KYLYKLIRDLLGNTKLHQTLTSIAIPTFDIKKLQPTIF  165


 Score = 50.4 bits (119),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPG I+A LE ELQ LDG D R ADYFDV+AGTS  G
Sbjct  12   PPKYGNLITVLSIDGGGIRGIIPGVILAALESELQKLDGEDVRLADYFDVMAGTSTGG  69



>ref|XP_009589750.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=427

 Score =   118 bits (296),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL++TML+AP+K+ RPLYA K+I  FY EHG KIFP +     V+  T+L  GPKYDGK
Sbjct  81   GGLISTMLTAPNKDNRPLYAAKNITNFYMEHGSKIFPESSRSGFVKRITNLFGGPKYDGK  140

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++  LG   + QTLT  VIPAFDIK  QP VF
Sbjct  141  YLKTLVKSILGNLTMKQTLTQTVIPAFDIKRLQPIVF  177


 Score = 55.8 bits (133),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGT++A+LE +LQ +DGPDAR ADYFDV+AGTS  G
Sbjct  29   GKIVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPDARIADYFDVVAGTSTGG  82



>gb|EMS66123.1| Patatin group A-3 [Triticum urartu]
Length=405

 Score =   118 bits (296),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K +RPL+A KDI  FY  H P+IFP   G F  +      L+GP YDG
Sbjct  68   GGLVTAMLTAPNKKRRPLFAAKDIQAFYMNHAPRIFPQLRGAFGRIMGILRSLSGPYYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+V++ +LG  RL QTLT++VIP FDIK  QPT+F
Sbjct  128  KYLHEVVRKKLGSARLHQTLTNVVIPTFDIKRLQPTIF  165


 Score = 55.8 bits (133),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = +1

Query  136  GEYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            G++     PP  G +ITILSIDGGGIRGIIP   +A+LE ELQ LDG +AR ADYFDVIA
Sbjct  4    GKHILCRQPPTYGNLITILSIDGGGIRGIIPAVALAFLESELQKLDGEEARLADYFDVIA  63

Query  310  GTSPEG  327
            GTS  G
Sbjct  64   GTSTGG  69



>ref|XP_009367484.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=415

 Score =   121 bits (303),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+ PD+N RPL++ KDI  FY EH PKIFP  SA +     D    L GPKYD
Sbjct  72   GGLVTAMLTTPDENNRPLFSAKDINAFYLEHCPKIFPQGSAPLIGEAVDMVKNLTGPKYD  131

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +++++LG+ RL+ TLT+++IP FDIK  QPT+F
Sbjct  132  GKYLHNIVKEKLGDKRLNDTLTNVIIPTFDIKRLQPTIF  170


 Score = 53.1 bits (126),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI GTS  G
Sbjct  20   GNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDVITGTSTGG  73



>ref|XP_008241509.1| PREDICTED: patatin-like protein 3 [Prunus mume]
Length=405

 Score =   119 bits (298),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 9/102 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-----AGIFEVVRDATSLLAGP  485
            GGL+ TML+AP+ N RPLYA KDIVPFY ++ PKIFP      A I E+V+    +L GP
Sbjct  69   GGLIATMLAAPNDNNRPLYAAKDIVPFYLDNCPKIFPQPRGLCAQIVELVK----VLTGP  124

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYDGKYLH+++++ +G+ RL QTLT++VIP FD+K   P +F
Sbjct  125  KYDGKYLHKLIRNIVGDKRLDQTLTNVVIPTFDVKKLLPVIF  166


 Score = 54.7 bits (130),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPG ++AYLE +LQ LDG DAR ADYFDVI+GTS  G
Sbjct  13   PPKYGNLITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVISGTSTGG  70



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   124 bits (312),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+ N+RPL+A KDI PFY EH PKIFP    +F  V      LAGPKYDG
Sbjct  71   GGLVTAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKDLFGSVTKLFRSLAGPKYDG  130

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LGE R+ +TLT+IVIP FDIKT QP +F
Sbjct  131  KYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIF  168


 Score = 49.7 bits (117),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ YLE +LQ LDG  AR ADYFDVI GTS  G
Sbjct  15   PPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVITGTSTGG  72



>ref|XP_007226924.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
 gb|EMJ28123.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
Length=410

 Score =   121 bits (304),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLL---AGPKY  491
            GGL+T ML+ PD+N RPL+A KDI  FY EH PKIFP    + ++ +A  ++   +GPKY
Sbjct  66   GGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAVSGPKY  125

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH+++++ LG+ RLS TLT+++IP FDIK  QP VF
Sbjct  126  DGKYLHKIVKEILGDIRLSDTLTNVIIPTFDIKRLQPMVF  165


 Score = 52.4 bits (124),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+ +LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  14   GNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGG  67



>gb|KFK30335.1| hypothetical protein AALP_AA7G248500 [Arabis alpina]
Length=410

 Score =   123 bits (309),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGLMT ML+ PDK  RP +A KDIVPFY EH PKIFP   G+  ++     LL+GPKY G
Sbjct  70   GGLMTAMLTVPDKTGRPHFAAKDIVPFYLEHSPKIFPQPTGLSALLPKLPKLLSGPKYSG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++L D LGET+L+QTLT+IVIP FDIK  QPT+F
Sbjct  130  KYLRKLLSDLLGETKLNQTLTNIVIPTFDIKKLQPTIF  167


 Score = 50.8 bits (120),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RGII G I+ YLE++LQ LDG D R ADYFDV+AGTS  G
Sbjct  14   PPACGNLVTILSLDGGGVRGIIAGVILDYLEKQLQELDGKDVRLADYFDVVAGTSTGG  71



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   117 bits (292),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPKYDG
Sbjct  69   GGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH +++++LG+T L QTLT+IVIP FDIK  QPT+F
Sbjct  129  KFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIF  166


 Score = 57.0 bits (136),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI+GTS  G
Sbjct  17   GNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGG  70



>ref|XP_007227189.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
 gb|EMJ28388.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
Length=410

 Score =   121 bits (304),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLL---AGPKY  491
            GGL+T ML+ PD+N RPL+A KDI  FY EH PKIFP    + ++ +A  ++   +GPKY
Sbjct  66   GGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAVSGPKY  125

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH+++++ LG+ RLS TLT+++IP FDIK  QP VF
Sbjct  126  DGKYLHKIVKEILGDIRLSDTLTNVIIPTFDIKRLQPMVF  165


 Score = 52.4 bits (124),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+ +LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  14   GNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGG  67



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   119 bits (298),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP +  RP+YA KDIVPFY  HGPKIFP     +   V +    L G KYD
Sbjct  67   GGLLTAMLTAPSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGMLANSVVNLVRALMGTKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V+++ L +T+L QTLT++ IP FDIK  QPT+F
Sbjct  127  GKYLHKVIKENLKDTKLHQTLTNVAIPTFDIKKLQPTIF  165


 Score = 54.7 bits (130),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            A+ PP    +ITILSIDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFDVIAGTS  
Sbjct  8    ANQPPTYANLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARLADYFDVIAGTSTG  67

Query  325  G  327
            G
Sbjct  68   G  68



>ref|XP_006360248.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=411

 Score =   120 bits (302),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLY  KDI  FY EHGPKIFP       ++   +L  GPKYDGK
Sbjct  80   GGLVTTMLTAPNKDNRPLYVAKDINNFYMEHGPKIFPQNSRNNFMKKMLNLFGGPKYDGK  139

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++ +LG   + QTLTH +IP FDIK  QP +F
Sbjct  140  YLRSLVRSELGNLTMKQTLTHTLIPTFDIKRLQPIIF  176


 Score = 53.1 bits (126),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  175  ITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +TILSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  31   VTILSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTGG  81



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   123 bits (309),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 10/103 (10%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS----AGIF--EVVRDATSLLAG  482
            GGL+T M++APDKN RPL+A KDI PFY EH PKIFP      GI   +VVR     L G
Sbjct  70   GGLVTAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRS----LGG  125

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLH V++++LG+ RL +T+T+IVIP FDIK+ QP +F
Sbjct  126  PKYDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIF  168


 Score = 50.4 bits (119),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRG+IP TI+ +LE +LQ LDG DAR ADYFDVI+GTS  G
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGG  71



>ref|XP_006354914.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   124 bits (311),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+T ML++PD+N RPLYA KDI PFY EH PKIFP    G+F  +      L GPKYD
Sbjct  66   GGLVTAMLTSPDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++L +T +S T+T++VIP FDIK  QPT+F
Sbjct  126  GKYLHKVVKEKLKDTCISNTITNVVIPTFDIKKLQPTIF  164


 Score = 49.3 bits (116),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRGIIP TI+++LE +LQ LDG DA  ADYFDVIAGTS  G
Sbjct  10   PPTYGDFITILSIDGGGIRGIIPATILSFLELQLQELDGKDATLADYFDVIAGTSTGG  67



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   117 bits (292),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPKYDG
Sbjct  69   GGLVTAMLAAPNKQNRPLFAAKDINEFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH +++++LG+T L QTLT+IVIP FDIK  QPT+F
Sbjct  129  KFLHGIVKEKLGDTWLQQTLTNIVIPTFDIKRLQPTIF  166


 Score = 57.0 bits (136),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI+GTS  G
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGG  70



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   123 bits (309),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+  ML+APD+NKRP  A KDI PFY EH  KIF  ++G  + VR     LAGPKYD 
Sbjct  98   GGLIAAMLAAPDENKRPCIAAKDITPFYLEHASKIFQQTSGFLKSVRSFLGNLAGPKYDE  157

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++D+LGETRL  T+T++VIP FDIK  QPTVF
Sbjct  158  KYLHGLMRDKLGETRLHDTVTNLVIPTFDIKRLQPTVF  195


 Score = 50.4 bits (119),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP TI+++ E +LQ LDG +AR ADYFDVIAGTS  G
Sbjct  42   PPNYGNLITVLSIDGGGIRGIIPATILSFFESQLQELDGEEARLADYFDVIAGTSTGG  99



>ref|XP_002301194.1| patatin-like family protein [Populus trichocarpa]
 gb|EEE80467.1| patatin-like family protein [Populus trichocarpa]
Length=405

 Score =   119 bits (298),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+A KDI  FY +H P+IFP  G  F    +     +GPKYDG
Sbjct  66   GGLVTAMLTAPNEQNRPLFAAKDINDFYLKHSPRIFPQDGSPFAAAGNLIKAFSGPKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LGE RL QTLT++VIP FDIK  QPT+F
Sbjct  126  KYLHSIVKEKLGEKRLHQTLTNVVIPTFDIKYLQPTIF  163


 Score = 54.3 bits (129),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  10   PPTYGNLITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGG  67



>ref|XP_010525997.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=406

 Score =   120 bits (300),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A  +I  FY EH PKIFP     F   ++    L GPKYDG
Sbjct  66   GGLVTAMLTAPNKQGRPLFAASEIKDFYLEHCPKIFPQEHFPFSAAKNLVKTLTGPKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+++ ++LG+TRL+QTLT++VIP FDIK  QPT+F
Sbjct  126  KYLHKLVMEKLGDTRLNQTLTNVVIPTFDIKCLQPTIF  163


 Score = 53.5 bits (127),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP TI+++LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  10   PPTYGSLITVLSIDGGGIRGIIPATILSFLESELQKLDGEEARLADYFDVIAGTSTGG  67



>ref|XP_004499076.1| PREDICTED: patatin-2-Kuras 3-like isoform X2 [Cicer arietinum]
Length=386

 Score =   123 bits (309),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 10/103 (10%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS----AGIF--EVVRDATSLLAG  482
            GGL+T M++APDKN RPL+A KDI PFY EH PKIFP      GI   +VVR     L G
Sbjct  70   GGLVTAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRS----LGG  125

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLH V++++LG+ RL +T+T+IVIP FDIK+ QP +F
Sbjct  126  PKYDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIF  168


 Score = 50.1 bits (118),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRG+IP TI+ +LE +LQ LDG DAR ADYFDVI+GTS  G
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGG  71



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   120 bits (302),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APDK+ RPL+A KDI  FY EH PKIFP   G F   +     LAGPKY+G
Sbjct  66   GGLVTAMLTAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LG +RL  TLT++VIP FDIK  QPT+F
Sbjct  126  KYLHGLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIF  163


 Score = 52.8 bits (125),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP  I+ +LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGG  67



>ref|XP_004238177.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=406

 Score =   122 bits (306),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+  ML+APD+N RPLYA KDI PFY EH PKIFP    G+F  +      L GPKYD
Sbjct  66   GGLVAAMLTAPDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V++++L +  +S T+T++VIP FDIK  QPT+F
Sbjct  126  GKYLHEVVKEKLKDICISNTITNVVIPTFDIKKLQPTIF  164


 Score = 50.8 bits (120),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRGIIP TI+ +LE +LQ LDG +AR ADYFDVIAGTS  G
Sbjct  10   PPTYGDFITILSIDGGGIRGIIPATILTFLESQLQELDGKNARIADYFDVIAGTSTGG  67



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score =   124 bits (310),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T MLSAP+  KRPL+A KDI PFY EH PKIFP    +F         L GPKYDG
Sbjct  69   GGLVTAMLSAPNDKKRPLFAAKDIKPFYLEHSPKIFPQQKDLFGSFGKLFRSLVGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+V++++LGE R+ +TLT+IVIP FDIKT QP +F
Sbjct  129  KYLHEVVREKLGEIRVHETLTNIVIPTFDIKTMQPIIF  166


 Score = 48.9 bits (115),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDG  AR ADYFDVI GTS  G
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYFDVITGTSTGG  70



