BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP016A10 569 bp,

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP33360.1|  hypothetical protein JCGZ_12909                         373   1e-123   Jatropha curcas
ref|XP_011091372.1|  PREDICTED: beta-amylase 1, chloroplastic           372   2e-123   Sesamum indicum [beniseed]
gb|AAY89374.1|  beta-amylase 1                                          368   7e-122   Nicotiana langsdorffii x Nicotiana sanderae
gb|AII99838.1|  beta-amylase                                            366   4e-121   Nicotiana tabacum [American tobacco]
ref|XP_009596880.1|  PREDICTED: beta-amylase 1, chloroplastic-like      366   4e-121   Nicotiana tomentosiformis
ref|XP_009785196.1|  PREDICTED: beta-amylase 1, chloroplastic-like      365   1e-120   Nicotiana sylvestris
ref|XP_006340896.1|  PREDICTED: beta-amylase 1, chloroplastic-like      363   8e-120   Solanum tuberosum [potatoes]
ref|XP_002314522.2|  hypothetical protein POPTR_0010s07340g             361   4e-119   Populus trichocarpa [western balsam poplar]
ref|XP_002518196.1|  Beta-amylase, putative                             360   6e-119   Ricinus communis
emb|CDP20299.1|  unnamed protein product                                360   1e-118   Coffea canephora [robusta coffee]
ref|NP_001234556.1|  beta-amylase                                       360   1e-118   
gb|KJB68707.1|  hypothetical protein B456_011G1810001                   348   9e-117   Gossypium raimondii
ref|XP_003534086.1|  PREDICTED: beta-amylase 1, chloroplastic           355   1e-116   Glycine max [soybeans]
gb|KJB68705.1|  hypothetical protein B456_011G1810001                   348   1e-116   Gossypium raimondii
ref|XP_003548316.1|  PREDICTED: beta-amylase 1, chloroplastic-like      354   2e-116   Glycine max [soybeans]
gb|KHG16283.1|  Beta-amylase 1, chloroplastic -like protein             355   2e-116   Gossypium arboreum [tree cotton]
ref|XP_007152599.1|  hypothetical protein PHAVU_004G143600g             353   2e-116   Phaseolus vulgaris [French bean]
ref|XP_003632025.2|  PREDICTED: beta-amylase 1, chloroplastic           350   4e-116   Vitis vinifera
gb|AGS94413.1|  beta-amylase                                            347   5e-116   Actinidia chinensis
ref|XP_009777267.1|  PREDICTED: beta-amylase 1, chloroplastic-like      353   6e-116   Nicotiana sylvestris
gb|KJB72486.1|  hypothetical protein B456_011G1809001                   345   1e-115   Gossypium raimondii
ref|XP_010666969.1|  PREDICTED: beta-amylase 1, chloroplastic           352   2e-115   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_011029718.1|  PREDICTED: beta-amylase 1, chloroplastic-like      352   3e-115   Populus euphratica
ref|XP_010023784.1|  PREDICTED: beta-amylase 1, chloroplastic           350   7e-115   Eucalyptus grandis [rose gum]
ref|XP_009608726.1|  PREDICTED: beta-amylase 1, chloroplastic-like      348   2e-114   Nicotiana tomentosiformis
ref|XP_011041480.1|  PREDICTED: beta-amylase 1, chloroplastic-like      349   2e-114   Populus euphratica
gb|AEN82034.1|  AT3G23920-like protein                                  334   7e-114   Neslia paniculata [ball mustard]
ref|XP_007035340.1|  Beta-amylase 1 isoform 1                           349   1e-113   Theobroma cacao [chocolate]
ref|XP_009343398.1|  PREDICTED: beta-amylase 1, chloroplastic-like      337   2e-113   Pyrus x bretschneideri [bai li]
ref|XP_004296549.1|  PREDICTED: beta-amylase 1, chloroplastic           347   2e-113   Fragaria vesca subsp. vesca
ref|XP_002311706.1|  beta-amylase family protein                        345   7e-113   Populus trichocarpa [western balsam poplar]
gb|KDO55739.1|  hypothetical protein CISIN_1g008030mg                   345   8e-113   Citrus sinensis [Valencia orange]
ref|XP_006420416.1|  hypothetical protein CICLE_v10004620mg             345   8e-113   Citrus clementina
emb|CAN71375.1|  hypothetical protein VITISV_002992                     345   9e-113   Vitis vinifera
ref|XP_002285569.1|  PREDICTED: beta-amylase 1, chloroplastic           345   1e-112   Vitis vinifera
gb|KEH26843.1|  beta-amylase                                            338   2e-112   Medicago truncatula
ref|XP_006493994.1|  PREDICTED: beta-amylase 1, chloroplastic-like      343   3e-112   Citrus sinensis [Valencia orange]
ref|XP_006418770.1|  hypothetical protein EUTSA_v10002460mg             343   4e-112   Eutrema salsugineum
gb|AFQ33614.1|  beta-amylase 2                                          343   5e-112   Citrus trifoliata [hardy orange]
ref|XP_010513371.1|  PREDICTED: beta-amylase 1, chloroplastic-like      343   6e-112   Camelina sativa [gold-of-pleasure]
gb|KFK39690.1|  hypothetical protein AALP_AA3G276400                    342   7e-112   Arabis alpina [alpine rockcress]
ref|XP_010488521.1|  PREDICTED: beta-amylase 1, chloroplastic-like      342   8e-112   Camelina sativa [gold-of-pleasure]
ref|XP_011073736.1|  PREDICTED: beta-amylase 1, chloroplastic-like      342   1e-111   Sesamum indicum [beniseed]
ref|XP_006296695.1|  hypothetical protein CARUB_v10013332mg             342   2e-111   Capsella rubella
ref|XP_002885629.1|  beta-amylase 7                                     341   2e-111   Arabidopsis lyrata subsp. lyrata
gb|EYU43789.1|  hypothetical protein MIMGU_mgv1a010885mg                332   3e-111   Erythranthe guttata [common monkey flower]
ref|XP_009102529.1|  PREDICTED: beta-amylase 1, chloroplastic           340   4e-111   Brassica rapa
emb|CDX77441.1|  BnaA07g05790D                                          340   4e-111   Brassica napus [oilseed rape]
gb|KJB34580.1|  hypothetical protein B456_006G073600                    340   7e-111   Gossypium raimondii
gb|AEN82029.1|  AT3G23920-like protein                                  326   1e-110   Capsella rubella
ref|XP_010466824.1|  PREDICTED: beta-amylase 1, chloroplastic iso...    339   1e-110   Camelina sativa [gold-of-pleasure]
ref|NP_189034.1|  beta-amylase 1                                        339   1e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466823.1|  PREDICTED: beta-amylase 1, chloroplastic iso...    339   1e-110   Camelina sativa [gold-of-pleasure]
ref|XP_008438436.1|  PREDICTED: beta-amylase 1, chloroplastic-like      338   4e-110   Cucumis melo [Oriental melon]
gb|AAL37169.1|AF319168_1  putative chloroplast-targeted beta-amylase    337   7e-110   Brassica napus [oilseed rape]
ref|XP_007223114.1|  hypothetical protein PRUPE_ppa005431mg             333   8e-110   Prunus persica
ref|XP_004515248.1|  PREDICTED: beta-amylase 1, chloroplastic-like      337   1e-109   Cicer arietinum [garbanzo]
emb|CDY45566.1|  BnaC09g21440D                                          337   1e-109   Brassica napus [oilseed rape]
ref|XP_004166730.1|  PREDICTED: beta-amylase 1, chloroplastic-like      337   1e-109   
ref|XP_004134029.1|  PREDICTED: beta-amylase 1, chloroplastic-like      337   1e-109   Cucumis sativus [cucumbers]
ref|XP_008391283.1|  PREDICTED: beta-amylase 1, chloroplastic-like      335   4e-109   Malus domestica [apple tree]
ref|XP_009350111.1|  PREDICTED: beta-amylase 1, chloroplastic           335   4e-109   Pyrus x bretschneideri [bai li]
ref|XP_010263970.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    335   5e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010263969.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    335   6e-109   Nelumbo nucifera [Indian lotus]
emb|CDX94831.1|  BnaC03g43570D                                          334   7e-109   Brassica napus [oilseed rape]
ref|XP_008342553.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    333   4e-108   Malus domestica [apple tree]
gb|KHN24537.1|  Beta-amylase 1, chloroplastic                           328   4e-108   Glycine soja [wild soybean]
ref|XP_008224054.1|  PREDICTED: beta-amylase 1, chloroplastic           330   3e-107   Prunus mume [ume]
ref|XP_010264799.1|  PREDICTED: beta-amylase 1, chloroplastic-like      331   4e-107   Nelumbo nucifera [Indian lotus]
ref|XP_009135884.1|  PREDICTED: beta-amylase 1, chloroplastic-like      325   4e-105   Brassica rapa
gb|EPS66628.1|  beta-amylase 1, chloroplastic                           324   2e-104   Genlisea aurea
emb|CDX93004.1|  BnaA03g37260D                                          322   4e-104   Brassica napus [oilseed rape]
gb|EPS61951.1|  beta-amylase                                            316   1e-101   Genlisea aurea
ref|XP_004164889.1|  PREDICTED: beta-amylase 1, chloroplastic-like      308   2e-101   
ref|XP_008460711.1|  PREDICTED: beta-amylase 1, chloroplastic           313   8e-101   Cucumis melo [Oriental melon]
ref|XP_004147196.1|  PREDICTED: beta-amylase 1, chloroplastic-like      311   7e-100   Cucumis sativus [cucumbers]
ref|XP_010111574.1|  Beta-amylase 1                                     308   2e-98    Morus notabilis
ref|XP_010550849.1|  PREDICTED: beta-amylase 1, chloroplastic           306   1e-97    Tarenaya hassleriana [spider flower]
ref|XP_006851336.1|  hypothetical protein AMTR_s00050p00205080          303   2e-96    Amborella trichopoda
ref|XP_009400488.1|  PREDICTED: beta-amylase 1, chloroplastic           295   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAX51378.1|  beta-amylase                                           285   9e-93    Hordeum vulgare subsp. vulgare [barley]
ref|NP_001048926.1|  Os03g0141200                                       288   4e-91    
gb|EAY88485.1|  hypothetical protein OsI_09956                          288   4e-91    Oryza sativa Indica Group [Indian rice]
dbj|BAJ96121.1|  predicted protein                                      286   2e-90    Hordeum vulgare subsp. vulgare [barley]
gb|ACF82250.1|  unknown                                                 274   4e-88    Zea mays [maize]
tpg|DAA43307.1|  TPA: beta-amylase                                      273   3e-87    Zea mays [maize]
ref|XP_003558837.1|  PREDICTED: beta-amylase 1, chloroplastic-like      278   4e-87    Brachypodium distachyon [annual false brome]
gb|ADE77496.1|  unknown                                                 266   5e-87    Picea sitchensis
ref|XP_004985750.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    276   4e-86    Setaria italica
gb|ACG29617.1|  beta-amylase                                            275   6e-86    Zea mays [maize]
tpg|DAA43306.1|  TPA: beta-amylase                                      275   7e-86    Zea mays [maize]
ref|XP_004985749.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    276   1e-85    
ref|NP_001148159.1|  beta-amylase                                       273   3e-85    Zea mays [maize]
gb|AGT17079.1|  beta-amylase                                            270   8e-84    Saccharum hybrid cultivar R570
ref|XP_002468533.1|  hypothetical protein SORBIDRAFT_01g047500          268   4e-83    Sorghum bicolor [broomcorn]
gb|EAZ16360.1|  hypothetical protein OsJ_31822                          265   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001782016.1|  predicted protein                                  261   2e-81    Physcomitrella patens
ref|XP_010918964.1|  PREDICTED: beta-amylase 1, chloroplastic           262   6e-81    Elaeis guineensis
ref|XP_008775132.1|  PREDICTED: beta-amylase 1, chloroplastic           262   1e-80    Phoenix dactylifera
gb|ABK24605.1|  unknown                                                 259   1e-80    Picea sitchensis
ref|XP_004982940.1|  PREDICTED: beta-amylase 1, chloroplastic-like      260   2e-80    
ref|XP_004168709.1|  PREDICTED: beta-amylase 3, chloroplastic-like      254   3e-80    
ref|NP_001064798.1|  Os10g0465700                                       259   3e-80    
ref|XP_001756520.1|  predicted protein                                  258   6e-80    Physcomitrella patens
ref|NP_001147532.1|  beta-amylase                                       258   2e-79    Zea mays [maize]
ref|XP_003571854.1|  PREDICTED: beta-amylase 1, chloroplastic-like      257   2e-79    Brachypodium distachyon [annual false brome]
ref|XP_002968794.1|  hypothetical protein SELMODRAFT_145994             255   3e-79    Selaginella moellendorffii
ref|XP_002467119.1|  hypothetical protein SORBIDRAFT_01g019850          257   5e-79    Sorghum bicolor [broomcorn]
ref|XP_002974185.1|  hypothetical protein SELMODRAFT_149606             253   1e-78    Selaginella moellendorffii
gb|AFI71858.1|  amylase                                                 256   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001778149.1|  predicted protein                                  255   1e-78    Physcomitrella patens
gb|EAY78842.1|  hypothetical protein OsI_33946                          254   3e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_004147264.1|  PREDICTED: beta-amylase 3, chloroplastic-like      254   4e-78    Cucumis sativus [cucumbers]
gb|EPS63004.1|  hypothetical protein M569_11781                         252   4e-78    Genlisea aurea
ref|XP_008448759.1|  PREDICTED: beta-amylase 3, chloroplastic           253   8e-78    Cucumis melo [Oriental melon]
ref|XP_007035341.1|  Beta-amylase 1 isoform 2                           253   1e-77    Theobroma cacao [chocolate]
gb|KJB39785.1|  hypothetical protein B456_007G030600                    252   2e-77    Gossypium raimondii
gb|AHJ09602.1|  chloroplast beta-amylase 3                              251   6e-77    Camellia sinensis [black tea]
ref|NP_001183801.1|  uncharacterized protein LOC100502394               242   2e-76    Zea mays [maize]
gb|KJB51735.1|  hypothetical protein B456_008G230100                    245   7e-76    Gossypium raimondii
gb|KJB51736.1|  hypothetical protein B456_008G230100                    246   2e-75    Gossypium raimondii
ref|XP_003611408.1|  Beta-amylase                                       246   4e-75    Medicago truncatula
ref|XP_009792527.1|  PREDICTED: beta-amylase 3, chloroplastic-like      247   4e-75    Nicotiana sylvestris
gb|KJB51734.1|  hypothetical protein B456_008G230100                    246   4e-75    Gossypium raimondii
ref|XP_009597851.1|  PREDICTED: beta-amylase 3, chloroplastic-like      246   7e-75    Nicotiana tomentosiformis
gb|KHN42645.1|  Beta-amylase 3, chloroplastic                           246   9e-75    Glycine soja [wild soybean]
ref|XP_006573703.1|  PREDICTED: beta-amylase 3, chloroplastic-like      246   1e-74    Glycine max [soybeans]
ref|XP_011070282.1|  PREDICTED: beta-amylase 3, chloroplastic           245   1e-74    Sesamum indicum [beniseed]
ref|NP_001236350.1|  beta-amylase                                       245   2e-74    Glycine max [soybeans]
gb|KHG28698.1|  Beta-amylase 3, chloroplastic -like protein             245   2e-74    Gossypium arboreum [tree cotton]
ref|XP_001768786.1|  predicted protein                                  244   2e-74    Physcomitrella patens
ref|XP_010919816.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    243   5e-74    Elaeis guineensis
ref|XP_007039629.1|  Chloroplast beta-amylase isoform 1                 244   7e-74    Theobroma cacao [chocolate]
ref|XP_004245844.1|  PREDICTED: beta-amylase 3, chloroplastic           243   7e-74    Solanum lycopersicum
ref|XP_003611409.1|  Beta-amylase                                       243   7e-74    Medicago truncatula
ref|XP_006385389.1|  beta-amylase family protein                        243   8e-74    Populus trichocarpa [western balsam poplar]
gb|AFO84076.1|  beta-amylase                                            243   8e-74    Actinidia chinensis
ref|NP_001275172.1|  beta-amylase PCT-BMYI                              243   1e-73    Solanum tuberosum [potatoes]
ref|XP_010531694.1|  PREDICTED: beta-amylase 3, chloroplastic-like      243   1e-73    Tarenaya hassleriana [spider flower]
ref|XP_003524296.1|  PREDICTED: beta-amylase 3, chloroplastic-like      243   1e-73    Glycine max [soybeans]
ref|XP_008794866.1|  PREDICTED: beta-amylase 3, chloroplastic           242   2e-73    Phoenix dactylifera
ref|XP_011018667.1|  PREDICTED: beta-amylase 3, chloroplastic-like      242   2e-73    Populus euphratica
ref|XP_010919815.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    242   3e-73    Elaeis guineensis
ref|XP_006385589.1|  beta-amylase family protein                        241   4e-73    Populus trichocarpa [western balsam poplar]
gb|KDP45986.1|  hypothetical protein JCGZ_11889                         241   5e-73    Jatropha curcas
ref|XP_004511752.1|  PREDICTED: beta-amylase 3, chloroplastic-like      241   5e-73    Cicer arietinum [garbanzo]
ref|NP_001065418.2|  Os10g0565200                                       240   6e-73    
ref|XP_010055392.1|  PREDICTED: beta-amylase 3, chloroplastic           241   6e-73    Eucalyptus grandis [rose gum]
ref|XP_007209867.1|  hypothetical protein PRUPE_ppa003812mg             241   9e-73    Prunus persica
ref|XP_007155732.1|  hypothetical protein PHAVU_003G226900g             240   1e-72    Phaseolus vulgaris [French bean]
gb|AFQ33620.1|  beta-amylase 8                                          235   1e-72    Citrus trifoliata [hardy orange]
ref|XP_006477060.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    240   1e-72    Citrus sinensis [Valencia orange]
ref|XP_008229498.1|  PREDICTED: beta-amylase 3, chloroplastic           240   1e-72    Prunus mume [ume]
gb|AAG60205.1|AC084763_25  putative chloroplast-targeted beta-amy...    240   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006477059.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    240   2e-72    
ref|XP_004983616.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...    240   2e-72    Setaria italica
ref|XP_004983617.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...    240   2e-72    
tpg|DAA46351.1|  TPA: hypothetical protein ZEAMMB73_080734              234   2e-72    Zea mays [maize]
ref|XP_003539125.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...    239   2e-72    Glycine max [soybeans]
ref|XP_004300297.1|  PREDICTED: beta-amylase 3, chloroplastic           239   3e-72    Fragaria vesca subsp. vesca
gb|KDO35878.1|  hypothetical protein CISIN_1g017328mg                   234   4e-72    Citrus sinensis [Valencia orange]
emb|CAN62440.1|  hypothetical protein VITISV_032500                     238   5e-72    Vitis vinifera
ref|XP_002282871.1|  PREDICTED: beta-amylase 3, chloroplastic           238   7e-72    Vitis vinifera
ref|XP_004508980.1|  PREDICTED: beta-amylase 3, chloroplastic-like      238   7e-72    Cicer arietinum [garbanzo]
ref|XP_010695452.1|  PREDICTED: beta-amylase 3, chloroplastic           238   7e-72    Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EYU17858.1|  hypothetical protein MIMGU_mgv1a003946mg                238   9e-72    Erythranthe guttata [common monkey flower]
ref|XP_004244551.1|  PREDICTED: beta-amylase 3, chloroplastic-like      238   1e-71    Solanum lycopersicum
ref|XP_008658990.1|  PREDICTED: uncharacterized protein LOC100502...    238   1e-71    Zea mays [maize]
emb|CAX51379.1|  beta-amylase                                           234   2e-71    Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ95735.1|  predicted protein                                      235   2e-71    Hordeum vulgare subsp. vulgare [barley]
ref|XP_002464915.1|  hypothetical protein SORBIDRAFT_01g028700          236   4e-71    Sorghum bicolor [broomcorn]
gb|KEH31589.1|  beta-amylase                                            236   4e-71    Medicago truncatula
gb|AFQ33613.1|  beta-amylase 1                                          236   5e-71    Citrus trifoliata [hardy orange]
ref|XP_009772032.1|  PREDICTED: beta-amylase 3, chloroplastic-like      235   7e-71    Nicotiana sylvestris
ref|XP_002517513.1|  Beta-amylase, putative                             236   7e-71    
emb|CDP13430.1|  unnamed protein product                                235   8e-71    Coffea canephora [robusta coffee]
ref|XP_009601320.1|  PREDICTED: beta-amylase 3, chloroplastic-like      235   9e-71    Nicotiana tomentosiformis
ref|XP_010274550.1|  PREDICTED: beta-amylase 3, chloroplastic           235   1e-70    Nelumbo nucifera [Indian lotus]
ref|XP_006440139.1|  hypothetical protein CICLE_v10019566mg             235   1e-70    Citrus clementina
tpg|DAA46353.1|  TPA: hypothetical protein ZEAMMB73_080734              234   2e-70    Zea mays [maize]
ref|XP_009759389.1|  PREDICTED: beta-amylase 3, chloroplastic-like      231   3e-70    Nicotiana sylvestris
ref|XP_006414272.1|  hypothetical protein EUTSA_v10024842mg             234   3e-70    Eutrema salsugineum
ref|XP_008658465.1|  PREDICTED: beta-amylase 3, chloroplastic-like      234   3e-70    Zea mays [maize]
ref|XP_006362484.1|  PREDICTED: beta-amylase 3, chloroplastic-like      234   4e-70    Solanum tuberosum [potatoes]
gb|KFK45005.1|  hypothetical protein AALP_AA1G332100                    234   4e-70    Arabis alpina [alpine rockcress]
gb|AFP89361.1|  beta-amylase                                            233   6e-70    Citrus limon [lemon]
emb|CDY42960.1|  BnaA01g17940D                                          233   8e-70    Brassica napus [oilseed rape]
ref|XP_009144721.1|  PREDICTED: beta-amylase 3, chloroplastic-like      233   1e-69    Brassica rapa
emb|CDY35597.1|  BnaC01g21190D                                          233   1e-69    Brassica napus [oilseed rape]
ref|XP_011032002.1|  PREDICTED: beta-amylase 3, chloroplastic-like      232   1e-69    Populus euphratica
ref|XP_009136825.1|  PREDICTED: beta-amylase 3, chloroplastic           231   3e-69    Brassica rapa
ref|XP_009371857.1|  PREDICTED: beta-amylase 3, chloroplastic           231   3e-69    Pyrus x bretschneideri [bai li]
emb|CDX90487.1|  BnaA03g42940D                                          231   3e-69    Brassica napus [oilseed rape]
ref|XP_006838474.1|  hypothetical protein AMTR_s00002p00150440          232   4e-69    
ref|XP_010440058.1|  PREDICTED: beta-amylase 3, chloroplastic           231   4e-69    Camelina sativa [gold-of-pleasure]
ref|XP_009802914.1|  PREDICTED: beta-amylase 3, chloroplastic-like      231   5e-69    Nicotiana sylvestris
emb|CDY09643.1|  BnaC07g34180D                                          231   5e-69    Brassica napus [oilseed rape]
emb|CAB46051.1|  putative beta-amylase                                  229   6e-69    Arabidopsis thaliana [mouse-ear cress]
gb|EAZ16358.1|  hypothetical protein OsJ_31821                          224   7e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002868085.1|  beta-amylase 8                                     230   7e-69    Arabidopsis lyrata subsp. lyrata
ref|NP_567523.1|  beta-amylase                                          230   8e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434720.1|  PREDICTED: beta-amylase 3, chloroplastic-like      230   9e-69    Camelina sativa [gold-of-pleasure]
ref|XP_010449668.1|  PREDICTED: beta-amylase 3, chloroplastic-like      230   1e-68    Camelina sativa [gold-of-pleasure]
ref|XP_006285145.1|  hypothetical protein CARUB_v10006488mg             229   1e-68    Capsella rubella
ref|XP_002978844.1|  hypothetical protein SELMODRAFT_233213             227   2e-68    Selaginella moellendorffii
gb|AFI56496.1|  beta-amylase                                            228   3e-68    Vaccinium corymbosum [American blueberry]
emb|CAX51380.1|  beta-amylase                                           221   3e-68    Hordeum vulgare subsp. vulgare [barley]
ref|XP_009397011.1|  PREDICTED: beta-amylase 3, chloroplastic-like      228   5e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008361217.1|  PREDICTED: beta-amylase 3, chloroplastic-like      229   1e-67    Malus domestica [apple tree]
ref|XP_002975660.1|  hypothetical protein SELMODRAFT_232533             225   2e-67    Selaginella moellendorffii
ref|XP_009612895.1|  PREDICTED: beta-amylase 3, chloroplastic           226   3e-67    Nicotiana tomentosiformis
ref|XP_010110537.1|  hypothetical protein L484_023371                   224   1e-66    Morus notabilis
ref|XP_008373719.1|  PREDICTED: beta-amylase 3, chloroplastic           222   1e-65    Malus domestica [apple tree]
gb|EMT27036.1|  Beta-amylase                                            221   1e-65    Aegilops tauschii
ref|XP_009413253.1|  PREDICTED: beta-amylase 3, chloroplastic           221   3e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003574353.1|  PREDICTED: beta-amylase 3, chloroplastic           221   3e-65    Brachypodium distachyon [annual false brome]
dbj|BAJ90222.1|  predicted protein                                      219   8e-65    Hordeum vulgare subsp. vulgare [barley]
gb|AFO84077.1|  beta-amylase                                            218   2e-64    Actinidia chinensis
gb|EAZ17007.1|  hypothetical protein OsJ_32492                          218   2e-64    Oryza sativa Japonica Group [Japonica rice]
gb|EYU24930.1|  hypothetical protein MIMGU_mgv1a020099mg                208   2e-60    Erythranthe guttata [common monkey flower]
ref|XP_006662424.1|  PREDICTED: beta-amylase 1, chloroplastic-like      202   5e-59    
gb|EEC67456.1|  hypothetical protein OsI_34681                          198   1e-58    Oryza sativa Indica Group [Indian rice]
gb|AEB00844.1|  beta-amylase 8                                          199   1e-57    Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ96156.1|  predicted protein                                      199   6e-57    Hordeum vulgare subsp. vulgare [barley]
ref|XP_008783150.1|  PREDICTED: beta-amylase 3, chloroplastic-like      197   4e-56    Phoenix dactylifera