>ref|XP_008801772.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   122 bits (306),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+KN RPL+A +DI  FY E+ PKIFP  AGI    R+  S++ GPKYDG
Sbjct  68   GGLVTAMLTAPNKNNRPLFAAEDIPKFYLENSPKIFPQKAGICSSTRNLFSVVTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  ++++ LGETRL Q LT IVIP FDIK   PT+F
Sbjct  128  KYLRSIIRELLGETRLHQALTDIVIPTFDIKLLHPTIF  165


 Score = 50.8 bits (120),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            A+ PP  G ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR ADYFDV+AGTS  
Sbjct  9    ANPPPCKGSLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGEDARIADYFDVVAGTSTG  68

Query  325  G  327
            G
Sbjct  69   G  69



>emb|CAN71271.1| hypothetical protein VITISV_001907 [Vitis vinifera]
Length=446

 Score =   122 bits (306),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+  ML+APD  KRPL+A KDI PFY EHGPKIFP   GIF  +      + GPKYDG
Sbjct  67   GGLVAAMLTAPDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +++++LG T L +TLT +VIP FDIK+ QPT+F
Sbjct  127  KYLKSLIKEKLGGTWLHETLTSVVIPTFDIKSLQPTIF  164


 Score = 50.8 bits (120),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++TILSIDGGGIRGIIP TI+A LE  LQ LDG DAR ADYFDVIAGTS  G
Sbjct  15   GNLVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTGG  68



>ref|XP_004160046.1| PREDICTED: patatin group A-3-like, partial [Cucumis sativus]
Length=406

 Score =   117 bits (294),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T M+++P++N RPLY+ KDI  F+ +H P IFP    + + +   SL  GPKYDGK
Sbjct  67   GGLLTAMITSPNENNRPLYSAKDIKQFFLDHSPLIFPQKMKWSLAKVLKSL-EGPKYDGK  125

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH++++++LG T+L+QTLT++VIP FDIK  QPTVF
Sbjct  126  YLHRLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVF  162


 Score = 55.5 bits (132),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPGTI+ +LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTFGNLITILSIDGGGIRGIIPGTILTFLESELQKLDGEDARIADYFDVIAGTSTGG  68



>gb|KDP38383.1| hypothetical protein JCGZ_04308 [Jatropha curcas]
Length=412

 Score =   116 bits (290),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP++  RP++A KDI  FY    PKIFP  S  +F         ++GPKYD
Sbjct  67   GGLVTAMLAAPNEKNRPVFAAKDIKDFYLNECPKIFPQRSCALFPQTTKVIKAISGPKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH++++++LG TRL+QTLT++VIP FDIK  QPT+F
Sbjct  127  GKYLHRLVKEKLGNTRLNQTLTNVVIPTFDIKRLQPTIF  165


 Score = 57.0 bits (136),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 3/64 (5%)
 Frame = +1

Query  145  NAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGT  315
            NAA++ P   G +IT+LSIDGGGIRGIIPGTI+++LE +LQ LDG DAR ADYFDVIAGT
Sbjct  5    NAAALQPPTYGNLITVLSIDGGGIRGIIPGTILSFLESQLQKLDGEDARIADYFDVIAGT  64

Query  316  SPEG  327
            S  G
Sbjct  65   STGG  68



>ref|XP_009133998.1| PREDICTED: patatin-like protein 2 [Brassica rapa]
Length=407

 Score =   119 bits (298),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A  +I  FY EH PKIFP     F   ++    L GPKYDG
Sbjct  68   GGLVTAMLTAPNKEGRPLFAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLHQ++  +LG+TRL QTLT++VIP FDIK  QPT+F
Sbjct  128  EYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIF  165


 Score = 53.5 bits (127),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A+LE ELQ LDG +AR ADYFDV+AGTS  G
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGG  69



>ref|XP_002880809.1| hypothetical protein ARALYDRAFT_344337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57068.1| hypothetical protein ARALYDRAFT_344337 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   120 bits (300),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A  +I  FY EH PKIFP     F   ++    L GPKYDG
Sbjct  66   GGLVTAMLTAPNKEGRPLFAANEIKDFYLEHCPKIFPQDQFPFSAAKNLLKSLTGPKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
             YLHQ+++++LG+TRL QTLT++VIP+FDIK  QPT+F
Sbjct  126  HYLHQLIKEKLGDTRLDQTLTNVVIPSFDIKHLQPTIF  163


 Score = 52.8 bits (125),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  145  NAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTS  318
            N+   PP  G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG  AR ADYFDVIAGTS
Sbjct  5    NSPLQPPTYGNLITILSIDGGGIRGIIPATILSFLESELQKLDGEGARLADYFDVIAGTS  64

Query  319  PEG  327
              G
Sbjct  65   TGG  67



>ref|XP_002282440.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19555.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   122 bits (305),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+  ML+APD  KRPL+A KDI PFY EHGPKIFP   GIF  +      + GPKYDG
Sbjct  67   GGLVAAMLTAPDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +++++LG T L +TLT +VIP FDIK+ QPT+F
Sbjct  127  KYLKSLIKEKLGGTWLHETLTSVVIPTFDIKSLQPTIF  164


 Score = 51.2 bits (121),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A LE  LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTGG  68



>emb|CDY21469.1| BnaC03g27280D [Brassica napus]
Length=407

 Score =   119 bits (298),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A  +I  FY EH PKIFP     F   ++    L GPKYDG
Sbjct  68   GGLVTAMLTAPNKEGRPLFAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLHQ++  +LG+TRL QTLT++VIP FDIK  QPT+F
Sbjct  128  EYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIF  165


 Score = 53.5 bits (127),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A+LE ELQ LDG +AR ADYFDV+AGTS  G
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGG  69



>ref|XP_007017310.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14535.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=404

 Score =   120 bits (302),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+TTML+AP++  RPL+A ++I  FY EHGP+IFP     F  V +    + GPKYDG
Sbjct  66   GGLLTTMLTAPNEKNRPLFAAQEIKAFYFEHGPRIFPQNRFPFSGVTNMIKRVLGPKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH VL+++LG TRL QTLT++VIP FDIK  QP +F
Sbjct  126  KYLHGVLKERLGYTRLHQTLTNVVIPTFDIKKLQPVIF  163


 Score = 52.0 bits (123),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPG I+++LE ELQ LDG  AR ADYFDV+AGTS  G
Sbjct  10   PPTHGELITVLSIDGGGIRGIIPGVILSFLESELQKLDGEQARIADYFDVVAGTSTGG  67



>ref|XP_002282597.1| PREDICTED: patatin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI19546.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   119 bits (298),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNK-RPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKY  491
            GGL+T ML+ P++N  RPL++ KDI  FY EHGPKIFP  S      V    + L+GPKY
Sbjct  67   GGLVTAMLTTPNENTGRPLFSAKDIKDFYLEHGPKIFPQHSHDPIPRVTKVVTALSGPKY  126

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH +++++LGETRL QTLT++VIP FDIK  QPT+F
Sbjct  127  DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIF  166


 Score = 53.5 bits (127),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPGT++ +LE ELQ LDG DAR +DYFDVIAGTS  G
Sbjct  11   PPTYGNLITILSIDGGGIRGIIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGG  68



>emb|CDP07842.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   123 bits (308),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 76/107 (71%), Gaps = 10/107 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA----------GIFEVVRDATS  470
            GGL+ TML+AP++  RPL+A KDI PFY EHGPKIFP            GI ++++   +
Sbjct  68   GGLIATMLTAPNEKDRPLFAAKDIKPFYMEHGPKIFPQRSGFRRMIKFCGIQKMIKFVLN  127

Query  471  LLAGPKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
               GP YDGKYLH++L+++LGETRL +TLT++VIP FD+K  QP +F
Sbjct  128  FFPGPVYDGKYLHKILKEKLGETRLRKTLTNVVIPTFDVKCLQPIIF  174


 Score = 49.7 bits (117),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  SIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            ++PP    ++TILSIDGGGIRGIIP TI+ +LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  10   NLPPVNENLVTILSIDGGGIRGIIPATILDFLESELQELDGQEARIADYFDVIAGTSTGG  69



>ref|XP_007224534.1| hypothetical protein PRUPE_ppa024261mg [Prunus persica]
 gb|EMJ25733.1| hypothetical protein PRUPE_ppa024261mg [Prunus persica]
Length=399

 Score =   118 bits (295),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T ML+AP+ N RP+YA KDI  FY ++GPKIFP  G + + +   ++L GP+YDGK
Sbjct  69   GGLLTIMLTAPNDNNRPMYAAKDIKSFYFDNGPKIFPQ-GSWPLAKMIKAVL-GPRYDGK  126

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH +L+ +LG TR  QTLT++VIP FDIK  QPT+F
Sbjct  127  YLHNLLKQKLGNTRCQQTLTNVVIPTFDIKRLQPTIF  163


 Score = 54.7 bits (130),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPG IVA+LE ELQ LDG +AR ADYFDV+AGTS  G
Sbjct  17   GKFITVLSIDGGGIRGIIPGIIVAFLESELQKLDGEEARVADYFDVVAGTSTGG  70



>ref|XP_009349524.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=412

 Score =   119 bits (297),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD+N RPLYA KDI PFY E+GPKIFP  + I   +     +L  PKYDG
Sbjct  64   GGLVTAMLTTPDENNRPLYAAKDITPFYLENGPKIFPQDSSIVANLAMNVKVLGRPKYDG  123

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH +L+++LG+  L  TLT++VIP FDIK  QP +F
Sbjct  124  KFLHSLLREKLGDKHLRHTLTNVVIPTFDIKRLQPVIF  161


 Score = 53.9 bits (128),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPG I+++LE ELQ LDG DAR ADYFDVI GTS  G
Sbjct  8    PPTNGSLITVLSIDGGGIRGIIPGIILSFLESELQKLDGKDARLADYFDVITGTSTGG  65



>ref|XP_010061769.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW68764.1| hypothetical protein EUGRSUZ_F02363 [Eucalyptus grandis]
Length=395

 Score =   120 bits (301),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDAT---SLLAGPKY  491
            GGL+  ML+APDK  RPLY GKDI  FY EH PKIFP      ++ +A      + GP+Y
Sbjct  59   GGLIAAMLAAPDKKNRPLYGGKDIKAFYLEHSPKIFPQLRCPSIIANAVRTIKAMVGPQY  118

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
             GKYLH++++++LG+TRL QTLT+++IP FD+K  QPT+F
Sbjct  119  SGKYLHRLIKEKLGDTRLHQTLTNVIIPTFDVKQLQPTIF  158


 Score = 52.4 bits (124),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIPG I+ +LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  3    PPASGNLVTILSIDGGGIRGIIPGIILGFLESELQKLDGEDARIADYFDVISGTSTGG  60



>ref|XP_008776250.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=443

 Score =   117 bits (293),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 9/102 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-----AGIFEVVRDATSLLAGP  485
            GGL+T ML+AP+   RP++A KDI  FY EH PKIFP      AG FE ++    L  GP
Sbjct  65   GGLVTAMLAAPNAKNRPIFAAKDIKEFYLEHCPKIFPQPWDSVAGAFEKIK----LFLGP  120

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYDGKYLH++++++LG  +L QTLT++VIP FDIK  QPT+F
Sbjct  121  KYDGKYLHRIIKEKLGTLKLHQTLTNVVIPTFDIKKLQPTIF  162


 Score = 55.5 bits (132),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +IT+LSIDGGGIRGIIP TI+A+LE +LQALDG DAR ADYFDVIAGTS  G
Sbjct  13   GNLITVLSIDGGGIRGIIPATILAFLESQLQALDGLDARLADYFDVIAGTSTGG  66



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   122 bits (307),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 8/102 (8%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-----SAGIFEVVRDATSLLAGP  485
            GGL+T ML+APDKN RPL+A KDI PF  EH PKIFP     SA +   V  +   L GP
Sbjct  70   GGLVTAMLAAPDKNNRPLFAAKDIKPFCLEHCPKIFPQHRGLSATLLAKVMRS---LGGP  126

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYDGKYLHQV++++LG+ RL +TLT+IV+P FDIKT QP +F
Sbjct  127  KYDGKYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIF  168


 Score = 49.7 bits (117),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR ADYFDVI+GTS  G
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGG  71



>gb|AEF30538.1| patatin-like phospholipase 1 [Capsicum annuum]
Length=413

 Score =   117 bits (292),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLY  K+I  FY +HGP+IFP +     +R  T+L  GPKYDGK
Sbjct  84   GGLVTTMLTAPNKDNRPLYQAKEISSFYMQHGPQIFPQSRRNSFLRRVTNLFGGPKYDGK  143

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + QTLT+ VIP FDIK  QP +F
Sbjct  144  YLRTIITSILGNLTMKQTLTNTVIPTFDIKRLQPIIF  180


 Score = 55.5 bits (132),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  32   GKMVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARVADYFDVVAGTSTGG  85



>ref|XP_008220193.1| PREDICTED: patatin-like protein 2 isoform X1 [Prunus mume]
Length=417

 Score =   121 bits (303),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVV---RDATSLLAGPKY  491
            GGL+T ML+ PD+N RPL+A KDI  FY EH PKIFP    + ++    D    ++GPKY
Sbjct  73   GGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGKAMDMVKAVSGPKY  132

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH+++++ LG+ RLS TLT+++IP FDIK  QP VF
Sbjct  133  DGKYLHKIMKEILGDIRLSDTLTNVIIPTFDIKRLQPMVF  172


 Score = 50.8 bits (120),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+ +LE ELQ LDG +AR  DYFDVIAGTS  G
Sbjct  21   GNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLVDYFDVIAGTSTGG  74



>ref|XP_008779158.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=404

 Score =   121 bits (303),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RP++  KDI  FY EH PKIFP   G  +   +A  L +GPKYDG
Sbjct  65   GGLVTAMLTAPNEKNRPIFEAKDIKAFYLEHSPKIFPQPRGPIDGAFNAFRLFSGPKYDG  124

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLHQ ++++LG  RL QTLT++VIPAFDIK  QPT+F
Sbjct  125  KYLHQTIKERLGSLRLHQTLTNVVIPAFDIKKLQPTIF  162


 Score = 50.8 bits (120),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +IT+LSIDGGGIRGIIP TI+A+LE +LQ  DG DAR ADYFDVIAGTS  G
Sbjct  13   GNLITVLSIDGGGIRGIIPATILAFLESQLQEHDGVDARLADYFDVIAGTSTGG  66



>ref|XP_008777430.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   121 bits (303),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ P+K+ RPL+A KDI  FY EH PKIFP   GI   +    + + GPKYDG
Sbjct  68   GGLVTAMLTTPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH  +++ LGE+RL Q LT+IVIPAFDIK  QPTVF
Sbjct  128  KYLHLKVRELLGESRLHQALTNIVIPAFDIKFLQPTVF  165


 Score = 50.8 bits (120),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            A+ PP  G ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR ADYFD+IAGTS  
Sbjct  9    ANPPPCKGRLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDIIAGTSTG  68

Query  325  G  327
            G
Sbjct  69   G  69



>ref|XP_008777590.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=403

 Score =   121 bits (303),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ P+K+ RPL+A KDI  FY EH PKIFP   GI   +    + + GPKYDG
Sbjct  68   GGLVTAMLTTPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH  +++ LGE+RL Q LT+IVIPAFDIK  QPTVF
Sbjct  128  KYLHLKVRELLGESRLHQALTNIVIPAFDIKFLQPTVF  165


 Score = 51.2 bits (121),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            A+ PP  G ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR ADYFD+IAGTS  
Sbjct  9    ANPPPCKGRLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDIIAGTSTG  68

Query  325  G  327
            G
Sbjct  69   G  69



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score =   122 bits (305),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+KN RPL+A KDI  FY E+  KIFP   GIF  + +  + + GPKY G
Sbjct  68   GGLVTAMLTAPNKNNRPLFAAKDITKFYLENSSKIFPQKNGIFSSIFNLFTAVTGPKYSG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH  +Q+ LGETRL Q LT IVIP FDIK  QPT+F
Sbjct  128  KYLHSKIQELLGETRLHQVLTDIVIPTFDIKLLQPTIF  165


 Score = 50.1 bits (118),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR  DYFDVIAGTS  G
Sbjct  12   PPCKGRLVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDARIVDYFDVIAGTSTGG  69



>ref|XP_006408594.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
 gb|ESQ50047.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
Length=407

 Score =   120 bits (301),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A  +I  FY EH PKIFP     F   ++    L GPKYDG
Sbjct  68   GGLVTAMLTAPNKEGRPLFAASEIKDFYLEHCPKIFPQDHFPFSAAKNLVKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLHQ++  +LGETRL QTLT++VIP FDIK  QPT+F
Sbjct  128  EYLHQLIHAKLGETRLHQTLTNVVIPTFDIKHLQPTIF  165


 Score = 51.6 bits (122),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGG+RGIIP TI+A+LE ELQ LDG +AR ADYFDV+AGTS  G
Sbjct  12   PPTYGNLVTILSIDGGGVRGIIPATILAFLESELQKLDGEEARLADYFDVMAGTSTGG  69



>ref|XP_008457873.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=392

 Score =   114 bits (286),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPKYDG  497
            GGL+T+ML+AP++N RPLYA KD+  FY EHGPKIFP    F   + +    + GPKYDG
Sbjct  60   GGLVTSMLTAPNENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSMVNMFGKVMGPKYDG  119

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  ++   LG+  L QTLT ++IPAFDIK  QP +F
Sbjct  120  KYLRSLINRLLGDITLKQTLTEVIIPAFDIKLLQPVIF  157


 Score = 57.4 bits (137),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  148  AASIPPGGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            AA    G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPDAR ADYFDVIAGTS  G
Sbjct  2    AAKYEKGEKITILSIDGGGIRGIIPGTILAFLESKLQELDGPDARIADYFDVIAGTSTGG  61



>ref|XP_010548410.1| PREDICTED: patatin-like protein 3 isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   120 bits (301),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T MLSAP K+ RPL++ KDIVPFY  H PKIFP + GI   V +   ++ GPKY+G
Sbjct  81   GGLITAMLSAPSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGWVENVIRVIRGPKYNG  140

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++  LG+ +LSQTLT IV+P FDIK  QP +F
Sbjct  141  KYLHKLIRGFLGDMKLSQTLTDIVVPCFDIKKLQPVIF  178


 Score = 51.6 bits (122),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +1

Query  139  EYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAG  312
            E   + +PP  G ++TILSIDGGGIRGIIPG I+++LE  LQ LDG DAR  DYFDVI+G
Sbjct  18   ERRLSCLPPSYGRLVTILSIDGGGIRGIIPGVILSHLESMLQELDGEDARLVDYFDVISG  77

Query  313  TSPEG  327
            TS  G
Sbjct  78   TSTGG  82



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score =   119 bits (298),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIF-EVVRDATSLLAGPKYD  494
            GGL+T ML+AP++N RPL+A +D+  FY ++ PKIFP   GIF  V +   S+  GPKY+
Sbjct  70   GGLVTAMLTAPNENNRPLFAAQDVTAFYLDNCPKIFPQMCGIFGSVAKTLRSIFVGPKYN  129

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +L+++LGETRL Q LT++VIP FD+K  QP +F
Sbjct  130  GKYLHGILREKLGETRLHQALTNVVIPTFDVKQLQPIIF  168


 Score = 52.8 bits (125),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR ADYFDVI GTS  G
Sbjct  14   PPTYGNLITVLSIDGGGIRGIIPGTILAFLESQLQELDGEDARIADYFDVIGGTSTGG  71



>ref|XP_006285520.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
 gb|EOA18418.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
Length=414

 Score =   117 bits (292),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD   RP +A KDIVPFY EH PKIFP  +G+F ++     LL+GPKY G
Sbjct  68   GGLVTAMLTVPDGTGRPYFAAKDIVPFYLEHCPKIFPQPSGVFALLPKLPKLLSGPKYSG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGE +L QTLT++VIP FDIK  QPTVF
Sbjct  128  KYLRNLLSKLLGEAKLHQTLTNVVIPTFDIKKLQPTVF  165


 Score = 55.1 bits (131),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RGII G ++AYLE++LQ LDG DAR ADYFDVIAGTS  G
Sbjct  12   PPSCGSLVTILSLDGGGVRGIIAGVVLAYLEKQLQELDGEDARLADYFDVIAGTSTGG  69



>ref|XP_008457871.1| PREDICTED: patatin-like protein 3 [Cucumis melo]
Length=394

 Score =   117 bits (294),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPKYDG  497
            GGL+T+ML+APDKN RPLYA KD+  FY EH PKIFP    F   V ++   + GP+YDG
Sbjct  61   GGLVTSMLTAPDKNNRPLYAAKDLTRFYVEHAPKIFPQRNHFLSSVMNSLGKVMGPRYDG  120

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  ++ + LG+  L +TLT ++IPAFDIK  QP +F
Sbjct  121  KYLRTLINNLLGDITLKETLTQVIIPAFDIKRLQPVIF  158


 Score = 53.9 bits (128),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPD R ADYFDVI GTS  G
Sbjct  9    GKRITILSIDGGGIRGIIPGTILAFLESKLQELDGPDVRIADYFDVITGTSTGG  62



>ref|XP_010548412.1| PREDICTED: patatin-like protein 3 isoform X3 [Tarenaya hassleriana]
Length=350

 Score =   120 bits (301),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T MLSAP K+ RPL++ KDIVPFY  H PKIFP + GI   V +   ++ GPKY+G
Sbjct  81   GGLITAMLSAPSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGWVENVIRVIRGPKYNG  140

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++  LG+ +LSQTLT IV+P FDIK  QP +F
Sbjct  141  KYLHKLIRGFLGDMKLSQTLTDIVVPCFDIKKLQPVIF  178


 Score = 51.2 bits (121),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +1

Query  139  EYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAG  312
            E   + +PP  G ++TILSIDGGGIRGIIPG I+++LE  LQ LDG DAR  DYFDVI+G
Sbjct  18   ERRLSCLPPSYGRLVTILSIDGGGIRGIIPGVILSHLESMLQELDGEDARLVDYFDVISG  77

Query  313  TSPEG  327
            TS  G
Sbjct  78   TSTGG  82



>ref|XP_010269072.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score =   119 bits (299),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APDK+ RPL+A KDI  FY EH PKIFP   G F   +     LAGPKY+G
Sbjct  66   GGLVTAMLTAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LG +RL  TLT++VIP FDIK  QPT+F
Sbjct  126  KYLHGLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIF  163


 Score = 52.0 bits (123),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP  I+ +LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGG  67



>ref|XP_007156813.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
 gb|ESW28807.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
Length=406

 Score =   119 bits (297),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPD--KNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKY  491
            GGL+  ML+AP+   NK PL+A  +IVPFY ++ P+IFP + G+F  +++    L GPKY
Sbjct  67   GGLVAAMLTAPNPNANKHPLFAANEIVPFYLQNSPQIFPQTRGLFGWLKNIVKALTGPKY  126

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH++++ +LG+T+  QTLT++VIP FDIKT QPT+F
Sbjct  127  DGKYLHELIRKKLGDTKFHQTLTNVVIPTFDIKTLQPTIF  166


 Score = 52.8 bits (125),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  175  ITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            IT+LSIDGGGIRGIIP  ++AYLE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  18   ITVLSIDGGGIRGIIPSVLLAYLESQLQELDGEDARLADYFDVIAGTSTGG  68



>ref|XP_009780403.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=427

 Score =   117 bits (294),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL++TML+AP+K+ RPLYA K+I  FY +HGPKIFP +     V+  T+L  GPKYDG 
Sbjct  81   GGLISTMLTAPNKDNRPLYAAKNITNFYMDHGPKIFPESSRSGFVKRITNLFGGPKYDGN  140

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++  LG   + QTLT  +IPAFDIK  QP VF
Sbjct  141  YLRTLVKSILGNLTMKQTLTQTIIPAFDIKRLQPIVF  177


 Score = 53.9 bits (128),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGT++A+LE +LQ +DGP+AR ADYFDV+AGTS  G
Sbjct  29   GKIVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVVAGTSTGG  82



>ref|XP_010269079.1| PREDICTED: patatin-like protein 2 isoform X3 [Nelumbo nucifera]
Length=324

 Score =   119 bits (298),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APDK+ RPL+A KDI  FY EH PKIFP   G F   +     LAGPKY+G
Sbjct  66   GGLVTAMLTAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LG +RL  TLT++VIP FDIK  QPT+F
Sbjct  126  KYLHGLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIF  163


 Score = 52.4 bits (124),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP  I+ +LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGG  67



>ref|XP_010548411.1| PREDICTED: patatin-like protein 3 isoform X2 [Tarenaya hassleriana]
Length=406

 Score =   120 bits (301),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T MLSAP K+ RPL++ KDIVPFY  H PKIFP + GI   V +   ++ GPKY+G
Sbjct  81   GGLITAMLSAPSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGWVENVIRVIRGPKYNG  140

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++  LG+ +LSQTLT IV+P FDIK  QP +F
Sbjct  141  KYLHKLIRGFLGDMKLSQTLTDIVVPCFDIKKLQPVIF  178


 Score = 51.2 bits (121),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +1

Query  139  EYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAG  312
            E   + +PP  G ++TILSIDGGGIRGIIPG I+++LE  LQ LDG DAR  DYFDVI+G
Sbjct  18   ERRLSCLPPSYGRLVTILSIDGGGIRGIIPGVILSHLESMLQELDGEDARLVDYFDVISG  77

Query  313  TSPEG  327
            TS  G
Sbjct  78   TSTGG  82



>ref|XP_006660710.1| PREDICTED: patatin-2-Kuras 2-like isoform X2 [Oryza brachyantha]
Length=387

 Score =   119 bits (299),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ P+KN+RPL+A KDI  FY  H PKIFP   G F  +      ++GP YDG
Sbjct  68   GGLVTAMLATPNKNRRPLFAAKDIKEFYMNHSPKIFPQLRGPFGRMMRIVRSMSGPSYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH+V++++LG TRL QTLT++VIP FDIK  QPT+F
Sbjct  128  KHLHEVVREKLGSTRLHQTLTNVVIPTFDIKRLQPTIF  165


 Score = 52.0 bits (123),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +1

Query  139  EYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAG  312
            ++     PP  G +IT+LSIDGGGIRGIIP  ++ +LE ELQ LDG +AR ADYFDV+AG
Sbjct  5    KHTICRHPPTYGNLITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARLADYFDVMAG  64

Query  313  TSPEG  327
            TS  G
Sbjct  65   TSTGG  69



>ref|XP_009370177.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=416

 Score =   121 bits (304),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+ PD++ RPL++ KDI  FY EH PKIFP  SA +F    D    + GPKYD
Sbjct  73   GGLVTAMLTTPDEHDRPLFSAKDINAFYLEHCPKIFPQNSAPLFGKAVDMVKAMTGPKYD  132

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH++++++LG+ RL+ TLT+++IP FDIK  QPT+F
Sbjct  133  GKYLHEIVKEKLGDKRLNDTLTNVIIPTFDIKQLQPTIF  171