ref|XP_003566188.1|  PREDICTED: beta-amylase 3, chloroplastic-like      197   4e-56    Brachypodium distachyon [annual false brome]
emb|CBI33977.3|  unnamed protein product                                195   5e-56    Vitis vinifera
ref|NP_001132696.1|  hypothetical protein                               196   6e-56    Zea mays [maize]
gb|EMT28216.1|  Beta-amylase                                            193   6e-56    Aegilops tauschii
ref|XP_002454872.1|  hypothetical protein SORBIDRAFT_03g000480          194   6e-56    Sorghum bicolor [broomcorn]
emb|CDM82306.1|  unnamed protein product                                191   8e-56    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010915994.1|  PREDICTED: beta-amylase 1, chloroplastic-like      196   9e-56    Elaeis guineensis
ref|NP_001130896.1|  hypothetical protein                               194   5e-55    Zea mays [maize]
gb|EEC70262.1|  hypothetical protein OsI_01068                          190   8e-55    Oryza sativa Indica Group [Indian rice]
gb|EEE54197.1|  hypothetical protein OsJ_01033                          190   9e-55    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA02286.1|  beta-amylase                                           191   2e-54    Ipomoea batatas [batate]
gb|ACJ83786.1|  unknown                                                 185   3e-54    Medicago truncatula
pdb|1FA2|A  Chain A, Crystal Structure Of Beta-Amylase From Sweet...    190   6e-54    Ipomoea batatas [batate]
sp|P10537.4|AMYB_IPOBA  RecName: Full=Beta-amylase; AltName: Full...    190   6e-54    Ipomoea batatas [batate]
dbj|BAD93289.1|  beta-amylase                                           189   9e-54    Glycine max [soybeans]
gb|AAA33941.1|  beta-amylase                                            189   1e-53    Glycine max [soybeans]
ref|NP_001236247.1|  beta-amylase precursor                             189   1e-53    Glycine max [soybeans]
pdb|1BYA|A  Chain A, Crystal Structures Of Soybean Beta-Amylase R...    189   1e-53    Glycine max [soybeans]
pdb|1BTC|A  Chain A, Three-Dimensional Structure Of Soybean Beta-...    189   1e-53    Glycine max [soybeans]
pdb|2DQX|A  Chain A, Mutant Beta-Amylase (W55r) From Soy Bean           189   1e-53    Glycine max [soybeans]
gb|KHN22864.1|  Beta-amylase                                            189   1e-53    Glycine soja [wild soybean]
pdb|1Q6C|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Co...    189   2e-53    Glycine max [soybeans]
ref|XP_007149944.1|  hypothetical protein PHAVU_005G112400g             190   2e-53    Phaseolus vulgaris [French bean]
dbj|BAD93288.1|  beta-amylase                                           189   2e-53    Glycine max [soybeans]
pdb|1Q6D|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    189   2e-53    Glycine max [soybeans]
pdb|1V3H|A  Chain A, The Roles Of Glu186 And Glu380 In The Cataly...    189   2e-53    Glycine max [soybeans]
gb|AAZ38831.1|  beta-amylase                                            189   2e-53    Glycine max [soybeans]
pdb|1Q6E|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    189   2e-53    Glycine max [soybeans]
dbj|BAA09462.1|  beta-amylase                                           189   2e-53    Glycine max [soybeans]
ref|XP_003539882.1|  PREDICTED: beta-amylase-like                       189   2e-53    Glycine max [soybeans]
pdb|1UKP|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    188   2e-53    Glycine max [soybeans]
pdb|1UKO|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    188   2e-53    Glycine max [soybeans]
dbj|BAA00828.1|  beta-amylase                                           188   3e-53    Ipomoea batatas [batate]
dbj|BAD93290.1|  beta-amylase                                           188   3e-53    Glycine max [soybeans]
dbj|BAD81275.1|  putative beta-amylase PCT-BMYI                         189   3e-53    Oryza sativa Japonica Group [Japonica rice]
gb|KJB46125.1|  hypothetical protein B456_007G349200                    188   3e-53    Gossypium raimondii
ref|XP_010659745.1|  PREDICTED: beta-amylase 1, chloroplastic-like      189   3e-53    Vitis vinifera
pdb|1WDR|A  Chain A, The Role Of An Inner Loop In The Catalytic M...    187   4e-53    Glycine max [soybeans]
ref|NP_001172248.1|  Os01g0236800                                       189   5e-53    
pdb|1V3I|A  Chain A, The Roles Of Glu186 And Glu380 In The Cataly...    187   5e-53    Glycine max [soybeans]
ref|XP_009802726.1|  PREDICTED: beta-amylase 1, chloroplastic-like      188   5e-53    Nicotiana sylvestris
emb|CAN65860.1|  hypothetical protein VITISV_014849                     188   6e-53    Vitis vinifera
dbj|BAD93291.1|  beta-amylase                                           187   6e-53    Glycine max [soybeans]
pdb|1WDQ|A  Chain A, The Role Of An Inner Loop In The Catalytic M...    187   7e-53    Glycine max [soybeans]
ref|XP_009341436.1|  PREDICTED: beta-amylase-like                       189   7e-53    Pyrus x bretschneideri [bai li]
pdb|1WDS|A  Chain A, The Role Of An Inner Loop In The Catalytic M...    187   8e-53    Glycine max [soybeans]
ref|XP_009409087.1|  PREDICTED: beta-amylase 3, chloroplastic-like      188   1e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004967358.1|  PREDICTED: beta-amylase 3, chloroplastic-like      187   1e-52    Setaria italica
ref|XP_010267811.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase       187   1e-52    Nelumbo nucifera [Indian lotus]
pdb|1Q6G|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    186   1e-52    Glycine max [soybeans]
gb|KJB31802.1|  hypothetical protein B456_005G208900                    187   1e-52    Gossypium raimondii
ref|XP_009627593.1|  PREDICTED: beta-amylase 1, chloroplastic-like      187   1e-52    Nicotiana tomentosiformis
gb|AAY40266.1|  beta-amylase                                            186   1e-52    Glycine max [soybeans]
gb|KJB31801.1|  hypothetical protein B456_005G208900                    186   2e-52    Gossypium raimondii
ref|XP_008365535.1|  PREDICTED: beta-amylase-like                       183   2e-52    
gb|KHG26296.1|  Beta-amylase                                            186   3e-52    
emb|CBI28977.3|  unnamed protein product                                186   3e-52    
ref|XP_006645692.1|  PREDICTED: beta-amylase 1, chloroplastic-like      183   3e-52    
gb|KGN43548.1|  hypothetical protein Csa_7G044880                       186   3e-52    
ref|XP_007132589.1|  hypothetical protein PHAVU_011G107700g             185   4e-52    
ref|XP_010051211.1|  PREDICTED: beta-amylase                            186   4e-52    
ref|XP_003078230.1|  beta amylase 2 (IC)                                182   5e-52    
ref|XP_002281003.2|  PREDICTED: beta-amylase                            186   6e-52    
ref|XP_008455399.1|  PREDICTED: beta-amylase-like isoform X3            184   6e-52    
ref|XP_008455398.1|  PREDICTED: beta-amylase-like isoform X2            185   7e-52    
emb|CDP20214.1|  unnamed protein product                                184   7e-52    
gb|KCW89435.1|  hypothetical protein EUGRSUZ_A01734                     186   8e-52    
emb|CDP12194.1|  unnamed protein product                                182   9e-52    
ref|XP_002515712.1|  Beta-amylase, putative                             184   9e-52    
ref|XP_004169660.1|  PREDICTED: beta-amylase 1, chloroplastic-like      182   1e-51    
ref|XP_010688831.1|  PREDICTED: beta-amylase-like                       185   1e-51    
gb|AAK30294.1|AF353207_1  beta-amylase                                  184   1e-51    
gb|AES67296.2|  beta-amylase                                            185   2e-51    
gb|AAG44882.1|AF284857_1  beta-amylase                                  183   2e-51    
ref|XP_007215122.1|  hypothetical protein PRUPE_ppa004334mg             184   2e-51    
ref|XP_004144579.1|  PREDICTED: beta-amylase-like                       184   2e-51    
ref|XP_008455397.1|  PREDICTED: beta-amylase-like isoform X1            185   2e-51    
sp|O65015.1|AMYB_TRIRP  RecName: Full=Beta-amylase; AltName: Full...    182   3e-51    
ref|XP_009353236.1|  PREDICTED: beta-amylase-like                       184   3e-51    
ref|XP_004289151.1|  PREDICTED: beta-amylase-like                       184   3e-51    
emb|CAN70833.1|  hypothetical protein VITISV_005286                     182   4e-51    
ref|XP_004243448.1|  PREDICTED: beta-amylase                            183   5e-51    
gb|EYU24817.1|  hypothetical protein MIMGU_mgv1a005201mg                182   6e-51    
ref|XP_010107262.1|  Beta-amylase 1                                     183   6e-51    
ref|XP_006360578.1|  PREDICTED: beta-amylase-like                       183   6e-51    
ref|XP_009597614.1|  PREDICTED: beta-amylase isoform X2                 181   1e-50    
gb|AHG94609.1|  beta-amylase                                            183   1e-50    
ref|XP_006844925.1|  hypothetical protein AMTR_s00058p00155330          182   1e-50    
ref|XP_002881219.1|  beta-amylase 5                                     182   1e-50    
ref|XP_008379598.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    183   1e-50    
gb|AFK33500.1|  unknown                                                 181   1e-50    
gb|KEH29555.1|  beta-amylase                                            181   1e-50    
emb|CEF97167.1|  Glycoside hydrolase, catalytic domain                  182   1e-50    
emb|CAA76131.1|  beta-amylase                                           182   2e-50    
ref|XP_009597613.1|  PREDICTED: beta-amylase isoform X1                 182   2e-50    
ref|XP_004144400.1|  PREDICTED: beta-amylase 1, chloroplastic-like      181   2e-50    
gb|KFK31133.1|  hypothetical protein AALP_AA6G072200                    182   2e-50    
emb|CDY12218.1|  BnaC04g12480D                                          182   2e-50    
ref|XP_010510055.1|  PREDICTED: beta-amylase 6 isoform X2               181   2e-50    
ref|XP_001755209.1|  predicted protein                                  180   2e-50    
ref|XP_010522319.1|  PREDICTED: beta-amylase 6                          182   2e-50    
ref|XP_010510054.1|  PREDICTED: beta-amylase 6 isoform X1               181   2e-50    
gb|EMT30792.1|  Beta-amylase                                            182   3e-50    
ref|XP_008460412.1|  PREDICTED: beta-amylase 1, chloroplastic-like      181   3e-50    
ref|XP_009403535.1|  PREDICTED: beta-amylase 3, chloroplastic-like      181   3e-50    
gb|AFG63534.1|  hypothetical protein 0_8796_01                          170   3e-50    
ref|XP_003541934.2|  PREDICTED: beta-amylase-like                       181   4e-50    
ref|XP_009776413.1|  PREDICTED: beta-amylase-like                       181   4e-50    
ref|XP_006343811.1|  PREDICTED: beta-amylase 1, chloroplastic-like      181   4e-50    
ref|XP_010689279.1|  PREDICTED: beta-amylase-like                       179   4e-50    
ref|XP_001416970.1|  predicted protein                                  179   5e-50    
gb|KHN25764.1|  Beta-amylase                                            181   5e-50    
sp|O22585.1|AMYB_MEDSA  RecName: Full=Beta-amylase; AltName: Full...    179   6e-50    
ref|XP_003540325.2|  PREDICTED: beta-amylase-like                       181   6e-50    
dbj|BAK00030.1|  predicted protein                                      181   6e-50    
ref|XP_010695752.1|  PREDICTED: beta-amylase-like                       179   6e-50    
ref|XP_011100422.1|  PREDICTED: beta-amylase-like                       181   6e-50    
gb|AFG63539.1|  hypothetical protein 0_8796_01                          169   7e-50    
ref|XP_004245482.1|  PREDICTED: beta-amylase 3, chloroplastic-like      180   8e-50    
gb|AFG63532.1|  hypothetical protein 0_8796_01                          169   9e-50    
gb|AFG63538.1|  hypothetical protein 0_8796_01                          169   1e-49    
ref|XP_010469618.1|  PREDICTED: beta-amylase 6 isoform X1               180   1e-49    
gb|AAC69949.1|  putative beta-amylase                                   179   1e-49    
gb|AFG63535.1|  hypothetical protein 0_8796_01                          169   1e-49    
gb|KDP25878.1|  hypothetical protein JCGZ_22908                         179   1e-49    
ref|NP_180788.2|  beta-amylase 6                                        179   2e-49    
ref|XP_001691372.1|  beta-amylase                                       179   2e-49    
gb|AFG63533.1|  hypothetical protein 0_8796_01                          168   2e-49    
ref|XP_006837006.1|  hypothetical protein AMTR_s00098p00153370          175   2e-49    
gb|KHN36566.1|  Beta-amylase                                            182   3e-49    
ref|XP_010055984.1|  PREDICTED: beta-amylase 1, chloroplastic-like      178   3e-49    
ref|XP_010414016.1|  PREDICTED: beta-amylase 6-like                     179   3e-49    
pdb|1B1Y|A  Chain A, Sevenfold Mutant Of Barley Beta-Amylase            177   3e-49    
ref|XP_010247031.1|  PREDICTED: beta-amylase-like                       176   5e-49    
gb|ADB81912.1|  beta-amylase                                            176   6e-49    
ref|XP_009143965.1|  PREDICTED: beta-amylase 6                          178   6e-49    
ref|XP_002304568.2|  hypothetical protein POPTR_0003s14340g             174   6e-49    
sp|O64407.1|AMYB_VIGUN  RecName: Full=Beta-amylase; AltName: Full...    176   6e-49    
ref|XP_006293905.1|  hypothetical protein CARUB_v10022897mg             177   7e-49    
emb|CDY48276.1|  BnaA05g10780D                                          177   7e-49    
ref|XP_007029518.1|  Beta-amylase 6                                     176   7e-49    
ref|XP_010109553.1|  hypothetical protein L484_018288                   176   9e-49    
gb|KDO76620.1|  hypothetical protein CISIN_1g009162mg                   176   1e-48    
ref|XP_003062547.1|  glycoside hydrolase family 14 protein              176   1e-48    
ref|XP_006293904.1|  hypothetical protein CARUB_v10022897mg             177   1e-48    
ref|XP_006396247.1|  hypothetical protein EUTSA_v10028560mg             176   1e-48    
ref|XP_002875024.1|  beta-amylase 9                                     176   1e-48    
gb|EMS48018.1|  Beta-amylase                                            177   2e-48    
ref|XP_006372994.1|  hypothetical protein POPTR_0017s06840g             172   2e-48    
gb|KDO76621.1|  hypothetical protein CISIN_1g009162mg                   176   2e-48    
gb|AAC13634.1|  similar to the family of glycosyl hydrolases            176   2e-48    
gb|AFQ33615.1|  beta-amylase 3                                          176   2e-48    
ref|XP_004957937.1|  PREDICTED: beta-amylase-like                       176   2e-48    
ref|XP_002320794.2|  hypothetical protein POPTR_0014s07950g             176   3e-48    
dbj|BAK06223.1|  predicted protein                                      172   3e-48    
ref|XP_011036188.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    175   3e-48    
ref|XP_002501612.1|  glycoside hydrolase family 14 protein              174   3e-48    
ref|XP_011036179.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    175   3e-48    
ref|XP_006439285.1|  hypothetical protein CICLE_v10019360mg             176   3e-48    
ref|XP_007209090.1|  hypothetical protein PRUPE_ppa003539mg             176   3e-48    
ref|XP_004487367.1|  PREDICTED: beta-amylase-like                       176   3e-48    
ref|XP_006476339.1|  PREDICTED: beta-amylase 1, chloroplastic-like      176   3e-48    
ref|NP_191958.3|  beta-amylase 2                                        175   3e-48    
ref|XP_006439286.1|  hypothetical protein CICLE_v10019360mg             176   4e-48    
ref|NP_001105496.1|  beta-amylase                                       174   4e-48    
dbj|BAC83773.1|  putative beta-amylase                                  174   4e-48    
gb|AAD15902.1|  beta-amylase                                            174   4e-48    
gb|EEC82222.1|  hypothetical protein OsI_26370                          176   4e-48    
gb|EAZ04228.1|  hypothetical protein OsI_26372                          174   4e-48    
ref|XP_002460819.1|  hypothetical protein SORBIDRAFT_02g035590          176   5e-48    
ref|XP_008239169.1|  PREDICTED: beta-amylase 3, chloroplastic-like      175   5e-48    
ref|XP_008793743.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    174   6e-48    
gb|EMS68884.1|  Beta-amylase                                            174   6e-48    
ref|XP_009387229.1|  PREDICTED: beta-amylase-like                       171   8e-48    
gb|EMT06941.1|  Beta-amylase                                            174   8e-48    
gb|AAX37358.1|  tissue-ubiquitous beta-amylase 2                        174   8e-48    
gb|KHG19612.1|  Beta-amylase 2, chloroplastic -like protein             174   9e-48    
ref|XP_010931493.1|  PREDICTED: beta-amylase                            174   9e-48    
gb|AAA33899.1|  beta-amylase                                            173   9e-48    
ref|XP_010456279.1|  PREDICTED: beta-amylase 2, chloroplastic-like      174   9e-48    
ref|XP_006657803.1|  PREDICTED: beta-amylase-like                       173   9e-48    
ref|XP_003562968.2|  PREDICTED: beta-amylase-like                       175   1e-47    
ref|XP_009388864.1|  PREDICTED: beta-amylase isoform X1                 173   1e-47    
gb|AAA33898.1|  beta-amylase                                            173   1e-47    
ref|XP_004513548.1|  PREDICTED: beta-amylase-like                       173   1e-47    
ref|XP_010427089.1|  PREDICTED: beta-amylase 2, chloroplastic           174   1e-47    
ref|XP_009388866.1|  PREDICTED: beta-amylase isoform X2                 173   1e-47    
ref|NP_001059906.1|  Os07g0543100                                       174   1e-47    
gb|KFK30629.1|  hypothetical protein AALP_AA6G006600                    173   2e-47    
gb|AGY14538.1|  beta-amylase                                            173   2e-47    
ref|XP_010670423.1|  PREDICTED: beta-amylase 2, chloroplastic           174   2e-47    
gb|KDO59876.1|  hypothetical protein CISIN_1g010067mg                   173   2e-47    
ref|XP_006410362.1|  hypothetical protein EUTSA_v10016419mg             174   2e-47    
ref|XP_007511103.1|  beta-amylase                                       175   2e-47    
sp|P82993.1|AMYB_HORVS  RecName: Full=Beta-amylase; AltName: Full...    173   2e-47    
pdb|2XFF|A  Chain A, Crystal Structure Of Barley Beta-Amylase Com...    173   2e-47    
emb|CAC16789.1|  beta-amylase                                           173   2e-47    
gb|AAX37357.1|  tissue-ubiquitous beta-amylase 2                        172   2e-47    
gb|AFQ33617.1|  beta-amylase 5                                          173   2e-47    
gb|AAO67355.1|AF414081_1  endosperm-specific beta-amylase 1             173   2e-47    
gb|AGY14536.1|  beta-amylase                                            173   2e-47    
gb|AGY14530.1|  beta-amylase                                            173   3e-47    
gb|ACF05414.1|  beta-amylase                                            173   3e-47    
gb|AAG25638.1|  beta-amylase                                            173   3e-47    
ref|XP_006372993.1|  Chain A family protein                             172   3e-47    
dbj|BAA04815.1|  beta-amylase                                           172   3e-47    
gb|AAR18251.1|  beta-amylase 1                                          172   3e-47    
gb|AGY14529.1|  beta-amylase                                            172   3e-47    
gb|AAO67356.1|AF414082_1  endosperm-specific beta-amylase 1             172   3e-47    
gb|AGY14527.1|  beta-amylase                                            172   3e-47    
gb|ACN24986.1|  beta-amylase                                            172   3e-47    
gb|EYU32116.1|  hypothetical protein MIMGU_mgv1a003882mg                173   3e-47    
sp|P93594.1|AMYB_WHEAT  RecName: Full=Beta-amylase; AltName: Full...    172   3e-47    
gb|AGY14524.1|  beta-amylase                                            172   4e-47    
ref|XP_006447463.1|  hypothetical protein CICLE_v10014929mg             172   4e-47    
gb|AFO64358.1|  beta-amylase                                            172   4e-47    
ref|XP_003562967.2|  PREDICTED: beta-amylase                            174   4e-47    
emb|CDY07213.1|  BnaCnng02280D                                          172   4e-47    
emb|CDY51154.1|  BnaA09g51890D                                          172   4e-47    
gb|AAG25637.1|  beta-amylase                                            172   5e-47    
ref|XP_009111477.1|  PREDICTED: beta-amylase 2, chloroplastic           172   5e-47    
ref|XP_006372990.1|  hypothetical protein POPTR_0017s06840g             172   5e-47    
gb|AAC67245.1|  beta-amylase                                            172   5e-47    
sp|P16098.1|AMYB_HORVU  RecName: Full=Beta-amylase; AltName: Full...    172   5e-47    
ref|XP_011038004.1|  PREDICTED: beta-amylase 1, chloroplastic-like      172   6e-47    
ref|XP_011022459.1|  PREDICTED: beta-amylase 1, chloroplastic-like      172   6e-47    
gb|AAC64904.1|  beta-amylase                                            171   6e-47    
ref|XP_003597045.1|  Beta-amylase                                       172   6e-47    
gb|AHC32020.1|  beta-amylase 2                                          172   8e-47    
ref|XP_006287426.1|  hypothetical protein CARUB_v10000631mg             171   9e-47    
gb|KDP28630.1|  hypothetical protein JCGZ_14401                         171   1e-46    
gb|AFK35065.1|  unknown                                                 161   1e-46    
ref|XP_011006412.1|  PREDICTED: beta-amylase-like                       171   1e-46    
ref|XP_010055131.1|  PREDICTED: beta-amylase 2, chloroplastic           171   2e-46    
gb|EYU24815.1|  hypothetical protein MIMGU_mgv1a006126mg                169   2e-46    
ref|XP_007051810.1|  Beta-amylase 2 isoform 1                           171   2e-46    
ref|NP_001175243.1|  Os07g0543200                                       174   3e-46    
ref|XP_007051811.1|  Beta-amylase 2 isoform 2                           170   3e-46    
gb|KJB41331.1|  hypothetical protein B456_007G099200                    170   3e-46    
ref|XP_008230132.1|  PREDICTED: beta-amylase-like                       169   3e-46    
ref|XP_009358648.1|  PREDICTED: beta-amylase 1, chloroplastic-like      170   4e-46    
ref|XP_004957938.1|  PREDICTED: beta-amylase-like                       169   4e-46    
ref|XP_010540283.1|  PREDICTED: beta-amylase 2, chloroplastic           169   4e-46    
ref|XP_003532447.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    169   7e-46    
ref|XP_005826390.1|  hypothetical protein GUITHDRAFT_96651              169   7e-46    
ref|XP_008804013.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    169   8e-46    
ref|XP_008804014.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    169   8e-46    
ref|XP_002511858.1|  Beta-amylase, putative                             169   1e-45    
ref|XP_008804015.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    169   1e-45    
ref|XP_002946796.1|  hypothetical protein VOLCADRAFT_103220             172   1e-45    
ref|XP_008338858.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    169   1e-45    
ref|XP_006445046.1|  hypothetical protein CICLE_v10019525mg             169   1e-45    
ref|XP_011070357.1|  PREDICTED: beta-amylase 1, chloroplastic-like      168   1e-45    
ref|XP_007218058.1|  hypothetical protein PRUPE_ppa006189mg             166   2e-45    
ref|XP_002274612.2|  PREDICTED: beta-amylase 2, chloroplastic           168   2e-45    
ref|XP_008787505.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    167   2e-45    
ref|XP_010255371.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    169   2e-45    
ref|XP_010255372.1|  PREDICTED: beta-amylase 7-like isoform X2          169   2e-45    
ref|XP_007040595.1|  Beta-amylase 1                                     168   2e-45    
ref|XP_011026832.1|  PREDICTED: beta-amylase 1, chloroplastic-like      167   2e-45    
ref|XP_010909265.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    169   2e-45    
ref|XP_004306786.1|  PREDICTED: beta-amylase 2, chloroplastic           167   2e-45    
ref|XP_006827627.1|  hypothetical protein AMTR_s00009p00244310          167   3e-45    
ref|XP_008337562.1|  PREDICTED: beta-amylase 1, chloroplastic-like      167   3e-45    
ref|XP_009794895.1|  PREDICTED: beta-amylase 3, chloroplastic-like      166   3e-45    
gb|KIY96832.1|  hypothetical protein MNEG_11132                         162   3e-45    
ref|XP_008232901.1|  PREDICTED: beta-amylase 2, chloroplastic           167   3e-45    
ref|XP_005846868.1|  hypothetical protein CHLNCDRAFT_134683             164   4e-45    
ref|XP_008787503.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    166   5e-45    
ref|XP_005534831.1|  probable beta-amylase                              166   6e-45    
emb|CCW36772.1|  beta-amylase 2                                         164   7e-45    
emb|CAA77817.1|  Beta-amylase                                           166   7e-45    
ref|XP_001770103.1|  predicted protein                                  166   7e-45    
gb|EPS61694.1|  hypothetical protein M569_13099                         166   7e-45    
gb|KIZ05231.1|  hypothetical protein MNEG_2733                          166   7e-45    