 Score = 49.7 bits (117),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+++LE ELQ LDG   R ADYFDVIAGTS  G
Sbjct  21   GNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEGVRLADYFDVIAGTSTGG  74



>ref|XP_010680418.1| PREDICTED: patatin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=407

 Score =   120 bits (300),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+   RPLYA K+I PFY EH PKIF   +GIF  +     LL+GPKYDG
Sbjct  71   GGLITAMLTAPNDKTRPLYAAKEITPFYLEHCPKIFRQPSGIFGSIGTLMKLLSGPKYDG  130

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH ++++ LG+ RL Q LT++VIP FDIK  QP +F
Sbjct  131  KYLHNLVKELLGQRRLHQALTNVVIPTFDIKNLQPVLF  168


 Score = 51.6 bits (122),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP  ++ +LE +LQ LDG +AR ADYFDVIAGTS  G
Sbjct  15   PPNHGNLITILSIDGGGIRGIIPAVMLEFLESQLQKLDGEEARLADYFDVIAGTSTGG  72



>ref|XP_008393826.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=415

 Score =   118 bits (296),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+ PD+N RPL++ KDI  FY EH PKIFP  SA +     D    L GPKYD
Sbjct  72   GGLVTAMLTTPDENNRPLFSAKDINAFYLEHCPKIFPQDSAPLIGEAVDMVKNLTGPKYD  131

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
             KYLH +++++LG+ RL+ TLT+++IP FDIK  QPT+F
Sbjct  132  XKYLHNIVKEKLGDKRLNDTLTNVIIPTFDIKRLQPTIF  170


 Score = 53.1 bits (126),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI GTS  G
Sbjct  20   GNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDVITGTSTGG  73



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   117 bits (294),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPKYDG
Sbjct  69   GGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLGGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH +++++LG+T L QTLT+IVIP FDIK  QPT+F
Sbjct  129  KFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIF  166


 Score = 53.5 bits (127),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGG  70



>ref|XP_008444641.1| PREDICTED: patatin-like protein 2 isoform X1 [Cucumis melo]
Length=413

 Score =   116 bits (290),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T+M++AP++N RPL++ KDI  F+ +H P IFP    + + +   SL  GPKYDG+
Sbjct  67   GGLLTSMITAPNENNRPLFSAKDIKQFFLDHSPLIFPQKIRWPIAKVLKSL-EGPKYDGE  125

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH++++++LG T+L+QTLT++VIP FDIK  QPTVF
Sbjct  126  YLHKLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVF  162


 Score = 55.1 bits (131),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPGTI+ +LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTFGNLITILSIDGGGIRGIIPGTILTFLESELQKLDGEDARIADYFDVIAGTSTGG  68



>emb|CDX83197.1| BnaA03g23090D [Brassica napus]
Length=407

 Score =   117 bits (294),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL A  +I  FY EH PKIFP     F   ++    L GPKYDG
Sbjct  68   GGLVTAMLTAPNKEGRPLLAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLHQ++  +LG+TRL QTLT++VIP FDIK  QPT+F
Sbjct  128  EYLHQLIHAKLGDTRLHQTLTNVVIPTFDIKHLQPTIF  165


 Score = 53.5 bits (127),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A+LE ELQ LDG +AR ADYFDV+AGTS  G
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGG  69



>ref|XP_004232051.1| PREDICTED: patatin-like protein 3 [Solanum lycopersicum]
Length=412

 Score =   117 bits (292),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLY  KDI  FY +HGP+IFP +     VR  T+L  GPKYDG 
Sbjct  84   GGLVTTMLTAPNKDNRPLYQAKDISNFYMQHGPQIFPQSRRNSFVRRITNLFGGPKYDGI  143

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + QTLT+ VIP FDIK  QP +F
Sbjct  144  YLRTIINSILGNLTMKQTLTNTVIPTFDIKRLQPIIF  180


 Score = 54.3 bits (129),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  +T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  32   GKTVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVVAGTSTGG  85



>ref|XP_006338216.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=412

 Score =   119 bits (297),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLY  KDI  FY EHGP+IFP +     VR  T+L  GPKYDG 
Sbjct  84   GGLVTTMLTAPNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGI  143

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + QTLT+ VIP FDIK  QP +F
Sbjct  144  YLRTIINSILGNITMKQTLTNTVIPTFDIKRLQPIIF  180


 Score = 52.4 bits (124),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  +TILSIDGGGIRG+IPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  32   GKTVTILSIDGGGIRGVIPGTLLAFLESKLQELDGPNARLADYFDVVAGTSTGG  85



>gb|AAF98370.1|AF158254_1 patatin-like protein 2 [Nicotiana tabacum]
Length=207

 Score =   117 bits (293),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL++TML+AP+K+ RPLYA K+I  FY EHG KIFP +     V+  T+L  GPKYDGK
Sbjct  56   GGLISTMLTAPNKDNRPLYAAKNITNFYMEHGSKIFPESSRSGFVKRITNLFGGPKYDGK  115

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++  LG   + QTLT  VIPAFDIK  QP VF
Sbjct  116  YLKTLVKSILGNLTMKQTLTQTVIPAFDIKRLQPIVF  152


 Score = 53.9 bits (128),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGT++A+LE +LQ +DGP+AR ADYFDV+AGTS  G
Sbjct  4    GKIVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVVAGTSTGG  57



>ref|XP_004957049.1| PREDICTED: patatin-05-like [Setaria italica]
Length=384

 Score =   118 bits (295),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 9/102 (9%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-----AGIFEVVRDATSLLAGP  485
            GGL+T+ML+AP+K  RPL+A KDI  FY  H PKIFP       GI  + R     L+GP
Sbjct  65   GGLVTSMLAAPNKKNRPLFAAKDIQEFYMNHAPKIFPQKRGPFGGIMRIFRS----LSGP  120

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
             YDGKYLH+V++ +LG TRL +TLT +VIP FDIK  QPT+F
Sbjct  121  SYDGKYLHEVVRKKLGITRLHETLTDVVIPTFDIKRLQPTIF  162


 Score = 53.1 bits (126),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP  ++++LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  9    PPTYGNLVTILSIDGGGIRGIIPAVVLSFLESELQKLDGEEARLADYFDVIAGTSTGG  66



>ref|XP_008444642.1| PREDICTED: patatin-like protein 2 isoform X2 [Cucumis melo]
Length=412

 Score =   115 bits (289),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T+M++AP++N RPL++ KDI  F+ +H P IFP   I+ + +   SL  GPKYDG+
Sbjct  67   GGLLTSMITAPNENNRPLFSAKDIKQFFLDHSPLIFPQK-IWPIAKVLKSL-EGPKYDGE  124

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH++++++LG T+L+QTLT++VIP FDIK  QPTVF
Sbjct  125  YLHKLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVF  161


 Score = 55.1 bits (131),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPGTI+ +LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTFGNLITILSIDGGGIRGIIPGTILTFLESELQKLDGEDARIADYFDVIAGTSTGG  68



>ref|XP_010926367.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=402

 Score =   117 bits (292),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+TTML+AP+K+ RPL++ KDI+ FY E+ PKIFP   G+     +    ++GPKYDG
Sbjct  68   GGLVTTMLTAPNKDNRPLFSAKDIIQFYLENCPKIFPQRTGLLAGALNLFGAVSGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH  +++ LG+T+L QTLT+IVIPAFDIK  QP +F
Sbjct  128  KFLHSKVKELLGDTKLHQTLTNIVIPAFDIKLLQPVIF  165


 Score = 53.9 bits (128),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +1

Query  139  EYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAG  312
            E   A+ PP  G V+TILSIDGGG+RGIIPGTI+ +LE +LQ LDGPDAR ADYFD+IAG
Sbjct  5    ESPVANPPPCKGKVVTILSIDGGGVRGIIPGTILEFLEAKLQELDGPDARIADYFDIIAG  64

Query  313  TSPEG  327
            TS  G
Sbjct  65   TSTGG  69



>ref|XP_006388385.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
 gb|ERP47299.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
Length=390

 Score =   117 bits (294),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPKYDG
Sbjct  69   GGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLGGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH +++++LG+T L QTLT+IVIP FDIK  QPT+F
Sbjct  129  KFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIF  166


 Score = 53.5 bits (127),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGG  70



>ref|XP_010094388.1| Patatin group A-3 [Morus notabilis]
 gb|EXB55925.1| Patatin group A-3 [Morus notabilis]
Length=397

 Score =   119 bits (299),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K+ RPLYA   IVPFY EH PKIFP A G F  +  +     GPKY+G
Sbjct  63   GGLITAMLTAPNKDNRPLYAANGIVPFYLEHCPKIFPQASGFFGSILGSIENAVGPKYNG  122

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH ++   LG TRL +TLT+IVIP FDIK  +PT+F
Sbjct  123  KYLHSLINGLLGTTRLHETLTNIVIPTFDIKKLEPTLF  160


 Score = 51.6 bits (122),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPG ++ YLE +LQ LDG D R ADYFDVI GTS  G
Sbjct  7    PPKKGNLITILSIDGGGIRGIIPGVLLEYLESQLQELDGKDVRLADYFDVITGTSTGG  64



>ref|XP_006425860.1| hypothetical protein CICLE_v10027314mg [Citrus clementina]
 gb|ESR39100.1| hypothetical protein CICLE_v10027314mg [Citrus clementina]
Length=386

 Score =   119 bits (299),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIF-EVVRDATSLLAGPKYD  494
            GGL+T ML+AP +  RP+YA KDIVPFY  HGPKIFP   GI    V +    L G KYD
Sbjct  67   GGLITAMLTAPSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGILANSVVNLVRALMGTKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V+++ L +T+L QTLT++ IP FDIK  QPT+F
Sbjct  127  GKYLHKVIKENLKDTKLHQTLTNVAIPTFDIKKLQPTIF  165


 Score = 51.6 bits (122),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPE  324
            A+ PP    +ITILSIDGGGIRGIIPG I+A LE +LQ LDG DAR ADYFDVIAGTS  
Sbjct  8    ANQPPTYANLITILSIDGGGIRGIIPGVILACLESQLQELDGQDARLADYFDVIAGTSTG  67

Query  325  G  327
            G
Sbjct  68   G  68



>ref|XP_010061770.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW68765.1| hypothetical protein EUGRSUZ_F02366 [Eucalyptus grandis]
Length=404

 Score =   115 bits (287),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            G L+T ML+AP++  RPL+A K I  FY ++GPKIFP    +F  +  +  L+ GPKYDG
Sbjct  66   GALLTAMLTAPNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFGPKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+ +LG  RL QTLT++VIP FDIK  QP +F
Sbjct  126  KYLHSLLRAKLGNLRLHQTLTNVVIPTFDIKQLQPIIF  163


 Score = 56.2 bits (134),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = +1

Query  139  EYNAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            EY  +++ P   G +ITILSIDGGGIRG++PG I+A+LE ELQ LDG DAR ADYFDVIA
Sbjct  2    EYAKSTLKPPTYGNLITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVIA  61

Query  310  GTS  318
            GTS
Sbjct  62   GTS  64



>ref|XP_006601293.1| PREDICTED: patatin-11-like [Glycine max]
 gb|KHN12763.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   122 bits (306),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD+N RPLYA KDI  FY +H PKIFP +  +F  +      L GP+Y+G
Sbjct  70   GGLVTAMLTAPDENNRPLYAAKDIKDFYLDHTPKIFPQNNNLFSPILKLGRTLFGPQYNG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++++LG+T+L QTLT++VIPAFDIK  QP +F
Sbjct  130  KYLHKLIREKLGDTKLHQTLTNVVIPAFDIKHLQPAIF  167


 Score = 48.9 bits (115),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPG I+ +LE ELQ LDG   R ADYFDVIAGTS  G
Sbjct  18   GHLVTVLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFDVIAGTSTGG  71



>ref|XP_004973688.1| PREDICTED: patatin-2-Kuras 1-like isoform X2 [Setaria italica]
Length=432

 Score =   116 bits (290),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 12/103 (12%)
 Frame = +3

Query  321  GGLMTTMLSAPDKN--KRPLYAGKDIVPFYKEHGPKIFPSAG----IFEVVRDATSLLAG  482
            GGL+T ML+AP+K   KRPL+A KDI  FY EH PKIFP +G    +F+      S+++G
Sbjct  97   GGLVTAMLTAPNKENPKRPLFAAKDINKFYLEHCPKIFPCSGGPLGLFK------SIMSG  150

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLH ++++ LGET++S  LT+IVIP FDIK  QPT+F
Sbjct  151  PKYDGKYLHSIVRELLGETKVSDVLTNIVIPTFDIKLLQPTIF  193


 Score = 54.7 bits (130),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  SIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            S PP  G ++T+LSIDGGG+RGIIPGTI+A+LEE+LQ LDG DAR ADYFDVIAGTS  G
Sbjct  39   SPPPAFGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQELDGTDARIADYFDVIAGTSTGG  98



>ref|XP_010061771.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=380

 Score =   114 bits (286),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            G L+T ML+AP++  RPL+A K I  FY ++GPKIFP    +F  +  +  L+ GPKYDG
Sbjct  66   GALLTAMLTAPNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFGPKYDG  125

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+ +LG  RL QTLT++VIP FDIK  QP +F
Sbjct  126  KYLHSLLRAKLGNLRLHQTLTNVVIPTFDIKQLQPIIF  163


 Score = 56.2 bits (134),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = +1

Query  139  EYNAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            EY  +++ P   G +ITILSIDGGGIRG++PG I+A+LE ELQ LDG DAR ADYFDVIA
Sbjct  2    EYAKSTLKPPTYGNLITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVIA  61

Query  310  GTS  318
            GTS
Sbjct  62   GTS  64



>ref|XP_009589625.1| PREDICTED: patatin-like protein 3 [Nicotiana tomentosiformis]
Length=411

 Score =   116 bits (290),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+ + RPLY  KDI  FY EHGP+IF  +     VR  T+L  GPKYDGK
Sbjct  82   GGLITTMLTAPNMDNRPLYQAKDISNFYMEHGPQIFSQSRRNSFVRRVTNLFGGPKYDGK  141

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + QTLT+ +IP FDIK  QP +F
Sbjct  142  YLRSIINSILGNLTMKQTLTNTIIPTFDIKRLQPIIF  178


 Score = 54.7 bits (130),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  30   GKMVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTGG  83



>ref|XP_006425859.1| hypothetical protein CICLE_v10027498mg [Citrus clementina]
 gb|ESR39099.1| hypothetical protein CICLE_v10027498mg [Citrus clementina]
Length=385

 Score =   116 bits (290),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP +  RP+ A KDIVPFY  HGP+IFP     +   V +    L G KYD
Sbjct  67   GGLITAMLTAPKEQNRPMSAAKDIVPFYIRHGPQIFPQLRGMLANSVVNRVRALMGSKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V+++ L +T+L QTLT++VIP FDIK  QPT+F
Sbjct  127  GKYLHKVIKENLKDTKLHQTLTNVVIPTFDIKKLQPTIF  165


 Score = 54.7 bits (130),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP    +ITILSIDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTHANLITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGG  68



>ref|XP_006372536.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
 gb|ERP50333.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
Length=368

 Score =   117 bits (292),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPKYDG
Sbjct  69   GGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH +++++LG+T L QTLT+IVIP FDIK  QPT+F
Sbjct  129  KFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIF  166


 Score = 53.5 bits (127),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGG  70



>ref|XP_010664585.1| PREDICTED: patatin-like protein 2 isoform X3 [Vitis vinifera]
Length=413

 Score =   119 bits (298),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNK-RPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKY  491
            GGL+T ML+ P++N  RPL++ KDI  FY EHGPKIFP  S      V    + L+GPKY
Sbjct  67   GGLVTAMLTTPNENTGRPLFSAKDIKDFYLEHGPKIFPQHSHDPIPRVTKVVTALSGPKY  126

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH +++++LGETRL QTLT++VIP FDIK  QPT+F
Sbjct  127  DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIF  166


 Score = 51.6 bits (122),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRG+IPGT++ +LE ELQ LDG DAR +DYFDVIAGTS  G
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTSTGG  68



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   116 bits (290),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML++PD+N RPL+A KDI  FY ++ PKIFP     F         + GPKYDG
Sbjct  67   GGLVTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+++Q++LG  RL QTLT++VIP FDIK+ QPT+F
Sbjct  127  KYLHKLVQEKLGNRRLHQTLTNVVIPTFDIKSLQPTIF  164


 Score = 54.3 bits (129),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRG+IPGTI+A+LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGG  68



>ref|XP_006466737.1| PREDICTED: patatin-14-like [Citrus sinensis]
Length=402

 Score =   115 bits (289),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP +  RP+ A KDIVPFY  HGP+IFP     +   V +    L G KYD
Sbjct  67   GGLITAMLTAPKEQNRPMSAAKDIVPFYIRHGPQIFPQLRGMLANSVVNRVRALMGSKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH+V+++ L +T+L QTLT++VIP FDIK  QPT+F
Sbjct  127  GKYLHKVIKENLKDTKLHQTLTNVVIPTFDIKKLQPTIF  165


 Score = 54.7 bits (130),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP    +ITILSIDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTHANLITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGG  68



>ref|NP_001063402.2| Os09g0462400 [Oryza sativa Japonica Group]
 dbj|BAD38550.1| putative patatin homolog [Oryza sativa Japonica Group]
 gb|EAZ45016.1| hypothetical protein OsJ_29655 [Oryza sativa Japonica Group]
 dbj|BAF25316.2| Os09g0462400 [Oryza sativa Japonica Group]
Length=387

 Score =   117 bits (294),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K +RPL+A KDI  FY  H PKIFP   G F  +      ++GP YDG
Sbjct  68   GGLVTAMLAAPNKKRRPLFAAKDIKAFYMNHAPKIFPQLRGPFGRMMRIFRSMSGPSYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH+V++++LG TRL QTLT++VIP FDIK  QPT+F
Sbjct  128  KHLHEVVREKLGSTRLHQTLTNVVIPTFDIKWLQPTIF  165


 Score = 52.8 bits (125),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP  ++ +LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  12   PPTYGNLITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARIADYFDVIAGTSTGG  69



>sp|Q6ZJD3.1|PLP2_ORYSJ RecName: Full=Patatin-like protein 2; Short=OsPLP2 [Oryza sativa 
Japonica Group]
 sp|A2YW91.1|PLP2_ORYSI RecName: Full=Patatin-like protein 2 [Oryza sativa Indica Group]
 dbj|BAD08998.1| putative patatin [Oryza sativa Japonica Group]
 gb|EAZ07352.1| hypothetical protein OsI_29602 [Oryza sativa Indica Group]
 gb|EAZ43081.1| hypothetical protein OsJ_27671 [Oryza sativa Japonica Group]
Length=405

 Score =   115 bits (289),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++N RPL+A  ++  FY EH P IFP    +   +     +++GPKYDG
Sbjct  70   GGLLTAMLTAPNENNRPLFAADELAKFYIEHSPSIFPQKNWVLSKIAGTLRMVSGPKYDG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+++LG+TRL + LT++VIP FDI   QPT+F
Sbjct  130  KYLHSLLREKLGDTRLDKALTNVVIPTFDIANLQPTIF  167


 Score = 54.3 bits (129),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            ++T+LSIDGGG+RGIIP TI+A+LE+ELQ LDGPDAR ADYFDV+AGTS  G
Sbjct  20   MVTVLSIDGGGVRGIIPATILAFLEKELQKLDGPDARIADYFDVVAGTSTGG  71



>ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis]
Length=411

 Score =   117 bits (294),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG--IFEVVRDATSLLAGPKYD  494
            GGL+T ML+APD+N RPL+A KDI  FY  H PKIFP     +F  V+     ++GPKY+
Sbjct  69   GGLVTAMLTAPDENNRPLFAAKDIKDFYLNHCPKIFPQPKWPLFSQVKKVVKGISGPKYN  128

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +++++LG+ RL +TLT+IVIP FDIK  QPT+F
Sbjct  129  GKYLHGLVREKLGKRRLHETLTNIVIPTFDIKQLQPTIF  167


 Score = 52.4 bits (124),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G V+TILSIDGGGIRG+IP TI+++LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  13   PPTYGNVVTILSIDGGGIRGLIPTTILSFLESELQKLDGEEARIADYFDVIAGTSTGG  70



>gb|EEC84713.1| hypothetical protein OsI_31673 [Oryza sativa Indica Group]
Length=387

 Score =   117 bits (294),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K +RPL+A KDI  FY  H PKIFP   G F  +      ++GP YDG
Sbjct  68   GGLVTAMLAAPNKKRRPLFAAKDIKAFYMNHAPKIFPQLRGPFGRMMRIFRSMSGPSYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH+V++++LG TRL QTLT++VIP FDIK  QPT+F
Sbjct  128  KHLHEVVREKLGSTRLHQTLTNVVIPTFDIKRLQPTIF  165


 Score = 52.8 bits (125),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRGIIP  ++ +LE ELQ LDG +AR ADYFDVIAGTS  G
Sbjct  12   PPTYGNLITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARIADYFDVIAGTSTGG  69



>ref|XP_010064133.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=361

 Score =   120 bits (302),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+ P++N RP++A KDI  FY  H PKIFP     F+ V      +AGPKYDG
Sbjct  67   GGLVTAMLTTPNENNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKMIKAMAGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH V++D+LG+ RL QTLT++VIP FDIK+ QPT+F
Sbjct  127  KYLHSVVRDELGDKRLHQTLTNVVIPTFDIKSLQPTIF  164


 Score = 49.7 bits (117),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  11   PPTYGNSITILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGG  68



>ref|XP_006829694.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
 gb|ERM97110.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
Length=405

 Score =   123 bits (308),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+TTML+APD+NKRPLYA KDIVPFY EH PKIFP   G F       S + GPKYDG
Sbjct  67   GGLVTTMLTAPDENKRPLYAAKDIVPFYLEHCPKIFPHPRGPFSSALKVISAVIGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL ++ ++ L + RL  TLT++VIP FDI   QPT+F
Sbjct  127  KYLRRLARETLKDKRLHDTLTNVVIPTFDINILQPTIF  164


 Score = 47.4 bits (111),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  ITILSIDGGG+RGIIPG I+++LE +LQALDG + R  DYFDVIAGTS  G
Sbjct  15   GDFITILSIDGGGVRGIIPGIILSFLESQLQALDGEEVRLVDYFDVIAGTSTGG  68



>ref|XP_008337062.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=406

 Score =   118 bits (296),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG--IFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP++N RPL+A KDI+ FY  H PKIFP     IF         LAGPKY+
Sbjct  66   GGLVTAMLAAPNENNRPLFAAKDIIDFYFHHCPKIFPQNTCPIFRYTIKIIKALAGPKYN  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH ++++++G  +L +TLT++VIP FDIK  QPTVF
Sbjct  126  GKYLHSLIREKMGNKKLHETLTNVVIPTFDIKNLQPTVF  164


 Score = 51.6 bits (122),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++ +LSIDGGGIRG+IP TI+A+LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  10   PPVLGKMVRVLSIDGGGIRGLIPATILAFLESELQKLDGEDARIADYFDVIAGTSTGG  67



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score =   122 bits (306),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+ P++N RP++A KDI  FY  H PKIFP     F++V      +AGPKYDG
Sbjct  81   GGLVTAMLTTPNENNRPVFAAKDIKDFYLNHCPKIFPQDSCSFKLVTKMIKAMAGPKYDG  140

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH V++D+LG+ RL QTLT++VIP FDIK+ QPT+F
Sbjct  141  KYLHSVVRDKLGDKRLHQTLTNVVIPTFDIKSLQPTIF  178


 Score = 48.1 bits (113),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  169  GVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G I ILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  30   GTIFILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGG  82



>ref|XP_010437269.1| PREDICTED: patatin-like protein 1 isoform X1 [Camelina sativa]
Length=415

 Score =   115 bits (288),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD+  RP +A KDIVPFY EH PKIFP  AG+  ++     LL+GPKY G
Sbjct  69   GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGET+L QTLT++VIP +DIK  QPT+F
Sbjct  129  KYLRNLLSKLLGETKLHQTLTNVVIPTYDIKKLQPTIF  166


 Score = 54.7 bits (130),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RG+I G I+AYLE++LQ LDG DAR ADYFDVIAGTS  G
Sbjct  13   PPACGSLVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGG  70



>ref|XP_004167584.1| PREDICTED: LOW QUALITY PROTEIN: patatin group A-3-like [Cucumis 
sativus]
Length=395

 Score =   115 bits (289),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPKYDG  497
            GGL+T+ML+AP++N RPLYA KD+  FY EHGPKIFP    F   V +    + GPKYDG
Sbjct  63   GGLVTSMLTAPNENNRPLYAAKDLTRFYIEHGPKIFPQRNYFLSSVVNMFGKVMGPKYDG  122

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  ++   LG+  L +TLT ++IPAFDIK  QP +F
Sbjct  123  KYLRSLINRLLGDITLKETLTQVIIPAFDIKLLQPVIF  160


 Score = 54.7 bits (130),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  151  ASIPPGGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            A+   G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR ADYFDVIAGTS  G
Sbjct  6    ATFEKGKKITILSIDGGGIRGIIPGTILAFLESKLQELDGEDARIADYFDVIAGTSTGG  64



>ref|XP_004169210.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=258

 Score =   112 bits (281),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 69/100 (69%), Gaps = 5/100 (5%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLA---GPKY  491
            GGL+T+ML+AP++N RPLYA KD+  FY EHGPKIFP    F  +  A ++     GPKY
Sbjct  63   GGLVTSMLTAPNENNRPLYAAKDLTRFYIEHGPKIFPQRNHF--LSSAVNMFGKVMGPKY  120

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYL  ++   LG+  L +TLT ++IPAFDIK  QP +F
Sbjct  121  DGKYLRSLINRLLGDITLKETLTQVIIPAFDIKLLQPVIF  160


 Score = 57.4 bits (137),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  139  EYNAASIPPGGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTS  318
            E   A    G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPDAR ADYFDVIAGTS
Sbjct  2    EDKLAKFEKGKKITILSIDGGGIRGIIPGTILAFLESKLQELDGPDARVADYFDVIAGTS  61

Query  319  PEG  327
              G
Sbjct  62   TGG  64



>ref|XP_010432097.1| PREDICTED: patatin-like protein 1 [Camelina sativa]
Length=414

 Score =   115 bits (288),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD+  RP +A KDIVPFY EH PKIFP  AG+  ++     LL+GPKY G
Sbjct  68   GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGET+L QTLT++VIP +DIK  QPT+F
Sbjct  128  KYLRNLLSKLLGETKLHQTLTNVVIPTYDIKKLQPTIF  165


 Score = 55.1 bits (131),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RG+I G I+AYLE++LQ LDG DAR ADYFDVIAGTS  G
Sbjct  12   PPACGSLVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGG  69



>ref|XP_004152795.1| PREDICTED: patatin group A-3-like, partial [Cucumis sativus]
Length=406

 Score =   114 bits (286),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T M+++P++N RPLY+ KDI  F+ +H   IFP    + + +   SL  GPKYDGK
Sbjct  67   GGLLTAMITSPNENNRPLYSAKDIKQFFLDHSSLIFPQKMKWSLAKVLKSL-EGPKYDGK  125