>gb|KDP33360.1| hypothetical protein JCGZ_12909 [Jatropha curcas]
Length=583

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T+PYGEFFL+WYSQML+DHGERIL S+ AIF+NTGVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  362  TSPYGEFFLNWYSQMLIDHGERILSSSKAIFENTGVKISVKVAGIHWHYGTRSHAPELTA  421

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARHGA+FNFTCIEMRDHEQPQDA CAPEKLVRQVALATQEAQ
Sbjct  422  GYYNTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAQ  481

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYDDYAHEQILR S+LSIDE S DREMCAFTYLRMNP LFQ DNWRRFVA
Sbjct  482  VPLAGENALPRYDDYAHEQILRASSLSIDENSDDREMCAFTYLRMNPHLFQEDNWRRFVA  541

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  542  FVKKMKEGK  550



>ref|XP_011091372.1| PREDICTED: beta-amylase 1, chloroplastic [Sesamum indicum]
Length=580

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYGEFFLSWYSQML+DHGERILQSA ++F+N GVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  359  NTPYGEFFLSWYSQMLIDHGERILQSAKSLFENKGVKISVKIAGIHWHYGTRSHAPELTA  418

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARHGA+FNFTCIEMRDHEQPQDA CAPEKLVRQVALATQEAQ
Sbjct  419  GYYNTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAQ  478

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYDDYAHEQIL+ SAL ID  S DREMCAFTYLRMNPDLFQ DNWRRFVA
Sbjct  479  VPLAGENALPRYDDYAHEQILQASALDIDGNSADREMCAFTYLRMNPDLFQPDNWRRFVA  538

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  539  FVKKMKEGK  547



>gb|AAY89374.1| beta-amylase 1 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=576

 Score =   368 bits (945),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLL+HGERILQSA AIFD+ GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  358  YGEFFLTWYSQMLLNHGERILQSAKAIFDDKGVKISVKIAGIHWHYGTRSHAPELTAGYY  417

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARHGAIFNFTC+EMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL
Sbjct  418  NTRFRDGYLPIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  477

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAHEQIL+ S+L+ID+ S DREMCAFTYLRMNPDLF  DNWRRFVAFVK
Sbjct  478  AGENALPRYDDYAHEQILQASSLNIDDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVK  537

Query  551  KMKEGK  568
            KMKEGK
Sbjct  538  KMKEGK  543



>gb|AII99838.1| beta-amylase [Nicotiana tabacum]
Length=576

 Score =   366 bits (940),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLL+HGERILQSA AIFD+ GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  358  YGEFFLTWYSQMLLNHGERILQSAKAIFDDKGVKISVKIAGIHWHYGTRSHAPELTAGYY  417

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARHGAIFNFTC+EMRDHEQPQDAQCAPEKLVRQVALATQEA+VPL
Sbjct  418  NTRFRDGYLPIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEARVPL  477

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAHEQIL+ S+L+ID+ S DREMCAFTYLRMNPDLF  DNWRRFVAFVK
Sbjct  478  AGENALPRYDDYAHEQILQASSLNIDDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVK  537

Query  551  KMKEGK  568
            KMKEGK
Sbjct  538  KMKEGK  543



>ref|XP_009596880.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana tomentosiformis]
Length=576

 Score =   366 bits (940),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLL+HGERILQSA AIFD+ GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  358  YGEFFLTWYSQMLLNHGERILQSAKAIFDDKGVKISVKIAGIHWHYGTRSHAPELTAGYY  417

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARHGAIFNFTC+EMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL
Sbjct  418  NTRFRDGYLPIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  477

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAHEQIL+ S+L+I++ S DREMCAFTYLRMNPDLF  DNWRRFVAFVK
Sbjct  478  AGENALPRYDDYAHEQILQASSLNINDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVK  537

Query  551  KMKEGK  568
            KMKEGK
Sbjct  538  KMKEGK  543



>ref|XP_009785196.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana sylvestris]
Length=576

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLL+HGERILQSA AIF + GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  358  YGEFFLTWYSQMLLNHGERILQSAKAIFHDKGVKISVKIAGIHWHYGTRSHAPELTAGYY  417

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARHGAIFNFTC+EMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL
Sbjct  418  NTRFRDGYLPIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  477

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAHEQIL+ S+L+ID+ S DREMCAFTYLRMNPDLF  DNWRRFVAFVK
Sbjct  478  AGENALPRYDDYAHEQILQASSLNIDDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVK  537

Query  551  KMKEGK  568
            KMKEGK
Sbjct  538  KMKEGK  543



>ref|XP_006340896.1| PREDICTED: beta-amylase 1, chloroplastic-like [Solanum tuberosum]
Length=579

 Score =   363 bits (931),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYS+MLL+HGERILQSA AIF++ GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  361  YGEFFLTWYSEMLLNHGERILQSAKAIFEDKGVKISVKIAGIHWHYGTRSHAPELTAGYY  420

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIAQMLARHGA+FNFTC+EMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL
Sbjct  421  NTRNRDGYLPIAQMLARHGAVFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  480

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAHEQIL+ S+L+I++ SGDREMCAFTYLRMNPDLF  DNWRRFVAFVK
Sbjct  481  AGENALPRYDDYAHEQILQASSLNINDQSGDREMCAFTYLRMNPDLFHPDNWRRFVAFVK  540

Query  551  KMKEGK  568
            KMKEGK
Sbjct  541  KMKEGK  546



>ref|XP_002314522.2| hypothetical protein POPTR_0010s07340g [Populus trichocarpa]
 gb|EEF00693.2| hypothetical protein POPTR_0010s07340g [Populus trichocarpa]
Length=586

 Score =   361 bits (927),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T+PYGEFFL+WYSQMLLDHGERIL SA A F+N GVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  365  TSPYGEFFLTWYSQMLLDHGERILSSAKATFENIGVKISVKIAGIHWHYGTRSHAPELTA  424

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIA+MLARHGAIFNFTCIEMRDHEQPQDA CAPEKLVRQVALAT+EA 
Sbjct  425  GYYNTRFRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAD  484

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PLAGENALPRYD+YAHEQIL+ S+L+IDE S D+EMCAFTYLRMNP LFQ DNWRRFVA
Sbjct  485  IPLAGENALPRYDEYAHEQILQASSLNIDESSDDKEMCAFTYLRMNPHLFQPDNWRRFVA  544

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  545  FVKKMKEGK  553



>ref|XP_002518196.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF44329.1| Beta-amylase, putative [Ricinus communis]
Length=574

 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL WYSQMLLDHGERIL SA AIF+NTGVKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  356  YGEFFLGWYSQMLLDHGERILSSATAIFENTGVKISVKVAGIHWHYGTRSHAPELTAGYY  415

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQML RHGAIFNFTCIEMRDHEQPQDA CAPEKLVRQVALATQEAQVPL
Sbjct  416  NTRFRDGYLPIAQMLGRHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAQVPL  475

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDD+AHEQIL+ S+LSI+  S DREMCAFTYLRMNP LFQ DNWRRFVAFVK
Sbjct  476  AGENALPRYDDFAHEQILQASSLSINGDSDDREMCAFTYLRMNPHLFQEDNWRRFVAFVK  535

Query  551  KMKEGK  568
            KMKEGK
Sbjct  536  KMKEGK  541



>emb|CDP20299.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYS+MLLDHGERILQSA AIF+N GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  364  YGEFFLTWYSKMLLDHGERILQSAKAIFENGGVKISVKIAGIHWHYGTRSHAPELTAGYY  423

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLVRQVALATQ+AQVPL
Sbjct  424  NTRLRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQQAQVPL  483

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD+YAHEQIL+T+AL+ID  S +REMCAFTYLRMNPDLF  DNWRRFVAFVK
Sbjct  484  AGENALPRYDEYAHEQILKTAALNIDGNSTNREMCAFTYLRMNPDLFHPDNWRRFVAFVK  543

Query  551  KMKEGK  568
            KMKEGK
Sbjct  544  KMKEGK  549



>ref|NP_001234556.1| beta-amylase [Solanum lycopersicum]
 gb|ADK97800.1| beta-amylase [Solanum lycopersicum]
Length=580

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYS+MLL+HGERILQSA AIF++ GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  362  YGEFFLTWYSEMLLNHGERILQSAKAIFEDKGVKISVKIAGIHWHYGTRSHAPELTAGYY  421

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIAQMLARHGA+FNFTC+EMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL
Sbjct  422  NTRNRDGYLPIAQMLARHGAVFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  481

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAHEQIL+ S+LSI++ SGDREM AFTYLRMNPDLF  DNWRRFVAFVK
Sbjct  482  AGENALPRYDDYAHEQILQASSLSINDQSGDREMSAFTYLRMNPDLFHPDNWRRFVAFVK  541

Query  551  KMKEGK  568
            KMKEGK
Sbjct  542  KMKEGK  547



>gb|KJB68707.1| hypothetical protein B456_011G1810001, partial [Gossypium raimondii]
Length=375

 Score =   348 bits (894),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYGEFFL+WYSQMLL+HG RIL SA +IFD  GVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  154  NTPYGEFFLTWYSQMLLEHGARILSSATSIFDGAGVKISVKVAGIHWHYGTRSHAPELTA  213

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVALAT  AQ
Sbjct  214  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVALATGAAQ  273

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+YAHEQILR S+L++D  + DREMCAFTYLRMNP LF  DNWRRFVA
Sbjct  274  VPLAGENALPRYDEYAHEQILRASSLNVDGSAVDREMCAFTYLRMNPSLFHPDNWRRFVA  333

Query  542  FVKKMKEGK  568
            FVKKM EGK
Sbjct  334  FVKKMNEGK  342



>ref|XP_003534086.1| PREDICTED: beta-amylase 1, chloroplastic [Glycine max]
Length=569

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYGEFFL+WYSQMLL+HG+RIL SA +IFDNTGVKISVK+AGIHWHYGTRSHAPELTAGY
Sbjct  351  PYGEFFLTWYSQMLLEHGDRILSSATSIFDNTGVKISVKVAGIHWHYGTRSHAPELTAGY  410

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQ+A CAPEKLV+QVALATQ+AQVP
Sbjct  411  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQEALCAPEKLVKQVALATQKAQVP  470

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD+YAHEQI+R S L +D  SGDREMCAFTYLRMNP LF+ +NWR+FV FV
Sbjct  471  LAGENALPRYDEYAHEQIIRASQLDVDGESGDREMCAFTYLRMNPHLFEPNNWRKFVGFV  530

Query  548  KKMKEGK  568
            KKMKEGK
Sbjct  531  KKMKEGK  537



>gb|KJB68705.1| hypothetical protein B456_011G1810001 [Gossypium raimondii]
Length=377

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYGEFFL+WYSQMLL+HG RIL SA +IFD  GVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  156  NTPYGEFFLTWYSQMLLEHGARILSSATSIFDGAGVKISVKVAGIHWHYGTRSHAPELTA  215

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVALAT  AQ
Sbjct  216  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVALATGAAQ  275

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+YAHEQILR S+L++D  + DREMCAFTYLRMNP LF  DNWRRFVA
Sbjct  276  VPLAGENALPRYDEYAHEQILRASSLNVDGSAVDREMCAFTYLRMNPSLFHPDNWRRFVA  335

Query  542  FVKKMKEGK  568
            FVKKM EGK
Sbjct  336  FVKKMNEGK  344



>ref|XP_003548316.1| PREDICTED: beta-amylase 1, chloroplastic-like [Glycine max]
Length=570

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYGEFFL+WYSQMLLDHG+RIL SA +IFDNTGVKISVK+AGIHWHYG+RSHAPELTAGY
Sbjct  352  PYGEFFLTWYSQMLLDHGDRILSSATSIFDNTGVKISVKVAGIHWHYGSRSHAPELTAGY  411

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGY+PIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVALATQ+AQVP
Sbjct  412  YNTRFRDGYIPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVALATQKAQVP  471

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD+YAHEQI+R S L +D  SG REMCAFTYLRMNP LF+ +NWR+FV FV
Sbjct  472  LAGENALPRYDEYAHEQIIRASQLDVDGDSGGREMCAFTYLRMNPHLFEPNNWRKFVGFV  531

Query  548  KKMKEGK  568
            KKMKEGK
Sbjct  532  KKMKEGK  538



>gb|KHG16283.1| Beta-amylase 1, chloroplastic -like protein [Gossypium arboreum]
Length=587