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH++++++LG T+L+QTLT++VIP FDIK  QPTVF
Sbjct  126  YLHRLVREKLGNTKLNQTLTNVVIPTFDIKLLQPTVF  162


 Score = 55.5 bits (132),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIPGTI+ +LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTFGNLITILSIDGGGIRGIIPGTILTFLESELQKLDGEDARIADYFDVIAGTSTGG  68



>ref|XP_009410116.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   117 bits (292),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+T M++AP++N RP+++ K+++ FY E+ PKIFP A G    V      + GPKYDG
Sbjct  79   GGLLTAMITAPNENNRPMFSAKEVIDFYLENSPKIFPQAKGFLSSVTKLAGAIMGPKYDG  138

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            K+LH  ++D L ET+LSQTLT+++IP FDIK  QP +F
Sbjct  139  KFLHTKVKDLLTETKLSQTLTNVIIPTFDIKLLQPVIF  176


 Score = 53.1 bits (126),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +IT+LSIDGGG+RG+IPGTI+++LE +LQ LDGPDAR ADYFDVI GTS  G
Sbjct  27   GKLITVLSIDGGGVRGLIPGTIISFLESKLQELDGPDARIADYFDVITGTSTGG  80



>ref|XP_009419098.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   116 bits (290),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD N RPL+A KDI  FY EH  KIFP   G+   VR     + GPKY+G
Sbjct  69   GGLVTAMLTAPDDNNRPLFAAKDIKSFYLEHSSKIFPQIGGLLAGVRRMFQAVWGPKYNG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LG  RL QTLT+++IP FDIK   P +F
Sbjct  129  KYLHSLIKEKLGGVRLHQTLTNVIIPTFDIKQLHPIIF  166


 Score = 53.9 bits (128),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  17   GNLITILSIDGGGIRGIIPATILSFLESELQKLDGEDARIADYFDVISGTSTGG  70



>ref|XP_006829699.1| hypothetical protein AMTR_s00126p00054960, partial [Amborella 
trichopoda]
 gb|ERM97115.1| hypothetical protein AMTR_s00126p00054960, partial [Amborella 
trichopoda]
Length=222

 Score =   119 bits (299),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T M++AP  N RPLYA KDI  FY +H PKIFP  +G+    R   S + GPKY+G
Sbjct  67   GGLVTAMITAPGDNNRPLYAAKDITSFYLDHCPKIFPQQSGLLGSARKFVSAITGPKYNG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++ QLG+ RL QTLT +VIPAFDI   QPT+F
Sbjct  127  KYLHKLVRKQLGDKRLHQTLTKVVIPAFDILLLQPTIF  164


 Score = 50.4 bits (119),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG + R ADYFDVI+GTS  G
Sbjct  11   PPTYGDLITILSIDGGGIRGIIPSTILSFLESELQKLDGEEVRLADYFDVISGTSTGG  68



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score =   120 bits (301),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 8/98 (8%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+ N+RPL+A KDI PFY EH PKIFP    +F         LAGPKYDG
Sbjct  71   GGLVTAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKYLFRS-------LAGPKYDG  123

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LGE R+ +TLT+IVIP FDIKT QP +F
Sbjct  124  KYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIF  161


 Score = 49.7 bits (117),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+ YLE +LQ LDG  AR ADYFDVI GTS  G
Sbjct  15   PPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVITGTSTGG  72



>ref|XP_009138468.1| PREDICTED: patatin-like protein 3 [Brassica rapa]
Length=412

 Score =   115 bits (288),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (70%), Gaps = 8/105 (8%)
 Frame = +3

Query  321  GGLMTTMLSAPDKN-------KRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLL  476
            GGL+  ML+A DK+        RPL+A K+IVPFY +H PKIFP   G+    +    L+
Sbjct  69   GGLIVAMLTAEDKDVKNSRNRSRPLFAAKEIVPFYLKHSPKIFPQHRGVCSWAQTMRRLV  128

Query  477  AGPKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
             GPKY+GKYLH+V+Q  LG+TRL+QT+T++VIP FDIK  QP +F
Sbjct  129  RGPKYNGKYLHEVIQGYLGDTRLTQTMTNVVIPCFDIKKLQPVIF  173


 Score = 54.7 bits (130),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 2/66 (3%)
 Frame = +1

Query  136  GEYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
             E   + +PP  G ++TILSIDGGGIRGIIPGTI+AYLE +LQ LDG +AR  DYFDVI+
Sbjct  5    SERRVSCLPPSYGQLVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVIS  64

Query  310  GTSPEG  327
            GTS  G
Sbjct  65   GTSTGG  70



>gb|AAB08428.1| patatin homolog [Nicotiana tabacum]
Length=390

 Score =   126 bits (316),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 8/97 (8%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GG++TTM+SAP++  RP  A KDIV FY EHGPKIFP  G++  +        GPKYDGK
Sbjct  79   GGILTTMISAPNEKGRPFSAAKDIVSFYFEHGPKIFPQ-GVWPPIL-------GPKYDGK  130

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YLH+VL+D+LGETRL QTLT++VIP FD+K FQP +F
Sbjct  131  YLHKVLEDKLGETRLHQTLTNVVIPTFDMKKFQPIIF  167


 Score = 43.5 bits (101),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDG-PDARAADYFDVIAGTSPEG  327
            G + T+LSIDGGGI+GIIP T++++LE +LQ LD   DAR ADYFDVIAGTS  G
Sbjct  26   GEIATVLSIDGGGIKGIIPATVLSFLESQLQELDNNEDARLADYFDVIAGTSTGG  80



>ref|XP_006360228.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=420

 Score =   115 bits (289),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+ TML+AP+K+ RPLYA K+I  FY +HGPKIFP +     ++  T+L  GPKYDGK
Sbjct  81   GGLIATMLTAPNKDNRPLYAAKNITNFYMDHGPKIFPESSRSSFLKRLTNLFGGPKYDGK  140

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++  LG   ++QTLT +V+P+FDIK  Q  VF
Sbjct  141  YLKTLVRSILGNLTVTQTLTQLVVPSFDIKRLQAVVF  177


 Score = 53.5 bits (127),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  +TILSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  29   GKKLTILSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVVAGTSTGG  82



>ref|XP_010437270.1| PREDICTED: patatin-like protein 1 isoform X2 [Camelina sativa]
Length=384

 Score =   115 bits (287),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD+  RP +A KDIVPFY EH PKIFP  AG+  ++     LL+GPKY G
Sbjct  69   GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGET+L QTLT++VIP +DIK  QPT+F
Sbjct  129  KYLRNLLSKLLGETKLHQTLTNVVIPTYDIKKLQPTIF  166


 Score = 54.7 bits (130),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RG+I G I+AYLE++LQ LDG DAR ADYFDVIAGTS  G
Sbjct  13   PPACGSLVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGG  70



>ref|XP_006829697.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
 gb|ERM97113.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
Length=404

 Score =   120 bits (302),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T M++AP  N RPLYA KDI  FY +H PKIF  ++G+   VR   S + GPKYDG
Sbjct  67   GGLVTAMITAPGDNNRPLYAAKDITSFYLDHCPKIFSQTSGLLGSVRKFVSAVTGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++ QLG+ RL QTLT +VIP FDI+  QPT+F
Sbjct  127  KYLHKLVRKQLGDKRLHQTLTKVVIPTFDIRLLQPTIF  164


 Score = 48.5 bits (114),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG + R  DYFDV+AGTS  G
Sbjct  11   PPSFGDLITILSIDGGGIRGIIPATILSFLESELQNLDGEEVRLVDYFDVMAGTSTGG  68



>ref|XP_009780402.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=413

 Score =   116 bits (290),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+K+ RPLYA  DI  F+ EHGPKIFP++     V+   ++  GPKYDG+
Sbjct  82   GGLVTTMLTAPNKDNRPLYAANDITSFFFEHGPKIFPASS-RNNVKKIFNIFGGPKYDGR  140

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++ +LG   + QTLTH VIP FDIK  QP +F
Sbjct  141  YLRSLVRSKLGNLTMKQTLTHTVIPTFDIKHLQPIIF  177


 Score = 53.1 bits (126),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  175  ITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  33   VTVLSIDGGGIRGIIPGTVLAFLESKLQELDGPNARVADYFDVVAGTSTGG  83



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score =   115 bits (287),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML++PD+N RPL+A KDI  FY ++ PKIFP     F         + GPKYDG
Sbjct  67   GGLVTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++++LG  RL QTLT++VIP FDIK+ QPT+F
Sbjct  127  KYLHELVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIF  164


 Score = 54.3 bits (129),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRG+IPGTI+A+LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGG  68



>ref|XP_010429587.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score =   117 bits (294),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A  +I  FY EH PKIFP     F   ++    L GPKYDG
Sbjct  68   GGLVTAMLTAPNKEGRPLFAASEIKEFYLEHCPKIFPQDHFPFSAAKNLVKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLHQ++  +LG+T+L+QTLT++VIP FDIK  QPT+F
Sbjct  128  EYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKRLQPTIF  165


 Score = 51.6 bits (122),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRG+IP  I+ +LE ELQ LDG DAR ADYFDV+AGTS  G
Sbjct  12   PPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEDARLADYFDVVAGTSTGG  69



>ref|XP_009589751.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=412

 Score =   117 bits (292),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T+ML+AP+K+ RPLYA  DI  FY EHGPKIFP++   +V +   ++  GPKYDG+
Sbjct  82   GGLVTSMLTAPNKDNRPLYAANDITSFYFEHGPKIFPASSRNDV-KKIFNIFGGPKYDGR  140

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++ +LG   + QTLTH VIP FDIK  QP +F
Sbjct  141  YLRSLVRSKLGNLTMKQTLTHTVIPTFDIKRLQPIIF  177


 Score = 52.4 bits (124),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  175  ITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  33   VTVLSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTGG  83



>gb|KJB58445.1| hypothetical protein B456_009G210500 [Gossypium raimondii]
Length=406

 Score =   117 bits (292),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T M++AP++  RPL+A KDI  FY  H PKIFP     F         +AGPKYDG
Sbjct  61   GGLVTAMITAPNEKNRPLFAAKDIKDFYLGHCPKIFPQDTSPFAAAASLMKTMAGPKYDG  120

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++L+++LG+ RLSQTLT++VIP FDIK  QP +F
Sbjct  121  KYLHKLLREKLGDARLSQTLTNVVIPTFDIKQLQPKIF  158


 Score = 52.4 bits (124),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGIRGIIPGTI+A+LE +LQ LDG +AR ADYFD+IAGTS  G
Sbjct  9    GEIITILSIDGGGIRGIIPGTILAFLEAQLQKLDGEEARLADYFDIIAGTSTGG  62



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score =   120 bits (300),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD N RP++A KDI  FY  H PKIFP     F+ V      +AGPKYDG
Sbjct  67   GGLVTAMLTTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVAGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH V++++LG+ RL QTLT+IVIP FDIK+ QPT+F
Sbjct  127  KYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIF  164


 Score = 49.3 bits (116),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGGIRG+IPGT++ +LE ELQ LDG DAR  DYFDVI+GTS  G
Sbjct  11   PPTYGNLITVLSIDGGGIRGLIPGTVLNFLESELQRLDGKDARIVDYFDVISGTSTGG  68



>ref|XP_010317808.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
 ref|XP_010317809.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=416

 Score =   116 bits (290),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+++ RPLYA KDI  FY EHGP IFP       V +   L  GPKYDG+
Sbjct  83   GGLITTMLTAPNRDNRPLYAAKDISTFYMEHGPHIFPQTRRRNFVNNVAHLFGGPKYDGE  142

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + Q LTH VIPAFDIK  QP +F
Sbjct  143  YLRLLVDSILGNLTIKQMLTHTVIPAFDIKRLQPIIF  179


 Score = 52.8 bits (125),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            ++T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  33   LVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVVAGTSTGG  84



>ref|XP_004234672.1| PREDICTED: patatin-like protein 3 isoform X2 [Solanum lycopersicum]
Length=410

 Score =   116 bits (291),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+TTML+AP+++ RPLYA KDI  FY EHGP IFP       V +   L  GPKYDG+
Sbjct  83   GGLITTMLTAPNRDNRPLYAAKDISTFYMEHGPHIFPQTRRRNFVNNVAHLFGGPKYDGE  142

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++   LG   + Q LTH VIPAFDIK  QP +F
Sbjct  143  YLRLLVDSILGNLTIKQMLTHTVIPAFDIKRLQPIIF  179


 Score = 52.8 bits (125),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            ++T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  33   LVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVVAGTSTGG  84



>gb|KCW66178.1| hypothetical protein EUGRSUZ_F00014 [Eucalyptus grandis]
Length=409

 Score =   115 bits (287),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML++PD+N RPL+A KDI  FY ++ PKIFP     F         + GPKYDG
Sbjct  67   GGLVTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++++LG  RL QTLT++VIP FDIK+ QPT+F
Sbjct  127  KYLHKLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIF  164


 Score = 54.3 bits (129),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRG+IPGTI+A+LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGG  68



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   116 bits (291),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+APDK+KRPL+  K I+ FY ++ PKIFP   AG+   + +    + GPKYD
Sbjct  68   GGLVTAMLTAPDKDKRPLFTAKQIIQFYLDNCPKIFPRKKAGLLNPLLNLFGAVTGPKYD  127

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH  +Q  LG+T+LSQTLT++VIP FDIK  QP +F
Sbjct  128  GKYLHSKVQQLLGDTKLSQTLTNVVIPTFDIKFLQPIIF  166