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYGEFFL+WYSQMLLDHGERIL SA +IFD  GVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  366  NTPYGEFFLTWYSQMLLDHGERILSSATSIFDGAGVKISVKVAGIHWHYGTRSHAPELTA  425

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+RDGYLPIAQMLARHGA+FNFTCIEMRDHEQPQDA CAPEKLV+QVALAT  AQ
Sbjct  426  GYYNTRYRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVKQVALATGAAQ  485

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+YAHEQIL+ S+L++D+   DREMCAFTYLRMNP LF  DNWRRFVA
Sbjct  486  VPLAGENALPRYDEYAHEQILQASSLNVDDLPVDREMCAFTYLRMNPSLFHPDNWRRFVA  545

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  546  FVKKMKEGK  554



>ref|XP_007152599.1| hypothetical protein PHAVU_004G143600g [Phaseolus vulgaris]
 gb|ESW24593.1| hypothetical protein PHAVU_004G143600g [Phaseolus vulgaris]
Length=568

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLL+HG+RIL SA +IFDNTGVKISVKIAGIHWHYG+RSHAPELTAGYY
Sbjct  351  YGEFFLTWYSQMLLNHGDRILTSAKSIFDNTGVKISVKIAGIHWHYGSRSHAPELTAGYY  410

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRF DGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVALATQ+AQV L
Sbjct  411  NTRFHDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVALATQKAQVAL  470

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPR+DDYAHEQI+R S L +D  SGDREMCAFTYLRMNP LF+ADNWR+FVAFVK
Sbjct  471  AGENALPRFDDYAHEQIIRASQLDVDGDSGDREMCAFTYLRMNPHLFEADNWRKFVAFVK  530

Query  551  KMKEGK  568
            KMKEGK
Sbjct  531  KMKEGK  536



>ref|XP_003632025.2| PREDICTED: beta-amylase 1, chloroplastic [Vitis vinifera]
Length=459

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 177/189 (94%), Gaps = 2/189 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T+PYGEFFL+WYSQMLLDHGERIL SA +IF + GVKISVK++GIHWHYGTRSHAPELTA
Sbjct  270  TSPYGEFFLNWYSQMLLDHGERILSSAKSIFQDMGVKISVKVSGIHWHYGTRSHAPELTA  329

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGAI NFTCIEMRDHEQPQDA+CAPEKLVRQ+ALAT++AQ
Sbjct  330  GYYNTRFRDGYIPIAQMLARHGAILNFTCIEMRDHEQPQDARCAPEKLVRQLALATRKAQ  389

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+ AHEQILR S+L+ D    +REMCAFTYLRMNPDLFQADNWRRFVA
Sbjct  390  VPLAGENALPRYDETAHEQILRASSLNFD--GEEREMCAFTYLRMNPDLFQADNWRRFVA  447

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  448  FVKKMKEGK  456



>gb|AGS94413.1| beta-amylase, partial [Actinidia chinensis]
Length=377

 Score =   347 bits (889),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 175/187 (94%), Gaps = 1/187 (1%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL WYSQMLLDHG+RIL SA AIF+N GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  162  YGEFFLGWYSQMLLDHGDRILSSAKAIFENKGVKISVKIAGIHWHYGTRSHAPELTAGYY  221

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARHGA+FNFTCIEMRDHEQPQDAQCAPEKLV+QVALAT+ AQVPL
Sbjct  222  NTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDAQCAPEKLVKQVALATRAAQVPL  281

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGD-REMCAFTYLRMNPDLFQADNWRRFVAFV  547
            AGENALPRYD+ AHEQIL+ S+L+I+  SGD REMCAFTYLRMN DLFQ DNWRRFVAFV
Sbjct  282  AGENALPRYDERAHEQILQASSLNIEGDSGDNREMCAFTYLRMNQDLFQPDNWRRFVAFV  341

Query  548  KKMKEGK  568
            KKMKEGK
Sbjct  342  KKMKEGK  348



>ref|XP_009777267.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana sylvestris]
Length=565

 Score =   353 bits (905),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYG+FFL+WYSQMLLDHGERILQS  AIF+N GVKISVK+AGIHWHYGTRSHAPELTAGY
Sbjct  346  PYGQFFLTWYSQMLLDHGERILQSTKAIFENKGVKISVKVAGIHWHYGTRSHAPELTAGY  405

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA+CAPEKLVRQVALAT+EAQVP
Sbjct  406  YNTRFRDGYLPIAQMLARHDAIFNFTCIEMRDHEQPQDARCAPEKLVRQVALATREAQVP  465

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD++AHEQIL+ S+L+ID  S +R+MCAFTYLRMNPDLF  DNW+RF+AFV
Sbjct  466  LAGENALPRYDEFAHEQILQASSLNIDSQSDNRQMCAFTYLRMNPDLFHPDNWKRFIAFV  525

Query  548  KKMKEGK  568
            KKM +GK
Sbjct  526  KKMNDGK  532



>gb|KJB72486.1| hypothetical protein B456_011G1809001, partial [Gossypium raimondii]
Length=375

 Score =   345 bits (886),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYGEFFL+WYSQMLL+HG RIL SA +IFD  GVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  154  NTPYGEFFLTWYSQMLLEHGARILSSATSIFDGAGVKISVKVAGIHWHYGTRSHAPELTA  213

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARHGA+FNFTCIEMRDHEQPQDA CAPEKLV+QVALAT  A 
Sbjct  214  GYYNTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVKQVALATGAAH  273

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+YAHEQILR S+L++D  + DREMCAFTYLRMNP LF  DNWRRFVA
Sbjct  274  VPLAGENALPRYDEYAHEQILRASSLNVDGSAVDREMCAFTYLRMNPSLFHPDNWRRFVA  333

Query  542  FVKKMKEGK  568
            FVKKM EGK
Sbjct  334  FVKKMNEGK  342



>ref|XP_010666969.1| PREDICTED: beta-amylase 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=579

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            ++ YGEFFL+WYSQMLLDHGERIL +A  IF + GVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  358  SSSYGEFFLTWYSQMLLDHGERILSAATEIFKDKGVKISVKIAGIHWHYGTRSHAPELTA  417

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLAR+GAIFNFTCIEMRD EQPQDA CAPEKLVRQV  ATQ AQ
Sbjct  418  GYYNTRFRDGYLPIAQMLARYGAIFNFTCIEMRDQEQPQDALCAPEKLVRQVVSATQRAQ  477

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD++AHEQIL  SAL++DE SG+REMCAFTYLRMNPDLFQADNWR+FVA
Sbjct  478  VPLAGENALPRYDEHAHEQILNASALNVDENSGEREMCAFTYLRMNPDLFQADNWRKFVA  537

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  538  FVKKMKEGK  546



>ref|XP_011029718.1| PREDICTED: beta-amylase 1, chloroplastic-like [Populus euphratica]
Length=582

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T PYGEFFLSWYSQMLLDH ERIL SA AIF+NTGVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  361  TCPYGEFFLSWYSQMLLDHAERILSSAKAIFENTGVKISVKIAGIHWHYGTRSHAPELTA  420

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLVRQVALAT+EA+
Sbjct  421  GYYNTRNRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAE  480

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+ AHEQIL+ S+L+ID  S DREMCAFTYLRMNP LFQ DNWRRFV 
Sbjct  481  VPLAGENALPRYDENAHEQILQASSLNIDGNSKDREMCAFTYLRMNPHLFQPDNWRRFVG  540

Query  542  FVKKMKEGK  568
            FVKKM E K
Sbjct  541  FVKKMNEVK  549



>ref|XP_010023784.1| PREDICTED: beta-amylase 1, chloroplastic [Eucalyptus grandis]
 gb|KCW60153.1| hypothetical protein EUGRSUZ_H02879 [Eucalyptus grandis]
Length=584

 Score =   350 bits (899),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 176/187 (94%), Gaps = 1/187 (1%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQMLLDHGERIL SA ++F+NTG KISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  365  YGEFFLSWYSQMLLDHGERILSSAKSVFENTGTKISVKVAGIHWHYGTRSHAPELTAGYY  424

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVALATQ+A+VPL
Sbjct  425  NTRYRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVALATQKAEVPL  484

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SG-DREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            AGENAL RYDDYAHEQILR++ L+ID     D+EMCAFTYLRMNPDLFQADNWRRFVAFV
Sbjct  485  AGENALQRYDDYAHEQILRSALLNIDGYPQEDKEMCAFTYLRMNPDLFQADNWRRFVAFV  544

Query  548  KKMKEGK  568
            KKMKEGK
Sbjct  545  KKMKEGK  551



>ref|XP_009608726.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana tomentosiformis]
Length=565

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYGEFFL+WYSQMLLDHGE ILQS  AIF+  GVKISVK+AGIHWHYGTRSHAPELTAGY
Sbjct  346  PYGEFFLTWYSQMLLDHGEGILQSTKAIFEKKGVKISVKVAGIHWHYGTRSHAPELTAGY  405

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA+CAPEKLVRQVALAT+EAQVP
Sbjct  406  YNTRFRDGYLPIAQMLARHDAIFNFTCIEMRDHEQPQDAECAPEKLVRQVALATREAQVP  465

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRY+++AHEQIL+ S+L+ID  S DR+MCAFTYLRMNPDLF  DNWRRF+AFV
Sbjct  466  LAGENALPRYNEFAHEQILQASSLNIDSQSDDRQMCAFTYLRMNPDLFHPDNWRRFIAFV  525

Query  548  KKMKEGK  568
            KK+ +GK
Sbjct  526  KKLNDGK  532



>ref|XP_011041480.1| PREDICTED: beta-amylase 1, chloroplastic-like [Populus euphratica]
Length=586

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T+PYGEFFL+WYSQMLLDHGERIL SA A F+N GVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  365  TSPYGEFFLTWYSQMLLDHGERILSSAKATFENIGVKISVKIAGIHWHYGTRSHAPELTA  424

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIA+MLARHGAIFNFTCIEMRDHEQPQDA CAPE+LV Q  LAT+EA 
Sbjct  425  GYYNTRFRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPERLVSQGTLATREAD  484

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPR+D+YAHEQIL+ S+L+ID  S D+EMCAFTYLRMNP LFQ DNWRRFVA
Sbjct  485  VPLAGENALPRFDEYAHEQILQASSLNIDGSSDDKEMCAFTYLRMNPHLFQPDNWRRFVA  544

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  545  FVKKMKEGK  553



>gb|AEN82034.1| AT3G23920-like protein, partial [Neslia paniculata]
Length=182

 Score =   334 bits (856),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = +2

Query  14   GEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYYN  193
            GEFFLSWYSQMLLDHGERIL SA +IF++TGVKISVKIAGIHWHYGTRSHAPELTAGYYN
Sbjct  1    GEFFLSWYSQMLLDHGERILSSAKSIFESTGVKISVKIAGIHWHYGTRSHAPELTAGYYN  60

Query  194  TRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLA  373
            TRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+VPLA
Sbjct  61   TRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAEVPLA  120

Query  374  GENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            GENALPRYDDYAHEQIL+ +ALS DE S   +REMCAFTYLRMNP+LFQA+NW +FVAFV
Sbjct  121  GENALPRYDDYAHEQILKATALSFDENSEGENREMCAFTYLRMNPELFQANNWGKFVAFV  180

Query  548  KK  553
            KK
Sbjct  181  KK  182



>ref|XP_007035340.1| Beta-amylase 1 isoform 1 [Theobroma cacao]
 gb|EOY06266.1| Beta-amylase 1 isoform 1 [Theobroma cacao]
Length=652

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQMLLDHGERIL SA ++F+  GVKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  434  YGEFFLSWYSQMLLDHGERILSSATSVFEGAGVKISVKVAGIHWHYGTRSHAPELTAGYY  493

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARHGA+FNFTCIEMRDHEQPQDA CAPEKLVRQVALAT  AQVPL
Sbjct  494  NTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVALATAAAQVPL  553

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD+YAH+QIL+ S+L+ID  S DREMCAFTYLRMNP LFQ +NWRRFVAFVK
Sbjct  554  AGENALPRYDEYAHDQILQASSLNIDGSSDDREMCAFTYLRMNPSLFQPENWRRFVAFVK  613

Query  551  KMKEGK  568
            KM EGK
Sbjct  614  KMNEGK  619



>ref|XP_009343398.1| PREDICTED: beta-amylase 1, chloroplastic-like [Pyrus x bretschneideri]
Length=299

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL WYSQMLLDHGERIL SA +IF+  GVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  79   NTAYGEFFLGWYSQMLLDHGERILTSAKSIFEEAGVKISVKVAGIHWHYGTRSHAPELTA  138

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGAIFNFTC+EMRDHEQPQ+AQC PEKLVRQVA+ATQ+  
Sbjct  139  GYYNTRFRDGYIPIAQMLARHGAIFNFTCVEMRDHEQPQEAQCLPEKLVRQVAMATQKVN  198

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYDDYAHEQIL  S+L+++  +   +MCAFTYLRMNP LFQ DNWRRFVA
Sbjct  199  VPLAGENALPRYDDYAHEQILEASSLNVEGNTQGNQMCAFTYLRMNPHLFQPDNWRRFVA  258

Query  542  FVKKMKE  562
            FVKKMKE
Sbjct  259  FVKKMKE  265



>ref|XP_004296549.1| PREDICTED: beta-amylase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   347 bits (889),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL WYSQMLLDHGERIL SA AI++N GVKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  360  YGEFFLGWYSQMLLDHGERILSSAKAIYENEGVKISVKVAGIHWHYGTRSHAPELTAGYY  419

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQM ARHGAIFNFTCIEM DHEQPQDAQC+PE LVRQVALATQ+A VPL
Sbjct  420  NTRFRDGYLPIAQMFARHGAIFNFTCIEMHDHEQPQDAQCSPEGLVRQVALATQKAGVPL  479

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAHEQIL+ SAL+I   +  ++MCAFTYLRMNP LFQADNWRRFV+FVK
Sbjct  480  AGENALPRYDDYAHEQILQASALNIKGNTEGKQMCAFTYLRMNPQLFQADNWRRFVSFVK  539

Query  551  KMKEGK  568
            KMKEGK
Sbjct  540  KMKEGK  545



>ref|XP_002311706.1| beta-amylase family protein [Populus trichocarpa]
 gb|EEE89073.1| beta-amylase family protein [Populus trichocarpa]
Length=562

 Score =   345 bits (884),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T PYGEFFLSWYSQMLLDH ERIL SA AI++NTGVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  341  TCPYGEFFLSWYSQMLLDHAERILSSAKAIYENTGVKISVKIAGIHWHYGTRSHAPELTA  400

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIAQMLAR+GAIFNFTCIEMRDHEQPQDA CAPEKLVRQVALAT+EA+
Sbjct  401  GYYNTRNRDGYLPIAQMLARYGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAE  460

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+ AHEQIL+ S+L+ID  S D EMCAFTYLRMNP LFQ DNWRRFV 
Sbjct  461  VPLAGENALPRYDENAHEQILQASSLNIDGNSKDSEMCAFTYLRMNPHLFQPDNWRRFVG  520

Query  542  FVKKMKEGK  568
            FVKKM E K
Sbjct  521  FVKKMNEVK  529



>gb|KDO55739.1| hypothetical protein CISIN_1g008030mg [Citrus sinensis]
Length=580

 Score =   345 bits (885),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 172/188 (91%), Gaps = 5/188 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            +PYGEFFLSWYSQMLLDHGERIL SA AIFD TGVKISVK+AGIHWHYG+RSHAPELTAG
Sbjct  365  SPYGEFFLSWYSQMLLDHGERILSSAKAIFDATGVKISVKVAGIHWHYGSRSHAPELTAG  424

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVA ATQ+A V
Sbjct  425  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQKAHV  484

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
            PLAGENALPRYD+YAHEQILR ++L +     D++MCAFTYLRMNP LFQ DNWR+FVAF
Sbjct  485  PLAGENALPRYDEYAHEQILRAASLDV-----DKQMCAFTYLRMNPHLFQPDNWRQFVAF  539

Query  545  VKKMKEGK  568
            VKKM EGK
Sbjct  540  VKKMNEGK  547



>ref|XP_006420416.1| hypothetical protein CICLE_v10004620mg [Citrus clementina]
 gb|ESR33656.1| hypothetical protein CICLE_v10004620mg [Citrus clementina]
Length=580

 Score =   345 bits (885),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 172/188 (91%), Gaps = 5/188 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            +PYGEFFLSWYSQMLLDHGERIL SA AIFD TGVKISVK+AGIHWHYG+RSHAPELTAG
Sbjct  365  SPYGEFFLSWYSQMLLDHGERILSSAKAIFDATGVKISVKVAGIHWHYGSRSHAPELTAG  424

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVA ATQ+A V
Sbjct  425  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQKAHV  484

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
            PLAGENALPRYD+YAHEQILR ++L +     D++MCAFTYLRMNP LFQ DNWR+FVAF
Sbjct  485  PLAGENALPRYDEYAHEQILRAASLDV-----DKQMCAFTYLRMNPHLFQPDNWRQFVAF  539

Query  545  VKKMKEGK  568
            VKKM EGK
Sbjct  540  VKKMNEGK  547



>emb|CAN71375.1| hypothetical protein VITISV_002992 [Vitis vinifera]
Length=570

 Score =   345 bits (884),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 174/189 (92%), Gaps = 2/189 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T+PYGEFFL+WYSQMLLDHGERIL SA +IF + GVKISVK++GIHWHYGT+SHAPELTA
Sbjct  351  TSPYGEFFLNWYSQMLLDHGERILSSAKSIFQDMGVKISVKVSGIHWHYGTQSHAPELTA  410

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGAI NFTCIEMRDHEQPQDA CAPEKLVRQVALAT+EAQ
Sbjct  411  GYYNTRFRDGYIPIAQMLARHGAILNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAQ  470

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+ AHEQIL  S+L+ID    + +MCAFTYLRMNPDLFQ DNWRRFVA
Sbjct  471  VPLAGENALPRYDETAHEQILGASSLNID--GEESDMCAFTYLRMNPDLFQPDNWRRFVA  528

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  529  FVKKMKEGK  537



>ref|XP_002285569.1| PREDICTED: beta-amylase 1, chloroplastic [Vitis vinifera]
Length=573

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 174/189 (92%), Gaps = 2/189 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            T+PYGEFFL+WYSQMLLDHGERIL SA +IF + GVKISVK++GIHWHYGT+SHAPELTA
Sbjct  354  TSPYGEFFLNWYSQMLLDHGERILSSAKSIFQDMGVKISVKVSGIHWHYGTQSHAPELTA  413

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGAI NFTCIEMRDHEQPQDA CAPEKLVRQVALAT+EAQ
Sbjct  414  GYYNTRFRDGYIPIAQMLARHGAILNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAQ  473

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+ AHEQIL  S+L+ID    + +MCAFTYLRMNPDLFQ DNWRRFVA
Sbjct  474  VPLAGENALPRYDETAHEQILGASSLNID--GEESDMCAFTYLRMNPDLFQPDNWRRFVA  531

Query  542  FVKKMKEGK  568
            FVKKMKEGK
Sbjct  532  FVKKMKEGK  540



>gb|KEH26843.1| beta-amylase [Medicago truncatula]
Length=384

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            + YGEFFL+WYSQMLL+HGERIL SA +IFDNTGVKISVK+AGIHWHYGTRSHAPELTAG
Sbjct  165  SEYGEFFLTWYSQMLLNHGERILTSAKSIFDNTGVKISVKVAGIHWHYGTRSHAPELTAG  224

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR RDGYLPIAQM ARH AIFNFTCIEMRDHEQPQDAQC PEKLV QVALATQ+AQV
Sbjct  225  YYNTRNRDGYLPIAQMFARHDAIFNFTCIEMRDHEQPQDAQCLPEKLVNQVALATQKAQV  284

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENALPRYD++AHEQIL+ SAL+I+  S + EMCAFTYLRMN DLFQ DNWR+FVAF
Sbjct  285  HLAGENALPRYDEHAHEQILKASALNIEGSSDETEMCAFTYLRMNQDLFQPDNWRKFVAF  344

Query  545  VKKMKEGK  568
            VKKMKEGK
Sbjct  345  VKKMKEGK  352



>ref|XP_006493994.1| PREDICTED: beta-amylase 1, chloroplastic-like [Citrus sinensis]
Length=580

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 171/188 (91%), Gaps = 5/188 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            +PYGEFFLSWYSQMLLDHGERIL SA +IFD TGVKISVKIAGIHWHYG+RSHAPELTAG
Sbjct  365  SPYGEFFLSWYSQMLLDHGERILASAKSIFDATGVKISVKIAGIHWHYGSRSHAPELTAG  424

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVA ATQ A V
Sbjct  425  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQTAHV  484

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
            PLAGENALPRYD+YAHEQILR ++L +     D++MCAFTYLRMNP LFQ DNWR+FVAF
Sbjct  485  PLAGENALPRYDEYAHEQILRAASLDV-----DKQMCAFTYLRMNPHLFQPDNWRQFVAF  539

Query  545  VKKMKEGK  568
            VKKM EGK
Sbjct  540  VKKMNEGK  547



>ref|XP_006418770.1| hypothetical protein EUTSA_v10002460mg [Eutrema salsugineum]
 gb|ESQ37206.1| hypothetical protein EUTSA_v10002460mg [Eutrema salsugineum]
Length=582

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL+WYSQMLLDHGERIL SA +IF+N GVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  359  NTEYGEFFLTWYSQMLLDHGERILSSAKSIFENRGVKISVKIAGIHWHYGTRSHAPELTA  418

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  419  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  478

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ SALS D+ S   +REMCAFTYLRMNP+LFQADNW +F
Sbjct  479  VPLAGENALPRYDDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFQADNWGKF  538

Query  536  VAFVKKMKEGK  568
            V FVKKM EG+
Sbjct  539  VGFVKKMSEGR  549



>gb|AFQ33614.1| beta-amylase 2 [Citrus trifoliata]
Length=580

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 171/188 (91%), Gaps = 5/188 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            +PYGEFFLSWYSQMLLDHGERIL SA AI D TGVKISVK+AGIHWHYG+RSHAPELTAG
Sbjct  365  SPYGEFFLSWYSQMLLDHGERILSSAKAILDATGVKISVKVAGIHWHYGSRSHAPELTAG  424

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDA CAPEKLV+QVA ATQ+A V
Sbjct  425  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQKAHV  484

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
            PLAGENALPRYD+YAHEQILR ++L +     D++MCAFTYLRMNP LFQ DNWR+FVAF
Sbjct  485  PLAGENALPRYDEYAHEQILRAASLDV-----DKQMCAFTYLRMNPHLFQPDNWRQFVAF  539

Query  545  VKKMKEGK  568
            VKKM EGK
Sbjct  540  VKKMNEGK  547



>ref|XP_010513371.1| PREDICTED: beta-amylase 1, chloroplastic-like [Camelina sativa]
Length=576

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFLSWYSQMLLDHGERIL SA +IF++TGVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  353  NTEYGEFFLSWYSQMLLDHGERILSSAKSIFESTGVKISVKIAGIHWHYGTRSHAPELTA  412

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  413  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  472

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ +ALS D+ S    REMCAFTYLRMNP+LFQA+NW +F
Sbjct  473  VPLAGENALPRYDDYAHEQILKATALSFDQNSEGEKREMCAFTYLRMNPELFQANNWGKF  532

Query  536  VAFVKKMKEGK  568
            VAFVKKM EG+
Sbjct  533  VAFVKKMGEGR  543



>gb|KFK39690.1| hypothetical protein AALP_AA3G276400 [Arabis alpina]
Length=569

 Score =   342 bits (878),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFLSWYSQMLLDHGERIL SA +IF+ TGVKISVKIAGIHWHYG+RSHAPELTA
Sbjct  346  NTEYGEFFLSWYSQMLLDHGERILSSAKSIFETTGVKISVKIAGIHWHYGSRSHAPELTA  405

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  406  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLTAE  465

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ SALS+D+ S   +REMCAFTYLRMNP+LF+ADNW +F
Sbjct  466  VPLAGENALPRYDDYAHEQILKASALSLDQNSEGENREMCAFTYLRMNPELFKADNWGKF  525

Query  536  VAFVKKMKEGK  568
            V FVKKM EG+
Sbjct  526  VGFVKKMGEGR  536



>ref|XP_010488521.1| PREDICTED: beta-amylase 1, chloroplastic-like [Camelina sativa]
Length=575

 Score =   342 bits (878),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFLSWYSQMLLDHGERIL SA +IF++TGVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  352  NTEYGEFFLSWYSQMLLDHGERILSSAKSIFESTGVKISVKIAGIHWHYGTRSHAPELTA  411

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  412  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  471

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ +ALS D+ S    REMCAFTYLRMNP+LFQA+NW +F
Sbjct  472  VPLAGENALPRYDDYAHEQILKATALSFDQNSEGEKREMCAFTYLRMNPELFQANNWGKF  531

Query  536  VAFVKKMKEGK  568
            VAFVKKM EG+
Sbjct  532  VAFVKKMGEGR  542



>ref|XP_011073736.1| PREDICTED: beta-amylase 1, chloroplastic-like [Sesamum indicum]
Length=583

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYG+FFLSWYSQMLL+HGERILQSA  IF N  VK+S KIAGIHWHYGTRSHAPELTA
Sbjct  362  NSPYGQFFLSWYSQMLLNHGERILQSAKTIFKNKSVKLSAKIAGIHWHYGTRSHAPELTA  421

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY PIAQMLAR+GAIFNFTCIEMRDHEQPQDA CAPEKLVRQVALATQEA 
Sbjct  422  GYYNTRFRDGYRPIAQMLARNGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAG  481

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD  AHEQIL+ SAL+++  S  REMCAFTYLRMNPDLFQ DNWRRFV 
Sbjct  482  VPLAGENALPRYDGCAHEQILQASALNVEGNSTGREMCAFTYLRMNPDLFQPDNWRRFVD  541

Query  542  FVKKMKEGK  568
            FVKKM+EGK
Sbjct  542  FVKKMREGK  550



>ref|XP_006296695.1| hypothetical protein CARUB_v10013332mg [Capsella rubella]
 gb|EOA29593.1| hypothetical protein CARUB_v10013332mg [Capsella rubella]
Length=573

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFLSWYSQMLLDHGERIL SA +IF++TGVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  350  NTEYGEFFLSWYSQMLLDHGERILSSAKSIFESTGVKISVKIAGIHWHYGTRSHAPELTA  409

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A 
Sbjct  410  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAD  469

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ SALS D+ S   ++EMCAFTYLRMNP+LFQA+NW +F
Sbjct  470  VPLAGENALPRYDDYAHEQILKASALSFDQNSEGKNQEMCAFTYLRMNPELFQANNWGKF  529

Query  536  VAFVKKMKEGK  568
            VAFVKKM EG+
Sbjct  530  VAFVKKMGEGR  540



>ref|XP_002885629.1| beta-amylase 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61888.1| beta-amylase 7 [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFLSWYSQMLLDHGERIL SA +IF+NTGVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  349  NTEYGDFFLSWYSQMLLDHGERILSSAKSIFENTGVKISVKIAGIHWHYGTRSHAPELTA  408

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  409  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  468

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD--REMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ S L++D+ +    REMCAFTYLRMNP+LFQADNW +F
Sbjct  469  VPLAGENALPRYDDYAHEQILKASVLNLDQNNQGEPREMCAFTYLRMNPELFQADNWGKF  528

Query  536  VAFVKKMKEGK  568
            VAFVKKM EG+
Sbjct  529  VAFVKKMVEGR  539



>gb|EYU43789.1| hypothetical protein MIMGU_mgv1a010885mg [Erythranthe guttata]
Length=298

 Score =   332 bits (850),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 169/187 (90%), Gaps = 4/187 (2%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQMLLDHGERIL+SA+ IF N  VKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  82   YGEFFLSWYSQMLLDHGERILKSASGIFRNEAVKISVKVAGIHWHYGTRSHAPELTAGYY  141

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIA+ML RH A+FNFTCIEMRDHEQPQDA CAPEKLVRQVA+A QEA+VPL
Sbjct  142  NTRFRDGYLPIARMLGRHNAVFNFTCIEMRDHEQPQDALCAPEKLVRQVAMAAQEARVPL  201

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDR-EMCAFTYLRMNPDLFQADNWRRFVAFV  547
            AGENALPRYD+ AHEQILR SAL +D   GD  EMCAFTYLRMNPDLF  +NWRRFV+FV
Sbjct  202  AGENALPRYDETAHEQILRASALEVD---GDSVEMCAFTYLRMNPDLFHPENWRRFVSFV  258

Query  548  KKMKEGK  568
            KKM+EG+
Sbjct  259  KKMREGR  265



>ref|XP_009102529.1| PREDICTED: beta-amylase 1, chloroplastic [Brassica rapa]
Length=570

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL+WYSQMLLDHGERIL SA +IF +TGVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  347  NTEYGEFFLTWYSQMLLDHGERILSSAKSIFQDTGVKISVKVAGIHWHYGTRSHAPELTA  406

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  407  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  466

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ SALS D+ S   +REMCAFTYLRMNP+LF+ADNW +F
Sbjct  467  VPLAGENALPRYDDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFKADNWGKF  526

Query  536  VAFVKKMKEGK  568
            V FVKKM EG+
Sbjct  527  VGFVKKMGEGR  537



>emb|CDX77441.1| BnaA07g05790D [Brassica napus]
Length=570

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL+WYSQMLLDHGERIL SA +IF +TGVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  347  NTEYGEFFLTWYSQMLLDHGERILSSAKSIFQDTGVKISVKVAGIHWHYGTRSHAPELTA  406

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  407  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  466

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ SALS D+ S   +REMCAFTYLRMNP+LF+ADNW +F
Sbjct  467  VPLAGENALPRYDDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFKADNWGKF  526

Query  536  VAFVKKMKEGK  568
            V FVKKM EG+
Sbjct  527  VGFVKKMGEGR  537



>gb|KJB34580.1| hypothetical protein B456_006G073600 [Gossypium raimondii]
Length=589

 Score =   340 bits (873),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQ+L++HGERIL SA+++F+ TGVKISVK+AGIHWHYG+RSHA ELTAGYY
Sbjct  371  YGEFFLSWYSQILIEHGERILSSASSVFEATGVKISVKVAGIHWHYGSRSHAAELTAGYY  430

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLP+AQM+AR+GA+FNFTCIEMRDHEQPQDA CAPE LVRQV LAT+EAQVPL
Sbjct  431  NTRFRDGYLPVAQMVARYGAVFNFTCIEMRDHEQPQDALCAPENLVRQVGLATKEAQVPL  490

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD+ AHEQIL+ S+L+ID  S DREMCAFTYLRMNP LFQ DNWRRFVAFVK
Sbjct  491  AGENALPRYDESAHEQILKASSLNIDGSSNDREMCAFTYLRMNPSLFQPDNWRRFVAFVK  550

Query  551  KMKEGK  568
            KM EGK
Sbjct  551  KMNEGK  556



>gb|AEN82029.1| AT3G23920-like protein, partial [Capsella rubella]
 gb|AEN82030.1| AT3G23920-like protein, partial [Capsella rubella]
 gb|AEN82031.1| AT3G23920-like protein, partial [Capsella rubella]
 gb|AEN82032.1| AT3G23920-like protein, partial [Capsella rubella]
 gb|AEN82033.1| AT3G23920-like protein, partial [Capsella rubella]
Length=182

 Score =   326 bits (835),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 166/182 (91%), Gaps = 2/182 (1%)
 Frame = +2

Query  14   GEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYYN  193
            GEFFLSWYSQMLLDHGERIL  A +IF++TGVKISVKIAGIHWHYGTRSHAPELTAGYYN
Sbjct  1    GEFFLSWYSQMLLDHGERILSPAKSIFESTGVKISVKIAGIHWHYGTRSHAPELTAGYYN  60

Query  194  TRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLA  373
            TRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A VPLA
Sbjct  61   TRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAADVPLA  120

Query  374  GENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            GENALPRYDDYAHEQIL+ SAL+ D+ S   +++MCAFTYLRMNP+LFQA+NW +FVAFV
Sbjct  121  GENALPRYDDYAHEQILKASALNFDQNSEGKNQDMCAFTYLRMNPELFQANNWGKFVAFV  180

Query  548  KK  553
            KK
Sbjct  181  KK  182



>ref|XP_010466824.1| PREDICTED: beta-amylase 1, chloroplastic isoform X2 [Camelina 
sativa]
Length=575

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 173/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFLSWYSQMLLDHGERIL SA +IF++TGVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  352  NTEYGEFFLSWYSQMLLDHGERILSSAKSIFESTGVKISVKVAGIHWHYGTRSHAPELTA  411

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  412  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  471

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ +ALS D+ S   +REMCAFTYLRMNP+LFQA+NW +F
Sbjct  472  VPLAGENALPRYDDYAHEQILKATALSFDQNSEGENREMCAFTYLRMNPELFQANNWGKF  531

Query  536  VAFVKKMKEGK  568
            VAFVKKM E +
Sbjct  532  VAFVKKMGEXR  542



>ref|NP_189034.1| beta-amylase 1 [Arabidopsis thaliana]
 sp|Q9LIR6.1|BAM1_ARATH RecName: Full=Beta-amylase 1, chloroplastic; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 
7; AltName: Full=Thioredoxin-regulated beta-amylase; Short=TR-BAMY; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56281.1|AF367293_1 AT3g23920/F14O13_11 [Arabidopsis thaliana]
 dbj|BAB03009.1| beta-amylase [Arabidopsis thaliana]
 gb|AAL67089.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AAL77747.1| AT3g23920/F14O13_11 [Arabidopsis thaliana]
 gb|AAM20167.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AEE76832.1| beta-amylase 1 [Arabidopsis thaliana]
Length=575

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 174/188 (93%), Gaps = 2/188 (1%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFLSWYSQMLLDHGERIL SA +IF+N GVKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  355  YGDFFLSWYSQMLLDHGERILSSAKSIFENMGVKISVKIAGIHWHYGTRSHAPELTAGYY  414

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+VPL
Sbjct  415  NTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAEVPL  474

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*S-GD-REMCAFTYLRMNPDLFQADNWRRFVAF  544
            AGENALPRYDDYAHEQIL+ SAL++D+ + G+ REMCAFTYLRMNP+LFQADNW +FVAF
Sbjct  475  AGENALPRYDDYAHEQILKASALNLDQNNEGEPREMCAFTYLRMNPELFQADNWGKFVAF  534

Query  545  VKKMKEGK  568
            VKKM EG+
Sbjct  535  VKKMGEGR  542



>ref|XP_010466823.1| PREDICTED: beta-amylase 1, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010466825.1| PREDICTED: beta-amylase 1, chloroplastic isoform X3 [Camelina 
sativa]
Length=575

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFLSWYSQMLLDHGERIL SA +IF++TGVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  352  NTEYGEFFLSWYSQMLLDHGERILSSAKSIFESTGVKISVKVAGIHWHYGTRSHAPELTA  411

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  412  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  471

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ +ALS D+ S   +REMCAFTYLRMNP+LFQA+NW +F
Sbjct  472  VPLAGENALPRYDDYAHEQILKATALSFDQNSEGENREMCAFTYLRMNPELFQANNWGKF  531

Query  536  VAFVKKMKE  562
            VAFVKKM E
Sbjct  532  VAFVKKMGE  540



>ref|XP_008438436.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis melo]
Length=577

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLLDHGERIL +A + F+NTGVKISVKIAGIHWHYG RSHAPELTAGYY
Sbjct  359  YGEFFLTWYSQMLLDHGERILTAATSTFENTGVKISVKIAGIHWHYGHRSHAPELTAGYY  418

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGYLPIA+MLARHGAIFNFTCIEMRDHEQPQDA CAPEKLVRQVA AT +AQVPL
Sbjct  419  NTRYRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAQATHKAQVPL  478

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD++AHEQIL+ S+   DE S + EMCAFTYLRMNP LF+A+NWRRFVAFVK
Sbjct  479  AGENALPRYDEFAHEQILQASSFIGDEDSEESEMCAFTYLRMNPHLFEAENWRRFVAFVK  538

Query  551  KMKEGK  568
            KMKEGK
Sbjct  539  KMKEGK  544



>gb|AAL37169.1|AF319168_1 putative chloroplast-targeted beta-amylase [Brassica napus]
Length=569

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL+WYSQMLLDHGERIL SA +IF +TGVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  346  NTEYGDFFLTWYSQMLLDHGERILSSAKSIFQDTGVKISVKVAGIHWHYGTRSHAPELTA  405

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  406  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  465

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRY+DYAHEQIL+ SALS D+ S   +REMCAFTYLRMNP+LF+ADNW +F
Sbjct  466  VPLAGENALPRYEDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFKADNWGKF  525

Query  536  VAFVKKMKEGK  568
            V FVKKM EG+
Sbjct  526  VGFVKKMGEGR  536



>ref|XP_007223114.1| hypothetical protein PRUPE_ppa005431mg [Prunus persica]
 gb|EMJ24313.1| hypothetical protein PRUPE_ppa005431mg [Prunus persica]
Length=461

 Score =   333 bits (855),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YGEFFL WYSQMLLDHGERIL SA +IF+N GVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  242  NSTYGEFFLGWYSQMLLDHGERILTSAKSIFENHGVKISVKIAGIHWHYGTRSHAPELTA  301

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGAIFNFTCIEMRDHEQPQ+AQC PEKLVRQVA+AT +A 
Sbjct  302  GYYNTRFRDGYIPIAQMLARHGAIFNFTCIEMRDHEQPQEAQCLPEKLVRQVAMATLKAN  361

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYDDYAH+QIL  S+L+I+  +   +MCAFTYLRMNP LFQ DNWR FVA
Sbjct  362  VPLAGENALPRYDDYAHKQILEASSLNIEGNTEGNQMCAFTYLRMNPHLFQPDNWRHFVA  421

Query  542  FVKKMKE  562
            FVKKMKE
Sbjct  422  FVKKMKE  428



>ref|XP_004515248.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cicer arietinum]
Length=573

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLL+HGERIL SA +IFDNTGVKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  356  YGEFFLTWYSQMLLNHGERILTSAKSIFDNTGVKISVKVAGIHWHYGTRSHAPELTAGYY  415

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIAQMLARH A+FNFTCIEMRDHEQPQDA CAPEKLV+QVALATQ+A+V L
Sbjct  416  NTRNRDGYLPIAQMLARHNAVFNFTCIEMRDHEQPQDALCAPEKLVKQVALATQKAKVHL  475

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD++AHEQIL+ S L+++  S D EMCAFTYLRMN +LFQ DNWR+FV+FVK
Sbjct  476  AGENALPRYDEHAHEQILKASQLNVEGNSDDAEMCAFTYLRMNQELFQPDNWRKFVSFVK  535

Query  551  KMKEGK  568
            KMKEGK
Sbjct  536  KMKEGK  541



>emb|CDY45566.1| BnaC09g21440D [Brassica napus]
Length=564

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 171/191 (90%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL+WYSQMLLDHGERIL SA +IF +T VKISVKIAGIHWHYGTRSHAPELTA
Sbjct  341  NTEYGEFFLTWYSQMLLDHGERILSSAKSIFQDTSVKISVKIAGIHWHYGTRSHAPELTA  400

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH AIFNFTCIEMRDHEQPQDA CAPEKLV QVALAT  A+
Sbjct  401  GYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAE  460

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDD+AHEQIL+ SALS D+ S   +REMCAFTYLRMNP+LF+ADNW +F
Sbjct  461  VPLAGENALPRYDDHAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFKADNWGKF  520

Query  536  VAFVKKMKEGK  568
            V FVKKM EG+
Sbjct  521  VGFVKKMGEGR  531



>ref|XP_004166730.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
Length=577

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLLDHG+RIL +A +IF+ TGVKISVKIAGIHWHYG RSHAPELTAGYY
Sbjct  359  YGEFFLTWYSQMLLDHGDRILTAATSIFEKTGVKISVKIAGIHWHYGHRSHAPELTAGYY  418

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGYLPIA+MLARHGAIFNFTCIEMRDHEQPQDA CAPEKLVRQVA AT +AQVPL
Sbjct  419  NTRYRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAQATHKAQVPL  478

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD++AHEQIL+ S+   DE S + EMCAFTYLRMNP LF+A+NWRRFVAFVK
Sbjct  479  AGENALPRYDEFAHEQILQASSFVGDEDSKESEMCAFTYLRMNPHLFEAENWRRFVAFVK  538

Query  551  KMKEGK  568
            KMKEGK
Sbjct  539  KMKEGK  544



>ref|XP_004134029.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
 gb|KGN56795.1| hypothetical protein Csa_3G133950 [Cucumis sativus]
Length=577

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL+WYSQMLLDHG+RIL +A +IF+ TGVKISVKIAGIHWHYG RSHAPELTAGYY
Sbjct  359  YGEFFLTWYSQMLLDHGDRILTAATSIFEKTGVKISVKIAGIHWHYGHRSHAPELTAGYY  418

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGYLPIA+MLARHGAIFNFTCIEMRDHEQPQDA CAPEKLVRQVA AT +AQVPL
Sbjct  419  NTRYRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAQATHKAQVPL  478

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD++AHEQIL+ S+   DE S + EMCAFTYLRMNP LF+A+NWRRFVAFVK
Sbjct  479  AGENALPRYDEFAHEQILQASSFVGDEDSKESEMCAFTYLRMNPHLFEAENWRRFVAFVK  538

Query  551  KMKEGK  568
            KMKEGK
Sbjct  539  KMKEGK  544



>ref|XP_008391283.1| PREDICTED: beta-amylase 1, chloroplastic-like [Malus domestica]
Length=571

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL WYSQMLLDHGERIL SA +IF+  GVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  351  NTTYGEFFLGWYSQMLLDHGERILTSAKSIFEEAGVKISVKVAGIHWHYGTRSHAPELTA  410

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGAIFNFTC+EMRDHEQPQ+AQC PEKLVRQVA+ATQ+  
Sbjct  411  GYYNTRFRDGYIPIAQMLARHGAIFNFTCVEMRDHEQPQEAQCLPEKLVRQVAMATQKVN  470

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYDDYAH QIL  S+L+++  +   +MCAFTYLRMNP LFQ DNWRRFVA
Sbjct  471  VPLAGENALPRYDDYAHXQILEASSLNVEGNTQGNQMCAFTYLRMNPHLFQPDNWRRFVA  530