 Score = 52.8 bits (125),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +1

Query  148  AASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSP  321
            +A+ PP  G ++T+LSIDGGG+RG+IP T++A+LE +LQ LDG DAR ADYFDVIAGTS 
Sbjct  8    SANPPPALGKLVTVLSIDGGGVRGLIPATLLAFLESKLQELDGADARIADYFDVIAGTST  67

Query  322  EG  327
             G
Sbjct  68   GG  69



>ref|XP_006473887.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   115 bits (288),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+A KDI  FY  H PKIFP S+G F         L GPKYDG
Sbjct  68   GGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++++LG  +L +TLT++VIP FDIK  QPT+F
Sbjct  128  KYLHRLVKEKLGNKKLHETLTNVVIPTFDIKKLQPTIF  165


 Score = 53.9 bits (128),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRGIIP TI+A+LE ELQ LDG +AR ADYFDVI+GTS  G
Sbjct  12   PPTFGNLITILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGG  69



>ref|XP_011017230.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011013052.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=408

 Score =   117 bits (292),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+ PD+N RP++A KDI  FY    PKIFP     +F  V+     L GPKYD
Sbjct  67   GGLVTAMLTCPDENSRPMFAAKDIKDFYLNQCPKIFPQPRCSLFTQVKKVIKALTGPKYD  126

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH ++++ LG  RL  TLT++VIP FDIKTFQPT+F
Sbjct  127  GKYLHGLVKELLGNRRLHHTLTNVVIPTFDIKTFQPTIF  165


 Score = 52.4 bits (124),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +1

Query  136  GEYNAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            G  N    PP  G +IT+LSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVIA
Sbjct  3    GTDNVLLQPPTFGNLITVLSIDGGGIRGLIPGTIINFLESELQKLDGEDARIADYFDVIA  62

Query  310  GTSPEG  327
            GTS  G
Sbjct  63   GTSTGG  68



>ref|XP_006419185.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
 gb|ESR32425.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
Length=381

 Score =   116 bits (290),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+A KDI  FY  H PKIFP S+G F         L GPKYDG
Sbjct  68   GGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++++LG+ +L +TLT++VIP FDIK  QPT+F
Sbjct  128  KYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIF  165


 Score = 53.1 bits (126),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A+LE ELQ LDG +AR ADYFDVI+GTS  G
Sbjct  12   PPTFGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGG  69



>ref|XP_009370176.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=406

 Score =   114 bits (284),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPKYD  494
            GGL+T ML+AP++N RPL+A KDI+ FY    PKIFP  +  IF         LAGPKY+
Sbjct  66   GGLVTAMLAAPNENNRPLFAAKDIIDFYLNQCPKIFPQKTWPIFPYTTKIIKALAGPKYN  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH++++++LG  +L  TLT++VIP FDIK  QP +F
Sbjct  126  GKYLHRLIRERLGNKKLHDTLTNVVIPTFDIKNLQPAIF  164


 Score = 55.1 bits (131),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +1

Query  139  EYNAASIPP---GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIA  309
            E N    PP   G ++TILSIDGGGIRG++P TI+A+LE ELQ LDG DAR ADYFDVIA
Sbjct  2    ERNGRVEPPTVFGKIVTILSIDGGGIRGLLPATILAFLESELQKLDGEDARIADYFDVIA  61

Query  310  GTSPEG  327
            GTS  G
Sbjct  62   GTSTGG  67



>gb|KCW66173.1| hypothetical protein EUGRSUZ_F00009 [Eucalyptus grandis]
Length=224

 Score =   120 bits (300),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+ P++N RP++A KDI  FY  H PKIFP     F+ V      +AGPKYDG
Sbjct  67   GGLVTAMLTTPNENNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKMIKAMAGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH V++D+LG+ RL QTLT++VIP FDIK+ QPT+F
Sbjct  127  KYLHSVVRDELGDKRLHQTLTNVVIPTFDIKSLQPTIF  164


 Score = 49.3 bits (116),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  ITILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI+GTS  G
Sbjct  11   PPTYGNSITILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGG  68



>ref|XP_004973690.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Setaria italica]
Length=412

 Score =   114 bits (285),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD N RPL+A KD+  FY +H PKIF     I   +     +L+GPKYDG
Sbjct  70   GGLLTAMLTAPDTNGRPLFAAKDLARFYIKHSPKIFRQKNHIRSKIASKLRMLSGPKYDG  129

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+  LG+ RL +TLT+IVIP FDI   QPT+F
Sbjct  130  KYLHALLRRYLGDMRLDRTLTNIVIPTFDIAYMQPTIF  167


 Score = 55.1 bits (131),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 2/59 (3%)
 Frame = +1

Query  157  IPPGGV--ITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +PP  +  +TILSIDGGGIRGIIP TI+A+LE +LQ LDGPDAR ADYFDV+AGTS  G
Sbjct  13   MPPDNLKLVTILSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGG  71



>ref|XP_006488152.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   115 bits (289),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+A KDI  FY  H PKIFP S+G F         L GPKYDG
Sbjct  68   GGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +++++LG+ +L +TLT++VIP FDIK  QPT+F
Sbjct  128  KYLHHLVKEKLGDKKLHETLTNVVIPTFDIKKLQPTIF  165


 Score = 53.1 bits (126),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILSIDGGGIRGIIP TI+A+LE ELQ LDG +AR ADYFDVI+GTS  G
Sbjct  12   PPTFGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGG  69



>ref|XP_010548404.1| PREDICTED: patatin-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=407

 Score =   123 bits (308),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+ GKDIVPFY EH PKIFP   G F ++     LL+GPKYDG
Sbjct  68   GGLVTAMLTAPNELGRPLFTGKDIVPFYMEHAPKIFPQPQGWFNLLPKLPKLLSGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++L+  LG+ RL QTLT++VIP FDIK  QP +F
Sbjct  128  KYLHELLRKLLGDKRLHQTLTNVVIPTFDIKKLQPAIF  165


 Score = 45.8 bits (107),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +1

Query  145  NAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTS  318
             A + PP  G ++TILS+DGGG+RGII G I+  LE  LQ LDG  AR ADYFDV+AGTS
Sbjct  7    RAKNKPPAYGKMVTILSMDGGGVRGIIVGVILTRLESYLQELDGEGARLADYFDVMAGTS  66

Query  319  PEG  327
              G
Sbjct  67   TGG  69



>gb|ACN25198.1| unknown [Zea mays]
 gb|AFW60363.1| patatin T5 [Zea mays]
Length=410

 Score =   109 bits (272),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPKYD  494
            G L+ +ML+APD+N RPL+A KD+  FY E+GPKIFP   AG+   +R+   L+ GPKYD
Sbjct  74   GALLASMLAAPDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYD  133

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            G +LH  ++    + R++ T+T++++PAFD+K+ QP +F
Sbjct  134  GVFLHDKIKSLTHDVRVADTVTNVIVPAFDVKSLQPIIF  172


 Score = 59.7 bits (143),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 52/66 (79%), Gaps = 5/66 (8%)
 Frame = +1

Query  136  GEYNAASIP-----PGGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFD  300
            G  N A++P      G +ITILSIDGGGIRG+IP TI+AYLE +LQ LDGPDAR ADYFD
Sbjct  7    GTANCATVPQPPPSTGKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFD  66

Query  301  VIAGTS  318
            VIAGTS
Sbjct  67   VIAGTS  72



>ref|XP_009403085.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   117 bits (292),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T M++APD+ +RPL++ KDI+ FY ++ PKIFP  +G    VR     + GPKYDG
Sbjct  79   GGLLTAMITAPDEKQRPLFSAKDIIDFYLQNCPKIFPQGSGFLSSVRKLAGAIMGPKYDG  138

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH  ++D L + +LSQTLT+++IPAFDIK  QP +F
Sbjct  139  KYLHSKVKDLLKDIKLSQTLTNVIIPAFDIKLLQPIIF  176


 Score = 52.0 bits (123),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +IT+LSIDGGG+RGIIPGTI+ +LE +LQ LDGPDAR ADYFDV+ GTS  G
Sbjct  23   PPCKGKLITVLSIDGGGVRGIIPGTIINFLETKLQELDGPDARVADYFDVVTGTSTGG  80



>ref|XP_006829698.1| hypothetical protein AMTR_s00126p00052810, partial [Amborella 
trichopoda]
 gb|ERM97114.1| hypothetical protein AMTR_s00126p00052810, partial [Amborella 
trichopoda]
Length=323

 Score =   119 bits (297),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T M++ P  N RPLYA KDI  FY +H PKIFP S+G        TS + GPKYDG
Sbjct  67   GGLVTAMITTPGNNDRPLYAAKDITTFYLDHCPKIFPQSSGFLGSAFKFTSAVTGPKYDG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++ +LG+ RL +TLT++VIP FDI+  QPTVF
Sbjct  127  KYLHKIVRKELGDKRLHETLTNVVIPTFDIRLLQPTVF  164


 Score = 50.1 bits (118),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G  +TILSIDGGGIRGIIP TI+++LE ELQ LDG + R ADYFDVIAGTS  G
Sbjct  11   PPTYGDYVTILSIDGGGIRGIIPATILSFLESELQKLDGEEVRLADYFDVIAGTSTGG  68



>ref|XP_006411935.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
 gb|ESQ53388.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
Length=408

 Score =   116 bits (290),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD+  RP +A KDIVPFY EH PKIFP   G+F ++     LL+GPKYDG
Sbjct  68   GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHTPKIFPQPEGLFALLPKLPKLLSGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGE RL QTLT++VI  FDIK  QPT+F
Sbjct  128  KYLKNLLSKLLGEKRLHQTLTNVVITTFDIKKLQPTIF  165


 Score = 52.8 bits (125),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RGII G I+AYLE++LQ LDG D R ADYFDV+AGTS  G
Sbjct  12   PPACGNLVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDVRLADYFDVVAGTSTGG  69



>ref|XP_010101003.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86651.1| Patatin group A-3 [Morus notabilis]
Length=411

 Score =   114 bits (284),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 10/103 (10%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI------FEVVRDATSLLAG  482
            GGL+T ML+AP++  RPL+A KDI  FY +H PKIFP   I       E+++     L G
Sbjct  66   GGLVTAMLAAPNEKNRPLFAAKDIKNFYLQHCPKIFPQDSIPLAGRATEIIKS----LTG  121

Query  483  PKYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            PKYDGKYLH++L+++LG+ +L QTLT+++IP FDIK  QP +F
Sbjct  122  PKYDGKYLHKLLKEKLGDLKLHQTLTNVIIPTFDIKRLQPIIF  164


 Score = 54.7 bits (130),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G VIT+LSIDGGGIRGIIP  ++ +LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  14   GNVITVLSIDGGGIRGIIPAIVLGFLESELQKLDGEDARIADYFDVIAGTSTGG  67



>ref|XP_011099197.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=433

 Score =   114 bits (285),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+T MLSAP K+ RP++A  +I  FY EH P IFP +     V   T+L+AGPKYDGK
Sbjct  83   GGLITAMLSAPGKDNRPVFAASNITNFYLEHCPNIFPESRRNNFVGTITNLVAGPKYDGK  142

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  ++Q+ LG  ++SQTLT++VIP FD+K  QP +F
Sbjct  143  YLKSLVQELLGSVKVSQTLTNVVIPTFDLKRLQPIIF  179


 Score = 54.3 bits (129),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDVIAGTS  G
Sbjct  31   GRMVTVLSIDGGGIRGIIPGTILAHLESKLQELDGPNARIADYFDVIAGTSTGG  84



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score =   120 bits (302),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+A K+IVPFY EH PKIF    G   V+     LL+GPKYDG
Sbjct  61   GGLVTAMLTAPNELGRPLFAAKEIVPFYMEHSPKIFSQPGGWLSVLPMPPRLLSGPKYDG  120

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++L+  LG+ RL QTLT+IVIP FDIK   PT+F
Sbjct  121  KYLHELLRKLLGDKRLHQTLTNIVIPTFDIKKLNPTIF  158


 Score = 47.8 bits (112),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RGII G I+A LE+ELQ LDG  AR ADYFDV+AGTS  G
Sbjct  5    PPARGKLVTILSLDGGGVRGIIAGVILARLEKELQELDGEGARLADYFDVMAGTSTGG  62



>ref|XP_007156814.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
 gb|ESW28808.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
Length=401

 Score =   118 bits (296),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPD--KNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKY  491
            GGL+ +ML+APD   N RPL++ KDIVPFY ++ P+IFP   GIF  + +    L GPKY
Sbjct  66   GGLVASMLAAPDPKANNRPLFSAKDIVPFYLKNSPQIFPQKRGIFTPLVNIGKALMGPKY  125

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            DGKYLH++++  LG+T L QTLT++VIP FD+K  QPT+F
Sbjct  126  DGKYLHELIRKNLGDTMLHQTLTNVVIPTFDVKKLQPTIF  165


 Score = 50.1 bits (118),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  160  PPGGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            P    IT+LSIDGGGIRGIIPG ++AYLE ELQ LDG +AR ADYFDV+ GTS  G
Sbjct  12   PKYDTITVLSIDGGGIRGIIPGVVLAYLESELQELDGDNARLADYFDVMTGTSTGG  67



>ref|NP_849511.1| patatin-related phospholipase A [Arabidopsis thaliana]
 sp|O23179.2|PLP1_ARATH RecName: Full=Patatin-like protein 1; Short=AtPLP1; AltName: 
Full=Patatin-related phospholipase A IIgamma; Short=pPLAIIg; 
AltName: Full=Phospholipase A IVA; Short=AtPLAIVA [Arabidopsis 
thaliana]
 emb|CAB16787.1| patatin-like protein [Arabidopsis thaliana]
 emb|CAB80373.1| patatin-like protein [Arabidopsis thaliana]
 gb|ABM06020.1| At4g37070 [Arabidopsis thaliana]
 gb|AEE86744.1| patatin-related phospholipase A [Arabidopsis thaliana]
Length=414