Query  542  FVKKMKE  562
            FVKKMKE
Sbjct  531  FVKKMKE  537



>ref|XP_009350111.1| PREDICTED: beta-amylase 1, chloroplastic [Pyrus x bretschneideri]
Length=571

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL WYSQMLLDHGERIL SA +IF+  GVKISVK+AGIHWHYGTRSHAPELTA
Sbjct  351  NTAYGEFFLGWYSQMLLDHGERILTSAKSIFEEAGVKISVKVAGIHWHYGTRSHAPELTA  410

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGAIFNFTC+EMRD EQPQ+AQC PEKLVRQVA+ATQ+  
Sbjct  411  GYYNTRFRDGYIPIAQMLARHGAIFNFTCVEMRDQEQPQEAQCLPEKLVRQVAMATQKVN  470

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYDDYAHEQIL  S+L+++  +   +MCAFTYLRMNP LFQ DNWRRFVA
Sbjct  471  VPLAGENALPRYDDYAHEQILEASSLNVEGNTQGNQMCAFTYLRMNPHLFQPDNWRRFVA  530

Query  542  FVKKMKE  562
            FVKKMKE
Sbjct  531  FVKKMKE  537



>ref|XP_010263970.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X2 [Nelumbo 
nucifera]
Length=568

 Score =   335 bits (858),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYGEFFL+WYSQ+LLDH E +L SA++IF  TGVKISVKIAGIHWHYG+RSHAPELTA
Sbjct  345  NSPYGEFFLTWYSQLLLDHCEMMLSSADSIFQGTGVKISVKIAGIHWHYGSRSHAPELTA  404

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIA++LARHGAIFNFTCIEMRD+EQPQDA+CAPEKLVRQVALAT EA 
Sbjct  405  GYYNTRFRDGYLPIARLLARHGAIFNFTCIEMRDYEQPQDARCAPEKLVRQVALATLEAG  464

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE--*SGDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYD+ AHEQILR ++L +D+   S  REMCAFTYLRM+PDLFQADNW RF
Sbjct  465  VPLAGENALPRYDEMAHEQILRAASLDLDDGNDSDGREMCAFTYLRMSPDLFQADNWTRF  524

Query  536  VAFVKKMKEGK  568
            VAFVKKMKEGK
Sbjct  525  VAFVKKMKEGK  535



>ref|XP_010263969.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=576

 Score =   335 bits (859),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYGEFFL+WYSQ+LLDH E +L SA++IF  TGVKISVKIAGIHWHYG+RSHAPELTA
Sbjct  353  NSPYGEFFLTWYSQLLLDHCEMMLSSADSIFQGTGVKISVKIAGIHWHYGSRSHAPELTA  412

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIA++LARHGAIFNFTCIEMRD+EQPQDA+CAPEKLVRQVALAT EA 
Sbjct  413  GYYNTRFRDGYLPIARLLARHGAIFNFTCIEMRDYEQPQDARCAPEKLVRQVALATLEAG  472

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE--*SGDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYD+ AHEQILR ++L +D+   S  REMCAFTYLRM+PDLFQADNW RF
Sbjct  473  VPLAGENALPRYDEMAHEQILRAASLDLDDGNDSDGREMCAFTYLRMSPDLFQADNWTRF  532

Query  536  VAFVKKMKEGK  568
            VAFVKKMKEGK
Sbjct  533  VAFVKKMKEGK  543



>emb|CDX94831.1| BnaC03g43570D [Brassica napus]
Length=545

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL+WYSQMLL+HGERIL SA +IF+NT VK+S K+AGIHWHYGTRSHAPELTA
Sbjct  322  NTEYGEFFLTWYSQMLLNHGERILSSAKSIFENTDVKLSAKVAGIHWHYGTRSHAPELTA  381

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIAQMLARH A+FNFTCIEMRDHEQPQDA CAPE+LV QVALAT  A+
Sbjct  382  GYYNTRLRDGYLPIAQMLARHSAVFNFTCIEMRDHEQPQDALCAPEQLVNQVALATLAAE  441

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQI++ SALS D+ S  G+REMCAFTYLRMNP+LF+A+NWRRF
Sbjct  442  VPLAGENALPRYDDYAHEQIVKASALSFDQDSEGGNREMCAFTYLRMNPELFKAENWRRF  501

Query  536  VAFVKKMKEGK  568
            V FVKKM EG+
Sbjct  502  VWFVKKMGEGR  512



>ref|XP_008342553.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 1, chloroplastic 
[Malus domestica]
Length=571

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFL WYSQMLLDHGERIL SA +IF+  GVKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  354  YGEFFLGWYSQMLLDHGERILTSAKSIFEEAGVKISVKVAGIHWHYGTRSHAPELTAGYY  413

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGY+PIAQMLARHGAIFNFTC+EM DHEQPQDAQC PEKLVRQVA+ATQ+  VPL
Sbjct  414  NTRFRDGYVPIAQMLARHGAIFNFTCVEMHDHEQPQDAQCLPEKLVRQVAMATQKTNVPL  473

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAH+QIL  S+L ++  +   +MCAFTYLRMNP LFQ DNWRRFV FVK
Sbjct  474  AGENALPRYDDYAHKQILEASSLKVEGNTEGNQMCAFTYLRMNPHLFQPDNWRRFVGFVK  533

Query  551  KMKE  562
            KMKE
Sbjct  534  KMKE  537



>gb|KHN24537.1| Beta-amylase 1, chloroplastic [Glycine soja]
Length=422

 Score =   328 bits (840),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 168/187 (90%), Gaps = 6/187 (3%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYGEFFL+WYSQMLLDHG+RIL SA +IFDNTGVKISVK+AGIHWHYG+RSHAPELTAGY
Sbjct  210  PYGEFFLTWYSQMLLDHGDRILSSATSIFDNTGVKISVKVAGIHWHYGSRSHAPELTAGY  269

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGY+PIAQMLARHGAIFNFTC+       PQDA CAPEKLV+QVALATQ+AQVP
Sbjct  270  YNTRFRDGYIPIAQMLARHGAIFNFTCM------LPQDALCAPEKLVKQVALATQKAQVP  323

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD+YAHEQI+R S L +D  SG REMCAFTYLRMNP LF+ +NWR+FV FV
Sbjct  324  LAGENALPRYDEYAHEQIIRASQLDVDGDSGGREMCAFTYLRMNPHLFEPNNWRKFVGFV  383

Query  548  KKMKEGK  568
            KKMKEGK
Sbjct  384  KKMKEGK  390



>ref|XP_008224054.1| PREDICTED: beta-amylase 1, chloroplastic [Prunus mume]
Length=569

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQMLLDHGERIL SA +IF+N  VKISVKIAGIHWHYGTRSHAPELTAGYY
Sbjct  353  YGEFFLSWYSQMLLDHGERILTSAKSIFENHSVKISVKIAGIHWHYGTRSHAPELTAGYY  412

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGY+PIAQMLAR GAIFNFTCIEMRDHEQPQ+AQC PEKLVRQVA+AT +A VPL
Sbjct  413  NTRFRDGYIPIAQMLARKGAIFNFTCIEMRDHEQPQEAQCLPEKLVRQVAMATLKANVPL  472

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYDDYAH+QIL  S+L+I+  +   +MCAFTYLRMNP LFQ DNWR FVAFVK
Sbjct  473  AGENALPRYDDYAHKQILEASSLNIEGNTEGNQMCAFTYLRMNPHLFQPDNWRHFVAFVK  532

Query  551  KMKE  562
            KMKE
Sbjct  533  KMKE  536



>ref|XP_010264799.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nelumbo nucifera]
Length=594

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYGEFFL+WYSQMLLDHGE IL SA +IF  TGVKIS K+AGIHWHYGTRSHA ELTA
Sbjct  372  NSPYGEFFLTWYSQMLLDHGEAILSSAKSIFXGTGVKISAKVAGIHWHYGTRSHAAELTA  431

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIA+MLARHG IFNFTCIEMRD+EQPQDAQCAPEKLVRQV LAT+EA 
Sbjct  432  GYYNTRFRDGYLPIARMLARHGTIFNFTCIEMRDYEQPQDAQCAPEKLVRQVVLATREAG  491

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD-REMCAFTYLRMNPDLFQADNWRRFV  538
            VPLAGENALPRYD+ AH QIL  ++L++++   D REMCAFTYLRMNP+LFQADNWR+FV
Sbjct  492  VPLAGENALPRYDEMAHLQILHAASLNLNDGKDDGREMCAFTYLRMNPNLFQADNWRKFV  551

Query  539  AFVKKMKEGK  568
            AFVKKM EGK
Sbjct  552  AFVKKMNEGK  561



>ref|XP_009135884.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brassica rapa]
Length=564

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL+WYSQMLLDHGERIL SA +IF++T VKIS K+AGIHWHYGTRSHAPELTA
Sbjct  341  NTEYGEFFLTWYSQMLLDHGERILSSAKSIFESTSVKISAKVAGIHWHYGTRSHAPELTA  400

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLARH A+FNFTCIEMRDHEQPQDA CAPE+LV QVALAT  ++
Sbjct  401  GYYNTRFRDGYLPIAQMLARHKAVFNFTCIEMRDHEQPQDALCAPEQLVNQVALATLASE  460

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ SAL  D  +    REMCAFTYLRMNP+LF+A+NW RF
Sbjct  461  VPLAGENALPRYDDYAHEQILKASALIFDRNNEGESREMCAFTYLRMNPELFRAENWGRF  520

Query  536  VAFVKKMKEGK  568
            V FVK+M EG+
Sbjct  521  VGFVKRMGEGR  531



>gb|EPS66628.1| beta-amylase 1, chloroplastic [Genlisea aurea]
Length=580

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQ LLDHGERIL+S+NA F NTGVKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  363  YGEFFLSWYSQSLLDHGERILRSSNAAFGNTGVKISVKVAGIHWHYGTRSHAPELTAGYY  422

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGY P+A+ML+RHGA+ NFTCIEMRDHEQPQDAQCAPEKLVRQVALA Q+AQVPL
Sbjct  423  NTRLRDGYAPVAEMLSRHGAVLNFTCIEMRDHEQPQDAQCAPEKLVRQVALAAQKAQVPL  482

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPR+D+YAH QILR++A  ++  S  ++MCAFTYLRMNPDLFQ +NW +FV FV 
Sbjct  483  AGENALPRFDEYAHGQILRSAAPVVEGNSEGKKMCAFTYLRMNPDLFQPENWSKFVCFVN  542

Query  551  KMKE  562
            +M E
Sbjct  543  RMGE  546



>emb|CDX93004.1| BnaA03g37260D [Brassica napus]
Length=555

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFL+WYSQMLL+HGERIL SA +IF NTGVK+S K+AGIHWHYGTRSHAPELTA
Sbjct  332  NTEYGEFFLTWYSQMLLNHGERILSSAKSIFQNTGVKLSAKVAGIHWHYGTRSHAPELTA  391

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFR+GYLPIAQMLAR+ A+FNFTCIEMRDHEQPQDA CAPE+LV QVALAT  ++
Sbjct  392  GYYNTRFRNGYLPIAQMLARYNAVFNFTCIEMRDHEQPQDALCAPEQLVNQVALATLASE  451

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*S--GDREMCAFTYLRMNPDLFQADNWRRF  535
            VPLAGENALPRYDDYAHEQIL+ SAL  D  +    REMCAFTYLRMNP+LF+A+NW RF
Sbjct  452  VPLAGENALPRYDDYAHEQILKASALIFDRNNEGESREMCAFTYLRMNPELFRAENWGRF  511

Query  536  VAFVKKMKEGK  568
            V FVK+M EG+
Sbjct  512  VGFVKRMGEGR  522



>gb|EPS61951.1| beta-amylase [Genlisea aurea]
Length=560

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 163/185 (88%), Gaps = 8/185 (4%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQMLLDHG+RILQSA A+++N  VKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  350  YGEFFLSWYSQMLLDHGDRILQSAMALYENRAVKISVKVAGIHWHYGTRSHAPELTAGYY  409

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIA+ML+RHGA+FNFTCIEM+D+EQPQDA CAPEKLV+QV  A + A VPL
Sbjct  410  NTRFRDGYLPIAKMLSRHGAVFNFTCIEMKDNEQPQDALCAPEKLVKQVGEACRRANVPL  469

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENALPRYD  AH+QILRT+AL         EMCAFTYLRMNPDLFQ +NWRRFVAFVK
Sbjct  470  AGENALPRYDGGAHDQILRTAALD--------EMCAFTYLRMNPDLFQPENWRRFVAFVK  521

Query  551  KMKEG  565
            +M EG
Sbjct  522  RMGEG  526



>ref|XP_004164889.1| PREDICTED: beta-amylase 1, chloroplastic-like, partial [Cucumis 
sativus]
Length=363

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 10/189 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YGEFFLSWYSQ+LLDHG+ IL  A++IF  + VKISVKIAGIHWHYGTRSHAPELTA
Sbjct  154  NSTYGEFFLSWYSQILLDHGDAILSHASSIFKPSSVKISVKIAGIHWHYGTRSHAPELTA  213

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+RDGY PIA+MLARHGAIFNFTCIEM DHEQPQ+AQC+PEKLVRQV LATQ+A 
Sbjct  214  GYYNTRYRDGYTPIARMLARHGAIFNFTCIEMHDHEQPQNAQCSPEKLVRQVKLATQKAH  273

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+YA+EQI+R S          REMCAFTYLRMN  LF+ +NWRRFV 
Sbjct  274  VPLAGENALPRYDEYAYEQIVRAS----------REMCAFTYLRMNTQLFEEENWRRFVG  323

Query  542  FVKKMKEGK  568
            FV+KMKEGK
Sbjct  324  FVQKMKEGK  332



>ref|XP_008460711.1| PREDICTED: beta-amylase 1, chloroplastic [Cucumis melo]
Length=545

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 162/189 (86%), Gaps = 10/189 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YGEFFLSWYSQ+LLDHG+ IL  A++IF  + VKISVKIAGIHWHYGTRSHAPELTA
Sbjct  336  NSTYGEFFLSWYSQILLDHGDSILSHASSIFKPSSVKISVKIAGIHWHYGTRSHAPELTA  395

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+RDGY PIAQMLARHGAIFNFTCIEM DHEQPQDAQC+PEKLVRQV LATQ+AQ
Sbjct  396  GYYNTRYRDGYTPIAQMLARHGAIFNFTCIEMHDHEQPQDAQCSPEKLVRQVKLATQKAQ  455

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENAL RYD+YA+EQI+R S          REMCAFTYLRMN  LF+ +NWRRFV 
Sbjct  456  VPLAGENALSRYDEYAYEQIVRAS----------REMCAFTYLRMNTQLFEEENWRRFVG  505

Query  542  FVKKMKEGK  568
            FV+KMKEGK
Sbjct  506  FVQKMKEGK  514



>ref|XP_004147196.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
 gb|KGN61543.1| hypothetical protein Csa_2G167190 [Cucumis sativus]
Length=545

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 10/189 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YGEFFLSWYSQ+LLDHG+ IL  A++IF  + VKISVKIAGIHWHYGTRSHAPELTA
Sbjct  336  NSTYGEFFLSWYSQILLDHGDAILSHASSIFKPSSVKISVKIAGIHWHYGTRSHAPELTA  395

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+RDGY PIA+MLARHGAIFNFTCIEM DHEQPQ+AQC+PEKLVRQV LATQ+A 
Sbjct  396  GYYNTRYRDGYTPIARMLARHGAIFNFTCIEMHDHEQPQNAQCSPEKLVRQVKLATQKAH  455

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+YA+EQI+R S          REMCAFTYLRMN  LF+ +NWRRFV 
Sbjct  456  VPLAGENALPRYDEYAYEQIVRAS----------REMCAFTYLRMNTQLFEEENWRRFVG  505

Query  542  FVKKMKEGK  568
            FV+KMKEGK
Sbjct  506  FVQKMKEGK  514



>ref|XP_010111574.1| Beta-amylase 1 [Morus notabilis]
 gb|EXC31281.1| Beta-amylase 1 [Morus notabilis]
Length=604

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 3/192 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYGEFFL+WYSQML+ HGERIL SA ++F+NTGVKISVKIAGIHWHYGTRSHAPELTA
Sbjct  381  NSPYGEFFLTWYSQMLIGHGERILTSAKSVFENTGVKISVKIAGIHWHYGTRSHAPELTA  440

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQD---AQCAPEKLVRQVALATQ  352
            GYYNTR RDGYLPIAQML+RHGA+FNFTCIEMRD+EQ  D   A C+PE LVRQVALAT+
Sbjct  441  GYYNTRSRDGYLPIAQMLSRHGAVFNFTCIEMRDYEQQGDYPGALCSPENLVRQVALATK  500

Query  353  EAQVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRR  532
            +AQVPLAGENAL RYD  A+EQIL+ S+L+ +  SG+ EMCAFTYLRMN +LF+ +N  R
Sbjct  501  KAQVPLAGENALERYDKDAYEQILQASSLNFEGASGEEEMCAFTYLRMNKELFKEENILR  560

Query  533  FVAFVKKMKEGK  568
            F+AFVKKMKEGK
Sbjct  561  FMAFVKKMKEGK  572



>ref|XP_010550849.1| PREDICTED: beta-amylase 1, chloroplastic [Tarenaya hassleriana]
Length=591

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YGEFFLSWYSQMLLDHGERIL SA ++F+NT  KISVKIAGIHWHYG+RSHAPELTA
Sbjct  362  NTEYGEFFLSWYSQMLLDHGERILSSAKSVFENTSTKISVKIAGIHWHYGSRSHAPELTA  421

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGY+PIAQMLARHGA+FNFTCIEMRDHEQPQDA CAPEKLV+QVA+AT+EA+
Sbjct  422  GYYNTRFRDGYIPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVKQVAMATREAE  481

Query  362  VPLAGENALPRYDDYAHEQILRTSALSI--DE*SGDREMCAFTYLRMNPD  505
            V LAGENALPRYD+YAHEQIL+ SALS+  D+  G++EMCAFTYLRMNPD
Sbjct  482  VALAGENALPRYDEYAHEQILKASALSLDGDKNGGNKEMCAFTYLRMNPD  531



>ref|XP_006851336.1| hypothetical protein AMTR_s00050p00205080 [Amborella trichopoda]
 gb|ERN12917.1| hypothetical protein AMTR_s00050p00205080 [Amborella trichopoda]
Length=587

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 161/189 (85%), Gaps = 4/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            ++PYGEFFLSWYSQMLLDHGE IL +A  IFD +G K+S K+AGIHWHYGTRSHAPELTA
Sbjct  369  SSPYGEFFLSWYSQMLLDHGELILTAAETIFDGSGAKLSGKVAGIHWHYGTRSHAPELTA  428

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIA++ ARHG +FNFTCIEM+D+EQPQDAQC+PE+LV QV LAT+EA+
Sbjct  429  GYYNTRFRDGYLPIARLFARHGVVFNFTCIEMKDYEQPQDAQCSPERLVHQVVLATREAK  488

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            VPLAGENALPRYD+ A  QIL  S+L   E      MCAFTYLRM+PDLF+ +NWR FVA
Sbjct  489  VPLAGENALPRYDEGALNQILNASSLEGSE----EAMCAFTYLRMSPDLFRHENWRLFVA  544

Query  542  FVKKMKEGK  568
            FV+KM +GK
Sbjct  545  FVRKMGQGK  553



>ref|XP_009400488.1| PREDICTED: beta-amylase 1, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=590

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYGEFFLSWYSQMLL+HGERIL SA ++FD+TGVKISVK+AGIHWHYGTRSHAPELTAGY
Sbjct  372  PYGEFFLSWYSQMLLEHGERILSSATSVFDSTGVKISVKVAGIHWHYGTRSHAPELTAGY  431

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGYLPIA+ML RHGA+FNFTC+EMRD EQP +A C PE LV QVA A +EA V 
Sbjct  432  YNTRFRDGYLPIARMLGRHGAVFNFTCVEMRDGEQPAEACCRPEGLVNQVAAAAKEAGVA  491

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD+ AHEQI+ T+     E  G+ +M AFTYLRM P+LFQ +NWRRFVAFV
Sbjct  492  LAGENALPRYDEMAHEQIVNTATA---EEGGEEKMAAFTYLRMGPELFQPENWRRFVAFV  548

Query  548  KKMKEGK  568
            KKM EG+
Sbjct  549  KKMAEGR  555



>emb|CAX51378.1| beta-amylase [Hordeum vulgare subsp. vulgare]
Length=318

 Score =   285 bits (729),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 157/188 (84%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
             T YG+FF+SWYSQMLL+HGERIL + +++F  T GVK+SVK+AGIHWHYGTRSHAPELT
Sbjct  100  NTDYGQFFMSWYSQMLLEHGERILSACSSVFTGTPGVKVSVKVAGIHWHYGTRSHAPELT  159

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGYLPIA+ML RHGA+ NFTC+EMR+HEQPQDAQC PE LV+QVA A ++A
Sbjct  160  AGYYNTRNHDGYLPIARMLGRHGAVLNFTCVEMRNHEQPQDAQCMPEALVQQVANAAKDA  219

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD+ AH+Q++ T+A   +E   DR M AFTYLRM PDLFQ DNWRRF 
Sbjct  220  GVGLAGENALPRYDETAHDQVIATAAEKAEE---DR-MVAFTYLRMGPDLFQPDNWRRFA  275

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  276  AFVKRMTE  283



>ref|NP_001048926.1| Os03g0141200 [Oryza sativa Japonica Group]
 gb|ABF93905.1| Beta-amylase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10840.1| Os03g0141200 [Oryza sativa Japonica Group]
 dbj|BAG91188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=557

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
             TPYGEFF+SWYSQMLL+HGERIL +A+ ++  T GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  339  NTPYGEFFMSWYSQMLLEHGERILSAASGVYTGTPGVKISVKVAGIHWHYGTRSHAAELT  398

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+MLARHGA+ NFTC+EMR+HEQPQDAQC PE+LV+QVA A +E+
Sbjct  399  AGYYNTRHHDGYQPIARMLARHGAVLNFTCVEMRNHEQPQDAQCRPEELVQQVAAAARES  458

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD+ AH+QI+ T+A   +E      M AFTYLRM PDLFQ DNWRRF 
Sbjct  459  GVGLAGENALPRYDETAHDQIVTTAAEKAEE----ERMVAFTYLRMGPDLFQPDNWRRFA  514

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  515  AFVKRMTE  522



>gb|EAY88485.1| hypothetical protein OsI_09956 [Oryza sativa Indica Group]
 gb|EAZ25531.1| hypothetical protein OsJ_09355 [Oryza sativa Japonica Group]
Length=556

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
             TPYGEFF+SWYSQMLL+HGERIL +A+ ++  T GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  338  NTPYGEFFMSWYSQMLLEHGERILSAASGVYTGTPGVKISVKVAGIHWHYGTRSHAAELT  397

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+MLARHGA+ NFTC+EMR+HEQPQDAQC PE+LV+QVA A +E+
Sbjct  398  AGYYNTRHHDGYQPIARMLARHGAVLNFTCVEMRNHEQPQDAQCRPEELVQQVAAAARES  457

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD+ AH+QI+ T+A   +E      M AFTYLRM PDLFQ DNWRRF 
Sbjct  458  GVGLAGENALPRYDETAHDQIVTTAAEKAEE----ERMVAFTYLRMGPDLFQPDNWRRFA  513

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  514  AFVKRMTE  521



>dbj|BAJ96121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 157/188 (84%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
             T YG+FF+SWYSQMLL+HGERIL + +++F  T GVK+SVK+AGIHWHYGTRSHAPELT
Sbjct  333  NTDYGQFFMSWYSQMLLEHGERILSACSSVFTGTPGVKVSVKVAGIHWHYGTRSHAPELT  392

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGYLPIA+ML RHGA+ NFTC+EMR+HEQPQDAQC PE LV+QVA A ++A
Sbjct  393  AGYYNTRNHDGYLPIARMLGRHGAVLNFTCVEMRNHEQPQDAQCMPEALVQQVANAAKDA  452

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD+ AH+Q++ T+A   +E   DR M AFTYLRM PDLFQ DNWRRF 
Sbjct  453  GVGLAGENALPRYDETAHDQVIATAAEKAEE---DR-MVAFTYLRMGPDLFQPDNWRRFA  508

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  509  AFVKRMTE  516



>gb|ACF82250.1| unknown [Zea mays]
Length=334

 Score =   274 bits (700),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFF+SWYSQMLL+HGERIL +A  +F  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  116  STEYGEFFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELT  175

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+MLARHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVA A +EA
Sbjct  176  AGYYNTRSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREA  235

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYDD AH+Q++ T+A   D  + DR M AFTYLRM PDLFQ DNWRRF 
Sbjct  236  GVGLAGENALPRYDDTAHDQVVATAA---DRAAEDR-MVAFTYLRMGPDLFQPDNWRRFA  291

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  292  AFVKRMTE  299



>tpg|DAA43307.1| TPA: beta-amylase [Zea mays]
Length=390

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFF+SWYSQMLL+HGERIL +A  +F  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  172  STEYGEFFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELT  231

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+MLARHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVA A +EA
Sbjct  232  AGYYNTRSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREA  291

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYDD AH+Q++ T+A   D  + DR M AFTYLRM PDLFQ DNWRRF 
Sbjct  292  GVGLAGENALPRYDDTAHDQVVATAA---DRAAEDR-MVAFTYLRMGPDLFQPDNWRRFA  347

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  348  AFVKRMTE  355



>ref|XP_003558837.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brachypodium distachyon]
Length=573

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 154/188 (82%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
             T YG+FF+SWYSQMLL+HGERIL + ++++  T GVK+SVK+AGIHWHYGTRSHAPELT
Sbjct  355  NTEYGQFFMSWYSQMLLEHGERILSATSSVYTGTPGVKVSVKVAGIHWHYGTRSHAPELT  414

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+ML RHGA+ NFTC+EMR+HEQPQDAQC PE LV+QVA A +EA
Sbjct  415  AGYYNTRNHDGYQPIARMLGRHGAVLNFTCVEMRNHEQPQDAQCMPENLVQQVANAAKEA  474

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             + LAGENALPRYD+ AH+Q+L T+A   +E      M AFTYLRM PDLFQ DNWRRF 
Sbjct  475  GIGLAGENALPRYDETAHDQVLATAAEKAEE----ERMVAFTYLRMGPDLFQPDNWRRFA  530

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  531  AFVKRMTE  538



>gb|ADE77496.1| unknown [Picea sitchensis]
Length=210

 Score =   266 bits (681),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 146/178 (82%), Gaps = 3/178 (2%)
 Frame = +2

Query  44   MLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPI  223
            MLLDHGERIL ++ AIF  TG K+S K+AGIHWHYGTRSHAPELTAGYYNTRFRDGYLPI
Sbjct  1    MLLDHGERILTASEAIFRGTGTKLSGKVAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPI  60

Query  224  AQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLAGENALPRYDD  403
            A M ARHG IFNFTCIEM+D EQP DAQC+PEKL++QV LAT++A VPLAGENALPR+D 
Sbjct  61   ASMFARHGVIFNFTCIEMKDWEQPGDAQCSPEKLIKQVILATRKAGVPLAGENALPRFDQ  120

Query  404  YAHEQILRTSALSIDE*SGD---REMCAFTYLRMNPDLFQADNWRRFVAFVKKMKEGK  568
             AH QI+R + L + E SG+     MCAFTYLRM+  LF  +NWR FV+FV+K+ +G+
Sbjct  121  DAHNQIIRNANLRLPEDSGNTTVEPMCAFTYLRMSQHLFHPENWRLFVSFVRKLAQGQ  178



>ref|XP_004985750.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X2 [Setaria 
italica]
Length=563

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 152/187 (81%), Gaps = 5/187 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
             T YG+FF+SWYSQMLL+HGERIL +A  +F  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  345  NTEYGQFFMSWYSQMLLEHGERILSAATGVFTASPGVKISVKVAGIHWHYGTRSHAAELT  404

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+ML RHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVALA ++A
Sbjct  405  AGYYNTRHHDGYQPIARMLGRHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVALAARDA  464

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD+ AH+Q++ T+A   +E      M AFTYLRM PDLFQ DNWRRF 
Sbjct  465  GVGLAGENALPRYDETAHDQVVATAAEKAEE----ERMVAFTYLRMGPDLFQPDNWRRFA  520

Query  539  AFVKKMK  559
            AFVK+M 
Sbjct  521  AFVKRMS  527



>gb|ACG29617.1| beta-amylase [Zea mays]
Length=572

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFF+SWYSQMLL+HGERIL +A  +F  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  354  STEYGEFFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELT  413

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+MLARHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVA A +EA
Sbjct  414  AGYYNTRSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREA  473

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYDD AH+Q++ T+A   D  + DR M AFTYLRM PDLFQ DNWRRF 
Sbjct  474  GVGLAGENALPRYDDTAHDQVVATAA---DRAAEDR-MVAFTYLRMGPDLFQPDNWRRFA  529

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  530  AFVKRMTE  537



>tpg|DAA43306.1| TPA: beta-amylase [Zea mays]
Length=573

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFF+SWYSQMLL+HGERIL +A  +F  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  355  STEYGEFFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELT  414

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+MLARHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVA A +EA
Sbjct  415  AGYYNTRSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREA  474

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYDD AH+Q++ T+A   D  + DR M AFTYLRM PDLFQ DNWRRF 
Sbjct  475  GVGLAGENALPRYDDTAHDQVVATAA---DRAAEDR-MVAFTYLRMGPDLFQPDNWRRFA  530

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  531  AFVKRMTE  538



>ref|XP_004985749.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X1 [Setaria 
italica]
Length=603

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 152/187 (81%), Gaps = 5/187 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
             T YG+FF+SWYSQMLL+HGERIL +A  +F  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  385  NTEYGQFFMSWYSQMLLEHGERILSAATGVFTASPGVKISVKVAGIHWHYGTRSHAAELT  444

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+ML RHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVALA ++A
Sbjct  445  AGYYNTRHHDGYQPIARMLGRHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVALAARDA  504

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD+ AH+Q++ T+A   +E      M AFTYLRM PDLFQ DNWRRF 
Sbjct  505  GVGLAGENALPRYDETAHDQVVATAAEKAEE----ERMVAFTYLRMGPDLFQPDNWRRFA  560

Query  539  AFVKKMK  559
            AFVK+M 
Sbjct  561  AFVKRMS  567



>ref|NP_001148159.1| beta-amylase [Zea mays]
 gb|ACG29973.1| beta-amylase [Zea mays]
Length=573

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFF+SWYSQMLL+HGERIL +A  +F  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  355  STEYGEFFMSWYSQMLLEHGERILSAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELT  414

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA+MLARHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVA A +EA
Sbjct  415  AGYYNTRSHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREA  474

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYDD AH+Q++ T+A   D  + DR M AFTYLRM PDLF+ DNWRRF 
Sbjct  475  GVGLAGENALPRYDDTAHDQVVATAA---DRAAEDR-MVAFTYLRMGPDLFRPDNWRRFA  530

Query  539  AFVKKMKE  562
            AFVK+M E
Sbjct  531  AFVKRMTE  538



>gb|AGT17079.1| beta-amylase [Saccharum hybrid cultivar R570]
Length=560

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELT  178
            +T YG+FF+SWYSQMLL+HGERIL +A  ++  + GVKISVK+AGIHWHYGTRSHA ELT
Sbjct  342  STEYGQFFMSWYSQMLLEHGERILSAATGVYTGSPGVKISVKVAGIHWHYGTRSHAAELT  401

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY P+A+MLARHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVA A +EA
Sbjct  402  AGYYNTRQHDGYAPVARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREA  461

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD+ AH+Q++ T+A   D  + DR M AFTYLRM PDLFQ DNWRRF 
Sbjct  462  GVGLAGENALPRYDETAHDQVVATAA---DRAAEDR-MVAFTYLRMGPDLFQPDNWRRFA  517

Query  539  AFVKKMKE  562
            AFVK+M +
Sbjct  518  AFVKRMSQ  525



>ref|XP_002468533.1| hypothetical protein SORBIDRAFT_01g047500 [Sorghum bicolor]
 gb|EER95531.1| hypothetical protein SORBIDRAFT_01g047500 [Sorghum bicolor]
Length=564

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNT-GVKISVKIAGIHWHYGTRSHAPELTAGY  187
            YG+FF+SWYSQMLL+HGERIL +A  ++  + GVKISVK+AGIHWHYGTRSHA ELTAGY
Sbjct  349  YGQFFMSWYSQMLLEHGERILSAATGVYTGSPGVKISVKVAGIHWHYGTRSHAAELTAGY  408

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTR  DGY PIA+MLARHGA+ NFTC+EMRDHEQPQDAQC PE LV+QVA A +EA V 
Sbjct  409  YNTRHHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVG  468

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD+ AH+Q++ T+A   D  + DR M AFTYLRM PDLFQ DNWRRF AFV
Sbjct  469  LAGENALPRYDETAHDQVVATAA---DRAAEDR-MVAFTYLRMGPDLFQPDNWRRFAAFV  524

Query  548  KKMKE  562
            K+M +
Sbjct  525  KRMSQ  529



>gb|EAZ16360.1| hypothetical protein OsJ_31822 [Oryza sativa Japonica Group]
Length=535

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIF-DNTGVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFFLSWYSQMLL+HGER+L  A ++F D  G KISVK+AGIHWHYGTRSHAPELT
Sbjct  320  STEYGEFFLSWYSQMLLEHGERVLSGATSVFGDGAGAKISVKVAGIHWHYGTRSHAPELT  379

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR RDGYLPIA+MLARHGA+ NFTC+EMRDHEQPQ+AQC PE LVRQVA A + A
Sbjct  380  AGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQVAAAARAA  439

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
               L GENALPRYD  AH+ ++ T+A    E   DR + A TYLRM PDLF  + W RFV
Sbjct  440  GFGLPGENALPRYDGTAHDPVITTAANRAAE---DR-IVALTYLRMGPDLFHPEKWGRFV  495

Query  539  AFVKKMKE  562
            AFV+++ E
Sbjct  496  AFVRRISE  503



>ref|XP_001782016.1| predicted protein [Physcomitrella patens]
 gb|EDQ53159.1| predicted protein [Physcomitrella patens]
Length=465

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 147/194 (76%), Gaps = 6/194 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG+FF+ WYS+MLL HGERIL  A  IF  TG  IS K+AGIHWHYGTRSHA ELTA
Sbjct  241  STEYGQFFMEWYSEMLLAHGERILSEATGIFRGTGAVISGKVAGIHWHYGTRSHAAELTA  300

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIAQM A++G   NFTCIEMRD EQP  A C+PE LVRQVALAT++  
Sbjct  301  GYYNTRSRDGYLPIAQMFAKYGVTLNFTCIEMRDFEQPAHALCSPEGLVRQVALATRKTG  360

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD-----REMCAFTYLRMNPDLFQADNW  526
            +P+AGENALPR+D  AHEQI+R S L ++E  GD       M AFT+LRM   LF ++NW
Sbjct  361  IPMAGENALPRFDSSAHEQIVRKSRLQMNE-KGDCQEHYEPMSAFTFLRMCESLFHSENW  419

Query  527  RRFVAFVKKMKEGK  568
            R FV FV+ M+EG+
Sbjct  420  RLFVPFVRHMEEGR  433



>ref|XP_010918964.1| PREDICTED: beta-amylase 1, chloroplastic [Elaeis guineensis]
Length=571

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 149/183 (81%), Gaps = 7/183 (4%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYGEFFL+WYSQMLLDHGER+L +A +IF   GVKISVK+AGIHWHYGTRSHA ELTAGY
Sbjct  357  PYGEFFLTWYSQMLLDHGERVLSAATSIFHGAGVKISVKVAGIHWHYGTRSHAAELTAGY  416

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGYLPIAQML RHGA+FNFTC+EMRD EQ  +A C PE LVRQVA A + A V 
Sbjct  417  YNTRFRDGYLPIAQMLGRHGAVFNFTCVEMRDEEQSGEACCRPEGLVRQVAAAARAAGVG  476

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD+ AHEQI++T+           EM AFTYLRM P LFQ DNWRRFVAFV
Sbjct  477  LAGENALPRYDETAHEQIVQTAVQG-------EEMKAFTYLRMGPALFQPDNWRRFVAFV  529

Query  548  KKM  556
            K+M
Sbjct  530  KRM  532



>ref|XP_008775132.1| PREDICTED: beta-amylase 1, chloroplastic [Phoenix dactylifera]
Length=572

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 151/181 (83%), Gaps = 7/181 (4%)
 Frame = +2

Query  8    PYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            PYGEFFL+WYSQMLLDHGER+L +A ++F   GVKISVK+AGIHWHYGTRSHAPELTAGY
Sbjct  358  PYGEFFLTWYSQMLLDHGERVLSAATSVFHGAGVKISVKVAGIHWHYGTRSHAPELTAGY  417

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTRFRDGYLPIAQML RHGA+FNFTC+EMRD EQ  +A C PE LVRQVA A + A V 
Sbjct  418  YNTRFRDGYLPIAQMLGRHGAVFNFTCVEMRDEEQSGEACCRPEGLVRQVAAAARAAGVG  477

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYD+ AH+QI++T+        G++ M AFTYLRM PDLFQ DNWRRFVAFV
Sbjct  478  LAGENALPRYDETAHDQIVQTAV------EGEK-MKAFTYLRMGPDLFQPDNWRRFVAFV  530

Query  548  K  550
            K
Sbjct  531  K  531



>gb|ABK24605.1| unknown [Picea sitchensis]
Length=492

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYGEFFL WYS MLL+HGERIL  A +IF  +G ++S K+AGIHWHY TRSHAPELTA
Sbjct  278  NSPYGEFFLQWYSNMLLNHGERILAEAESIFHKSGARLSGKVAGIHWHYLTRSHAPELTA  337

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIAQM  RHG +F FTCIEM+D EQP DA+C+PEKL++QV  AT++A+
Sbjct  338  GYYNTGDRDGYLPIAQMFGRHGVVFIFTCIEMKDVEQPADAKCSPEKLIKQVIKATRKAR  397

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDRE---MCAFTYLRMNPDLFQADNWRR  532
            + LAGENALPR+D+ A+ Q+L  S L +++ + D +   MCAFTYLRM+  LFQ+ NW  
Sbjct  398  IHLAGENALPRFDEAAYTQVLNNSCLRLEQDNPDDKIEPMCAFTYLRMSQHLFQSKNWST  457

Query  533  FVAFVKKMKE  562
            FV+FV++M +
Sbjct  458  FVSFVRRMSQ  467



>ref|XP_004982940.1| PREDICTED: beta-amylase 1, chloroplastic-like [Setaria italica]
Length=543

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 150/185 (81%), Gaps = 4/185 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG+FFLSWYSQML++HG+RIL  A+++F  + V++SVK+AGIHWHYGTRSHAPELTA
Sbjct  329  STEYGDFFLSWYSQMLMEHGDRILTGASSVFSASPVEVSVKVAGIHWHYGTRSHAPELTA  388

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLP+A++LARHGA+ NFTC+EMRDHEQPQDAQC PE LVRQV  A + A 
Sbjct  389  GYYNTRHHDGYLPVARLLARHGAVLNFTCVEMRDHEQPQDAQCMPEALVRQVGAAARAAG  448

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENALPRYD  AH+Q++ T+A    E + +  M AFTYLRM  DLF  DNW RF A
Sbjct  449  VGLAGENALPRYDGAAHDQVVSTAA----ERAAEDRMVAFTYLRMGADLFHPDNWHRFAA  504

Query  542  FVKKM  556
            FV++M
Sbjct  505  FVRRM  509



>ref|XP_004168709.1| PREDICTED: beta-amylase 3, chloroplastic-like, partial [Cucumis 
sativus]
Length=341

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YGEFFL+WYS  LL HG+ IL +A  IF  TG K+S K+AGIHWHYGTRSHA ELTAG
Sbjct  128  TEYGEFFLAWYSSKLLQHGDSILAAAKGIFRGTGAKLSAKVAGIHWHYGTRSHAAELTAG  187

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR RDGY PIA+MLA+HG +FNFTC+EMRD +QP  A C+PE LVRQV +AT++A+V
Sbjct  188  YYNTRHRDGYSPIAKMLAKHGVVFNFTCMEMRDGQQPGHANCSPEGLVRQVKMATRDAKV  247

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD  A+EQIL TS       SG+  + AFTYLRMN +LF+ +NWR  V F
Sbjct  248  ELAGENALERYDGAAYEQILATSRSD----SGN-GLAAFTYLRMNKNLFEPNNWRNLVEF  302

Query  545  VKKMKEG  565
            VK M EG
Sbjct  303  VKSMSEG  309



>ref|NP_001064798.1| Os10g0465700 [Oryza sativa Japonica Group]
 gb|AAK27799.1|AC022457_2 putative amylase [Oryza sativa Japonica Group]
 gb|AAP54185.1| Glycosyl hydrolase family 14 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26712.1| Os10g0465700 [Oryza sativa Japonica Group]
 dbj|BAG90332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=535

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 152/188 (81%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIF-DNTGVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFFLSWYSQMLL+HGER+L  A ++F D  G KISVK+AGIHWHYGTRSHAPELT
Sbjct  320  STEYGEFFLSWYSQMLLEHGERVLSGATSVFGDGAGAKISVKVAGIHWHYGTRSHAPELT  379

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR RDGYLPIA+MLARHGA+ NFTC+EMRDHEQPQ+AQC PE LVRQVA A + A
Sbjct  380  AGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQVAAAARAA  439

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD  AH+Q++  +A    E      M AFTYLRM PDLF  DNWRRFV
Sbjct  440  GVGLAGENALPRYDGTAHDQVVAAAADRAAE----DRMVAFTYLRMGPDLFHPDNWRRFV  495

Query  539  AFVKKMKE  562
            AFV++M E
Sbjct  496  AFVRRMSE  503



>ref|XP_001756520.1| predicted protein [Physcomitrella patens]
 gb|EDQ78474.1| predicted protein [Physcomitrella patens]
Length=483

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 147/194 (76%), Gaps = 6/194 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            ++ YG+FFL WYS+MLL HGERIL  A  IF  TG  IS K+AGIHWHYGTRSHA ELTA
Sbjct  259  SSEYGQFFLEWYSEMLLAHGERILSQATGIFRGTGAIISGKVAGIHWHYGTRSHAAELTA  318

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY PIAQM A++G   NFTCIEMRD EQP  A C+PE LVRQVALAT++A 
Sbjct  319  GYYNTRTRDGYSPIAQMFAKYGVTLNFTCIEMRDFEQPSHALCSPEGLVRQVALATRKAG  378