 Score =   117 bits (292),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD+  RP +A KDIVPFY EH PKIFP   G+  ++     LL+GPKY G
Sbjct  68   GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGETRL QTLT+IVIP FDIK  QPT+F
Sbjct  128  KYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIF  165


 Score = 51.6 bits (122),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RGII G I+A+LE++LQ LDG +AR ADYFDVIAGTS  G
Sbjct  12   PPSCGSLVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGG  69



>ref|XP_004233432.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=420

 Score =   114 bits (284),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPKYDGK  500
            GGL+ TML+AP+K+ RPLYA K+I  FY +HGPKIFP +     ++   ++  GPKYDGK
Sbjct  81   GGLIATMLTAPNKDNRPLYAAKNITNFYMDHGPKIFPESSRTSFLKRLANIFGGPKYDGK  140

Query  501  YLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            YL  +++  LG   ++QTLT +VIP+FDIK  Q  VF
Sbjct  141  YLRTLVRSILGNLTVTQTLTQLVIPSFDIKRLQAVVF  177


 Score = 54.3 bits (129),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDV+AGTS  G
Sbjct  29   GKKITILSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTGG  82



>ref|XP_010942709.1| PREDICTED: patatin-like protein 2, partial [Elaeis guineensis]
Length=299

 Score =   120 bits (301),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APDKN RPL+A KDI  FY E+ PKIFP   GIF  + +  + + GPKY+G
Sbjct  126  GGLVTAMLTAPDKNNRPLFAAKDINEFYLENCPKIFPQKTGIFSSMFNLFTAVRGPKYNG  185

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KY H+ +Q+ LGETR+ Q LT+IVIP FDIK  QPT+F
Sbjct  186  KYPHKKIQELLGETRVHQALTNIVIPTFDIKLLQPTIF  223


 Score = 47.8 bits (112),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = +1

Query  145  NAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTS  318
            N A+ PP  G ++TILSIDGGG+RGI+PG I+A+LE +L  LDG DAR ADYFD +AGTS
Sbjct  65   NLANPPPCKGRLVTILSIDGGGVRGIVPGIILAFLESKLLELDGEDARIADYFDAVAGTS  124

Query  319  PEG  327
              G
Sbjct  125  TGG  127



>ref|XP_006424637.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
 gb|ESR37877.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
Length=408

 Score =   116 bits (290),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+A KDI  FY  H PKIFP S+G F         L GPKYDG
Sbjct  68   GGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++++++LG+ +L +TLT++VIP FDIK  QPT+F
Sbjct  128  KYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIF  165


 Score = 52.0 bits (123),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G +ITILSIDGGGIRG+IP TI+A+LE ELQ LDG +AR ADYFDVI+GTS  G
Sbjct  12   PPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGG  69



>gb|KHN12764.1| Patatin group A-3 [Glycine soja]
Length=377

 Score =   119 bits (299),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSL---LAGPKY  491
            GGL+T +L+AP++N RPLYA KDI  FY +H PKIFP    + ++     L   L GP+Y
Sbjct  68   GGLVTAILTAPNENNRPLYAAKDIKNFYLDHTPKIFPQNKCWNLLSSMVKLTRTLFGPQY  127

Query  492  DGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +GKYLH +++++LGET+L QTLT++VIP FDIK  QPT+F
Sbjct  128  NGKYLHNLIREKLGETKLHQTLTNVVIPGFDIKRLQPTIF  167


 Score = 48.5 bits (114),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++T+LSIDGGGIRGIIPG I+ +LE ELQ LDG   R ADYFDVIAGTS  G
Sbjct  16   GHLVTVLSIDGGGIRGIIPGIILGFLESELQKLDGNHVRLADYFDVIAGTSTGG  69



>gb|KFK32501.1| hypothetical protein AALP_AA6G250900, partial [Arabis alpina]
Length=384

 Score =   120 bits (302),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP+K  RPL+A  DI  FY EH PKIFP     F   +     L GPKYDG
Sbjct  44   GGLVTAMLTAPNKEGRPLFAASDIKDFYLEHCPKIFPQDHFPFSAAKTLVKSLTGPKYDG  103

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            +YLHQ++ D LG+TRL QTLT++VIP FDIK  QPT+F
Sbjct  104  EYLHQLIHDLLGDTRLHQTLTNVVIPTFDIKHLQPTIF  141


 Score = 47.4 bits (111),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  232  VAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +A+LE ELQ LDG +AR ADYFDV+AGTS  G
Sbjct  14   LAFLESELQKLDGEEARLADYFDVMAGTSTGG  45



>emb|CAA05628.1| patatin-like protein [Arabidopsis thaliana]
Length=410

 Score =   116 bits (291),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD+  RP +A KDIVPFY EH PKIFP   G+  ++     LL+GPKY G
Sbjct  64   GGLVTAMLTVPDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSG  123

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGETRL QTLT+IVIP FDIK  QPT+F
Sbjct  124  KYLRNLLSKLLGETRLHQTLTNIVIPTFDIKKLQPTIF  161


 Score = 51.6 bits (122),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RGII G I+A+LE++LQ LDG +AR ADYFDVIAGTS  G
Sbjct  8    PPSCGSLVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGG  65



>ref|XP_009409669.1| PREDICTED: patatin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   117 bits (292),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV-VRDATSLLAGPKYDG  497
            GGL+T ML+APD+N RPL+A KD+  FY EH PKIFP  G F   VR     L GPKY G
Sbjct  67   GGLVTAMLAAPDENNRPLFAAKDMKSFYLEHSPKIFPQIGGFLAPVRRMFRSLWGPKYSG  126

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
             YLH +++++LG  RL +TLT+++IP FDIK   PT+F
Sbjct  127  TYLHSLIREKLGGVRLHETLTNVIIPTFDIKQLHPTIF  164


 Score = 51.6 bits (122),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGIRG+IP TI+++LE ELQ LDG D R ADYFDVIAGTS  G
Sbjct  15   GKLITILSIDGGGIRGVIPATILSFLESELQKLDGDDVRIADYFDVIAGTSTGG  68



>ref|XP_002510255.1| Patatin precursor, putative [Ricinus communis]
 gb|EEF52442.1| Patatin precursor, putative [Ricinus communis]
Length=407

 Score =   116 bits (290),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPKYD  494
            GGL+T ML++P++  RP++A KDI  FY    PKIFP     +F  V      +AGPKYD
Sbjct  66   GGLVTAMLASPNEKNRPIFAAKDINEFYLNECPKIFPQHRFQLFAQVSKVIKAIAGPKYD  125

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +++++LG TRL+QTLT+++IP FDIK  QPT+F
Sbjct  126  GKYLHNLVKEKLGNTRLNQTLTNVIIPTFDIKKLQPTIF  164


 Score = 52.0 bits (123),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G ++TILSIDGGGIRGIIPGTI+++LE E Q LDG DAR ADYFDVI GTS  G
Sbjct  14   GNLVTILSIDGGGIRGIIPGTILSFLESEFQKLDGEDARIADYFDVITGTSTGG  67



>ref|XP_003574632.1| PREDICTED: patatin-like protein 2 [Brachypodium distachyon]
Length=402

 Score =   114 bits (284),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPKYDG  497
            GGL+TTML+AP KN RPL+  KD+  FY +  PKIFP   G F  +  A  ++  PKYDG
Sbjct  70   GGLLTTMLTAP-KNGRPLFDAKDLAQFYIDESPKIFPQKNGFFSKIGTALKMVGAPKYDG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH +L+  LGETRL  TLT++VIP FDI   QPT+F
Sbjct  129  KYLHSLLRKYLGETRLDATLTNVVIPTFDISYLQPTIF  166


 Score = 54.3 bits (129),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  172  VITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            +IT+LSIDGGG+RGIIP T++A+LEEEL+ LDGPD+R ADYFDV+AGTS  G
Sbjct  20   LITVLSIDGGGVRGIIPATVLAFLEEELKKLDGPDSRIADYFDVVAGTSTGG  71



>ref|XP_010101001.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86649.1| Patatin group A-3 [Morus notabilis]
Length=408

 Score =   114 bits (286),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLA--GPKYD  494
            GGL+T ML+AP+++ RP +A KDI  FY +H PKIFP    F +   A +L A  GPKYD
Sbjct  66   GGLVTAMLTAPNEDTRPRFAAKDIKDFYLQHCPKIFPQES-FPLAGAAETLKAMMGPKYD  124

Query  495  GKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            GKYLH +L+++LG+ RL QTLT++VIP FDIK  QPT+F
Sbjct  125  GKYLHNLLREKLGDLRLHQTLTNVVIPTFDIKRLQPTIF  163


 Score = 53.5 bits (127),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G VIT+LSIDGGGIRGIIPG I++ LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  14   GNVITVLSIDGGGIRGIIPGIILSCLEAELQKLDGEDARLADYFDVIAGTSTGG  67



>ref|XP_008664527.1| PREDICTED: patatin-like protein 2 [Zea mays]
 tpg|DAA48468.1| TPA: hypothetical protein ZEAMMB73_225874 [Zea mays]
Length=436

 Score =   119 bits (297),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 12/102 (12%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-----GIFEVVRDATSLLAGP  485
            GGL+T ML+AP+K  RPL+A KDI  FY EH PKIFPS      G+F+        +AGP
Sbjct  103  GGLVTAMLTAPNKEGRPLFAAKDINDFYLEHCPKIFPSGSGGPMGLFKS-------MAGP  155

Query  486  KYDGKYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYDGKYLH ++++ LG+TR+S+ L +IVIPAFDIK  QPTVF
Sbjct  156  KYDGKYLHSIVRELLGDTRVSEALQNIVIPAFDIKLLQPTVF  197


 Score = 49.3 bits (116),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 3/61 (5%)
 Frame = +1

Query  154  SIPP--GGVITILSidgggirgiipgtiVAYLEEELQALD-GPDARAADYFDVIAGTSPE  324
            S PP  G ++T+LSIDGGG+RGIIPGTI+A+LEE+LQ  D  PDAR ADYFDVIAGTS  
Sbjct  44   SPPPAYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQEFDERPDARLADYFDVIAGTSTG  103

Query  325  G  327
            G
Sbjct  104  G  104



>ref|XP_008813724.1| PREDICTED: patatin-like protein 2 isoform X1 [Phoenix dactylifera]
Length=410

 Score =   114 bits (285),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+APD++ RPL+A KDI  FY    PKIFP   GI   +      L GP+Y+G
Sbjct  69   GGLVTAMLTAPDEDNRPLFAAKDIESFYLAESPKIFPQYGGILAPITRMVRALWGPRYNG  128

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH+++++ LG  RL QTLT++VIP FDIK   PT+F
Sbjct  129  KYLHKLIRENLGSMRLHQTLTNVVIPTFDIKRLHPTIF  166


 Score = 53.9 bits (128),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  166  GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            G +ITILSIDGGGIRGIIP  I+++LE ELQ LDG DAR ADYFDVIAGTS  G
Sbjct  17   GNLITILSIDGGGIRGIIPAVILSFLELELQKLDGEDARIADYFDVIAGTSTGG  70



>ref|XP_010548405.1| PREDICTED: patatin-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=383

 Score =   122 bits (307),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+AP++  RPL+ GKDIVPFY EH PKIFP   G F ++     LL+GPKYDG
Sbjct  68   GGLVTAMLTAPNELGRPLFTGKDIVPFYMEHAPKIFPQPQGWFNLLPKLPKLLSGPKYDG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYLH++L+  LG+ RL QTLT++VIP FDIK  QP +F
Sbjct  128  KYLHELLRKLLGDKRLHQTLTNVVIPTFDIKKLQPAIF  165


 Score = 45.4 bits (106),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +1

Query  145  NAASIPP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTS  318
             A + PP  G ++TILS+DGGG+RGII G I+  LE  LQ LDG  AR ADYFDV+AGTS
Sbjct  7    RAKNKPPAYGKMVTILSMDGGGVRGIIVGVILTRLESYLQELDGEGARLADYFDVMAGTS  66

Query  319  PEG  327
              G
Sbjct  67   TGG  69



>ref|XP_010446709.1| PREDICTED: patatin-like protein 1 isoform X2 [Camelina sativa]
Length=414

 Score =   117 bits (293),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  321  GGLMTTMLSAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPKYDG  497
            GGL+T ML+ PD   RP +A KDIVPFY EH PKIFP  AG+F ++     LL+GPKY G
Sbjct  68   GGLVTAMLTVPDGTGRPHFAAKDIVPFYLEHCPKIFPQPAGVFALLPKLPKLLSGPKYSG  127

Query  498  KYLHQVLQDQLGETRLSQTLTHIVIPAFDIKTFQPTVF  611
            KYL  +L   LGET+L QTLT++VIP +DIK  QPT+F
Sbjct  128  KYLRNLLSKLLGETKLHQTLTNVVIPTYDIKKLQPTIF  165


 Score = 50.8 bits (120),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +1

Query  160  PP--GGVITILSidgggirgiipgtiVAYLEEELQALDGPDARAADYFDVIAGTSPEG  327
            PP  G ++TILS+DGGG+RG+I G ++AYLE++LQ +DG  AR ADYFDVIAGTS  G
Sbjct  12   PPACGSLVTILSLDGGGVRGVIAGVVLAYLEKQLQEIDGEGARLADYFDVIAGTSTGG  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660