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD-----REMCAFTYLRMNPDLFQADNW  526
            + +AGENALPR+D+ AHEQI+R S L ++E  GD       M AFT+LRM   LF ++NW
Sbjct  379  ISMAGENALPRFDNSAHEQIVRKSRLQMNE-KGDCQEEYEPMSAFTFLRMCESLFHSENW  437

Query  527  RRFVAFVKKMKEGK  568
            R FV FV+ M+EG+
Sbjct  438  RLFVPFVRHMEEGR  451



>ref|NP_001147532.1| beta-amylase [Zea mays]
 gb|ACF86357.1| unknown [Zea mays]
 gb|ACG27842.1| beta-amylase [Zea mays]
 gb|AFW68644.1| beta-amylase [Zea mays]
Length=544

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 4/186 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG+FFLSWYSQMLL+HG+RIL  A ++F    V++SVK+AGIHWHYG+RSHAPELTA
Sbjct  330  STEYGDFFLSWYSQMLLEHGDRILSGATSVFGAAPVEVSVKVAGIHWHYGSRSHAPELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYL IA++LARHGA+ NFTC+EMRDHEQPQ+A+C PE LVRQV  A + A 
Sbjct  390  GYYNTRRHDGYLTIARLLARHGAVLNFTCVEMRDHEQPQEARCMPEALVRQVGAAARAAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENALPRYD  AH+Q++ T+A    E + +  M AFTYLRM PDLF  DNWRRF A
Sbjct  450  VGLAGENALPRYDGTAHDQVVTTAA----ERAAEDRMVAFTYLRMGPDLFHPDNWRRFAA  505

Query  542  FVKKMK  559
            FV++M 
Sbjct  506  FVRRMN  511



>ref|XP_003571854.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brachypodium distachyon]
Length=534

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 150/190 (79%), Gaps = 10/190 (5%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIF------DNTGVKISVKIAGIHWHYGTRSHAPE  172
            YGEFF+SWYSQMLLDHG+R+L  A ++F      D   +++S K++GIHWHYGTRSHAPE
Sbjct  317  YGEFFMSWYSQMLLDHGDRVLSGAASVFSASASPDVDDIRLSAKVSGIHWHYGTRSHAPE  376

Query  173  LTAGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQ  352
            LTAGYYNT  RDGY P+A+MLARHGA+ NFTC+EMRD EQP++A+C PE LVRQVA A +
Sbjct  377  LTAGYYNTGDRDGYRPVARMLARHGAVLNFTCVEMRDREQPREARCMPEALVRQVAAAAR  436

Query  353  EAQVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRR  532
            +A V LAGENALPRYD  AH+Q++ T+A   +E   DR M AFTYLRM PDLFQ DNWRR
Sbjct  437  DAGVGLAGENALPRYDGAAHDQVVATAAERAEE---DR-MVAFTYLRMGPDLFQPDNWRR  492

Query  533  FVAFVKKMKE  562
            F AFV +M +
Sbjct  493  FAAFVNRMSK  502



>ref|XP_002968794.1| hypothetical protein SELMODRAFT_145994 [Selaginella moellendorffii]
 gb|EFJ29910.1| hypothetical protein SELMODRAFT_145994 [Selaginella moellendorffii]
Length=464

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 145/193 (75%), Gaps = 4/193 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FFL WYS  L++HGE +L +A  IF  + V++S K+AGIHWHYGTRSHAPELTA
Sbjct  241  NTDYGRFFLEWYSGKLIEHGESVLTAAEGIFRGSPVRLSAKVAGIHWHYGTRSHAPELTA  300

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLP+A+M  RHG  FNFTC EMRD EQP  AQC+PE L++QV  A + A 
Sbjct  301  GYYNTRFRDGYLPLARMFGRHGVTFNFTCFEMRDVEQPAAAQCSPEGLLKQVVAAAKSAG  360

Query  362  VPLAGENALPRYDDYAHEQILRTSALSID-E*SGDR---EMCAFTYLRMNPDLFQADNWR  529
            VPLAGENALPRYD+ A+ QI+  S L ++ E S +R    MC FT+LRMN  LF  +NWR
Sbjct  361  VPLAGENALPRYDEGAYHQIVMKSRLEVEGEESMERAYEPMCCFTFLRMNERLFHPENWR  420

Query  530  RFVAFVKKMKEGK  568
            RFV FVK++ +GK
Sbjct  421  RFVQFVKEIGDGK  433



>ref|XP_002467119.1| hypothetical protein SORBIDRAFT_01g019850 [Sorghum bicolor]
 gb|EER94117.1| hypothetical protein SORBIDRAFT_01g019850 [Sorghum bicolor]
Length=547

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFD-NTGVKISVKIAGIHWHYGTRSHAPELT  178
            +T YG+FFLSWYSQMLL+HG+RIL  A ++F  ++ V++SVK+AGIHWHYGTRSHAPELT
Sbjct  332  STQYGDFFLSWYSQMLLEHGDRILSGATSVFGASSPVEVSVKVAGIHWHYGTRSHAPELT  391

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR  DGY PIA +LARHGA+ NFTC+EMRDHEQPQ+AQC PE LVRQV  A + A
Sbjct  392  AGYYNTRHHDGYRPIADLLARHGAVLNFTCVEMRDHEQPQEAQCMPEHLVRQVGAAARAA  451

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD  AH+Q++ T+A    E   DR M AFTYLRM PDLF  DNW+RF 
Sbjct  452  GVGLAGENALPRYDGTAHDQVVATAAQRAAE---DR-MVAFTYLRMGPDLFHPDNWQRFA  507

Query  539  AFVKKMK  559
            AFV++M 
Sbjct  508  AFVRRMN  514



>ref|XP_002974185.1| hypothetical protein SELMODRAFT_149606, partial [Selaginella 
moellendorffii]
 gb|EFJ25140.1| hypothetical protein SELMODRAFT_149606, partial [Selaginella 
moellendorffii]
Length=432

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 144/192 (75%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FFL WYS  L++HGE +L +A  IF  + V++S K+AGIHWHYGTRSHAPELTA
Sbjct  241  NTDYGRFFLEWYSGKLIEHGESVLTAAEGIFRGSPVRLSAKVAGIHWHYGTRSHAPELTA  300

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLP+A+M  RHG  FNFTC EMRD EQP  AQC+PE L++QV  A + A 
Sbjct  301  GYYNTRFRDGYLPLARMFGRHGVTFNFTCFEMRDVEQPAAAQCSPEGLLKQVVAAAKSAG  360

Query  362  VPLAGENALPRYDDYAHEQILRTSALSID-E*SGDR---EMCAFTYLRMNPDLFQADNWR  529
            VPLAGENALPRYD+ A+ QI+  S L ++ E S +R    MC FT+LRMN  LF  +NWR
Sbjct  361  VPLAGENALPRYDEGAYHQIVMKSRLEVEGEESMERAYEPMCCFTFLRMNERLFHPENWR  420

Query  530  RFVAFVKKMKEG  565
            RFV FVK++ +G
Sbjct  421  RFVQFVKEIGDG  432



>gb|AFI71858.1| amylase [Oryza sativa]
Length=535

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 151/188 (80%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFD-NTGVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFFLSWYSQMLL+HGER+L  A ++F    G KISVK+AGIHWHYGTRSHAPELT
Sbjct  320  STEYGEFFLSWYSQMLLEHGERVLSGATSVFGAGAGAKISVKVAGIHWHYGTRSHAPELT  379

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR RDGYLPIA+MLARHGA+ NFTC+EMRDHEQPQ+AQC PE LVRQVA A + A
Sbjct  380  AGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQVAAAARAA  439

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD  AH+Q++  +A    E      M AFT+LRM PDLF  DNWRRFV
Sbjct  440  GVGLAGENALPRYDGTAHDQVVAAAADRAAE----DRMVAFTFLRMGPDLFHPDNWRRFV  495

Query  539  AFVKKMKE  562
            AFV++M E
Sbjct  496  AFVRRMSE  503



>ref|XP_001778149.1| predicted protein [Physcomitrella patens]
 gb|EDQ57039.1| predicted protein [Physcomitrella patens]
Length=507

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 146/191 (76%), Gaps = 6/191 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FF+ WYS+M+L HGER+L SA+ IF  TG  IS K+AGIHWHYGTRSHA ELTAGYY
Sbjct  287  YGQFFMEWYSEMILAHGERLLASASGIFKGTGAVISGKVAGIHWHYGTRSHAAELTAGYY  346

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGY  IAQM A++G   NFTCIEMRD+EQP  A C+PE LVRQVALAT+ A +P+
Sbjct  347  NTRTRDGYATIAQMFAKYGVTLNFTCIEMRDYEQPSQASCSPEGLVRQVALATRRAGIPM  406

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGD-----REMCAFTYLRMNPDLFQADNWRRF  535
            AGENALPR+D  AHEQI+R S L ++E  GD       M AFT+LRM   LF ++NW+ F
Sbjct  407  AGENALPRFDSSAHEQIVRKSRLRMNE-HGDCHEEYEPMAAFTFLRMCESLFHSENWKLF  465

Query  536  VAFVKKMKEGK  568
            V FV+ M+EG+
Sbjct  466  VPFVRHMEEGR  476



>gb|EAY78842.1| hypothetical protein OsI_33946 [Oryza sativa Indica Group]
Length=536

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFD-NTGVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFFLSWYSQMLL+HGER+L  A ++F    G KISVK+AGIHWHYGTRSHAPELT
Sbjct  320  STEYGEFFLSWYSQMLLEHGERVLSGATSVFGAGAGAKISVKVAGIHWHYGTRSHAPELT  379

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR RDGYLPIA+MLARHGA+ NFTC+EMRDHEQPQ+AQC PE LVRQVA A + A
Sbjct  380  AGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQVAAAARAA  439

Query  359  QVPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFV  538
             V LAGENALPRYD  AH+Q++  +A    E   +  M AFTYLRM PDLF  DNWRRFV
Sbjct  440  GVGLAGENALPRYDGTAHDQVVAAAADRAAE---EDRMVAFTYLRMGPDLFHPDNWRRFV  496

Query  539  AFVKKMKE  562
            AFV++M E
Sbjct  497  AFVRRMSE  504



>ref|XP_004147264.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cucumis sativus]
 gb|KGN55808.1| hypothetical protein Csa_3G017020 [Cucumis sativus]
Length=538

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YGEFFL+WYS  LL HG+ IL +A  IF  TG K+S K+AGIHWHYGTRSHA ELTAG
Sbjct  325  TEYGEFFLAWYSSKLLQHGDSILAAAKGIFRGTGAKLSAKVAGIHWHYGTRSHAAELTAG  384

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR RDGY PIA+MLA+HG +FNFTC+EMRD +QP  A C+PE LVRQV +AT++A+V
Sbjct  385  YYNTRHRDGYSPIAKMLAKHGVVFNFTCMEMRDGQQPGHANCSPEGLVRQVKMATRDAKV  444

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD  A+EQIL TS       SG+  + AFTYLRMN +LF+ +NWR  V F
Sbjct  445  ELAGENALERYDGAAYEQILATSRSD----SGN-GLAAFTYLRMNKNLFEPNNWRNLVEF  499

Query  545  VKKMKEG  565
            VK M EG
Sbjct  500  VKSMSEG  506



>gb|EPS63004.1| hypothetical protein M569_11781, partial [Genlisea aurea]
Length=455

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FFL WYS MLLDHGE+IL +A  IF  TGVK+S K+AGIHWHY TRSHA ELTA
Sbjct  250  NSEYGRFFLEWYSNMLLDHGEKILAAAEKIFRGTGVKLSGKVAGIHWHYKTRSHAAELTA  309

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLP+A+M+A+HG +FNFTC+EMRD EQP+ A  +PE LVRQV +AT+ A+
Sbjct  310  GYYNTRNRDGYLPVAKMMAKHGVVFNFTCMEMRDGEQPEAAGSSPESLVRQVKMATKRAE  369

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q++ TS       +G R + AFTYLRMN  LF+ADNWR  V 
Sbjct  370  AELAGENALERYDGSAYSQVINTSRSE----TGSR-LSAFTYLRMNRRLFEADNWRNLVE  424

Query  542  FVKKMKEGK  568
            FV+ M EG+
Sbjct  425  FVRAMSEGR  433



>ref|XP_008448759.1| PREDICTED: beta-amylase 3, chloroplastic [Cucumis melo]
Length=537

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YGEFFL+WYS  LL HG+ IL +A  IF  TG K+S K+AGIHWHYGTRSHA ELTAG
Sbjct  324  TEYGEFFLAWYSSKLLQHGDSILAAAKGIFRGTGAKLSAKVAGIHWHYGTRSHAAELTAG  383

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR RDGY PIA+MLA+HG +FNFTC+EMRD +QP  A C+PE LVRQV +AT++A+V
Sbjct  384  YYNTRHRDGYSPIAKMLAKHGVVFNFTCMEMRDGQQPGYANCSPEGLVRQVKMATRDAKV  443

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD  A+EQIL TS       SG+  + AFTYLRMN +LF+ +NWR  V F
Sbjct  444  ELAGENALERYDGAAYEQILATSRSD----SGN-GLAAFTYLRMNKNLFEPNNWRNLVEF  498

Query  545  VKKMKEG  565
            VK M EG
Sbjct  499  VKSMSEG  505



>ref|XP_007035341.1| Beta-amylase 1 isoform 2, partial [Theobroma cacao]
 gb|EOY06267.1| Beta-amylase 1 isoform 2, partial [Theobroma cacao]
Length=521

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YGEFFLSWYSQMLLDHGERIL SA ++F+  GVKISVK+AGIHWHYGTRSHAPELTAGYY
Sbjct  394  YGEFFLSWYSQMLLDHGERILSSATSVFEGAGVKISVKVAGIHWHYGTRSHAPELTAGYY  453

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTRFRDGYLPIAQMLARHGA+FNFTCIEMRDHEQPQDA CAPEKLVRQVALAT  AQVPL
Sbjct  454  NTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVALATAAAQVPL  513

Query  371  AGENALPR  394
            AGENALPR
Sbjct  514  AGENALPR  521



>gb|KJB39785.1| hypothetical protein B456_007G030600 [Gossypium raimondii]
Length=539

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS MLLDHG+R+L +A   F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  324  NTEYGQFFLEWYSGMLLDHGDRLLSAAKGTFQGTGAKLSGKVAGIHWHYNTRSHAAELTA  383

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIA+M ++HG +FNFTC+EMRD +QP+ A C+PE LVRQV + T+ A+
Sbjct  384  GYYNTRHRDGYLPIARMFSKHGVVFNFTCMEMRDSQQPEHANCSPEGLVRQVKMVTKTAR  443

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A+ Q+L TS    D  SG   + AFTYLRMN  LF+ DNWR  V 
Sbjct  444  VELAGENALERYDSGAYAQVLATS--RSDSGSG---LSAFTYLRMNKRLFEGDNWRNLVE  498

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  499  FVKNMSEG  506



>gb|AHJ09602.1| chloroplast beta-amylase 3 [Camellia sinensis]
Length=548

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS MLL+HG+RIL +A  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  334  YGQFFLEWYSGMLLEHGDRILAAAKGIFQGTGAKLSGKVAGIHWHYRTRSHAAELTAGYY  393

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGY PIAQM+++HG + NFTC+EMRD EQP++A C+PE LV+QV +AT+ A+  L
Sbjct  394  NTRHRDGYQPIAQMMSKHGVVLNFTCMEMRDREQPENANCSPEGLVQQVKMATKTARTEL  453

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A+ Q+L TS       SG+  +CAFTYLR+N  LF+ADNWR  V FVK
Sbjct  454  AGENALERYDAGAYAQVLATSRSD----SGN-GLCAFTYLRLNKSLFEADNWRHLVEFVK  508

Query  551  KMKEG  565
             M EG
Sbjct  509  NMSEG  513



>ref|NP_001183801.1| uncharacterized protein LOC100502394 [Zea mays]
 gb|ACR38352.1| unknown [Zea mays]
Length=265

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL WYS MLL+HG+R++ +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  45   STEYGHFFLEWYSGMLLEHGDRVMDAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTA  104

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY PIA+MLA+ GA+ NFTC+EM+D +QPQ A C+PE LV+QV  AT  A 
Sbjct  105  GYYNTRGRDGYAPIARMLAKRGAVLNFTCMEMKDEQQPQHASCSPELLVQQVKAATSAAG  164

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYDD A  Q++ T+  +         + AFTYLRMN  LF  DNW RFV+
Sbjct  165  VQLAGENALERYDDAAFSQVVSTARGA--------GLAAFTYLRMNKTLFDGDNWGRFVS  216

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  217  FVRAMADG  224



>gb|KJB51735.1| hypothetical protein B456_008G230100 [Gossypium raimondii]
Length=421

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS+ LL+HG+RIL +A   F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  207  NTEYGQFFLEWYSRKLLEHGDRILAAAKGTFHGTGAKLSAKVAGIHWHYRTRSHAAELTA  266

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIAQM ++HG +FNFTC+EMRD EQP+ A C+PE LVRQV +AT+ A+
Sbjct  267  GYYNTRHHDGYLPIAQMFSKHGVVFNFTCMEMRDGEQPEYANCSPEGLVRQVKMATKIAR  326

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  ++ Q+L TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  327  VELAGENALERYDAGSYAQVLATSRSD----SGN-GLSAFTYLRMNKRLFEGDNWRHLVE  381

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  382  FVKNMSEG  389



>gb|KJB51736.1| hypothetical protein B456_008G230100 [Gossypium raimondii]
Length=508

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS+ LL+HG+RIL +A   F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  294  NTEYGQFFLEWYSRKLLEHGDRILAAAKGTFHGTGAKLSAKVAGIHWHYRTRSHAAELTA  353

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIAQM ++HG +FNFTC+EMRD EQP+ A C+PE LVRQV +AT+ A+
Sbjct  354  GYYNTRHHDGYLPIAQMFSKHGVVFNFTCMEMRDGEQPEYANCSPEGLVRQVKMATKIAR  413

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  ++ Q+L TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  414  VELAGENALERYDAGSYAQVLATSRSD----SGN-GLSAFTYLRMNKRLFEGDNWRHLVE  468

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  469  FVKNMSEG  476



>ref|XP_003611408.1| Beta-amylase [Medicago truncatula]
 gb|AES94366.1| beta-amylase [Medicago truncatula]
Length=543

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 138/188 (73%), Gaps = 11/188 (6%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  L++HGE+IL SA +IF  +GVK+S KIAGIHWHY  RSHA ELTA
Sbjct  334  NTEYGDFFLDWYSSKLVEHGEKILVSAKSIFQTSGVKLSAKIAGIHWHYNARSHATELTA  393

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT+F DGY+PIAQMLA+HG I NFTC+EM+D+EQP DA C+PE LV QV +AT+ A 
Sbjct  394  GYYNTKFHDGYIPIAQMLAKHGVILNFTCMEMKDNEQPCDANCSPEGLVNQVRMATKIAG  453

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS LS           AFTYLR+N  L + DNWR+FV 
Sbjct  454  GELAGENALERYDSSAYGQVLSTSGLS-----------AFTYLRINKRLLEGDNWRKFVD  502

Query  542  FVKKMKEG  565
            FV  M +G
Sbjct  503  FVVSMSDG  510



>ref|XP_009792527.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=548

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 137/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  LL+HG+RIL SA  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  335  YGQFFLEWYSGKLLEHGDRILGSAEGIFRGTGAKLSGKVAGIHWHYNTRSHAAELTAGYY  394

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIA+M A+HG +FNFTC+EMRD EQPQ A C+PE LVRQV  ATQ A + L
Sbjct  395  NTRHRDGYLPIARMFAKHGVVFNFTCMEMRDGEQPQSANCSPEGLVRQVKKATQIAGIEL  454

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD   + Q+L TS       SG+  + AFTYLR+N  LF+ +NWR  V FVK
Sbjct  455  AGENALERYDGGGYAQVLATSKSE----SGN-GLSAFTYLRLNKRLFEPENWRNLVEFVK  509

Query  551  KMKEG  565
             M EG
Sbjct  510  NMSEG  514



>gb|KJB51734.1| hypothetical protein B456_008G230100 [Gossypium raimondii]
Length=540

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS+ LL+HG+RIL +A   F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  326  NTEYGQFFLEWYSRKLLEHGDRILAAAKGTFHGTGAKLSAKVAGIHWHYRTRSHAAELTA  385

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIAQM ++HG +FNFTC+EMRD EQP+ A C+PE LVRQV +AT+ A+
Sbjct  386  GYYNTRHHDGYLPIAQMFSKHGVVFNFTCMEMRDGEQPEYANCSPEGLVRQVKMATKIAR  445

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  ++ Q+L TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  446  VELAGENALERYDAGSYAQVLATSRSD----SGN-GLSAFTYLRMNKRLFEGDNWRHLVE  500

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  501  FVKNMSEG  508



>ref|XP_009597851.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana tomentosiformis]
Length=548

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 137/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  LL+HG+RIL SA  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  335  YGQFFLEWYSGKLLEHGDRILGSAEGIFRGTGAKLSGKVAGIHWHYNTRSHAAELTAGYY  394

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIA+M A+HG +FNFTC+EMRD EQPQ A C+PE LVRQV  ATQ A + L
Sbjct  395  NTRHRDGYLPIARMFAKHGVVFNFTCMEMRDGEQPQSANCSPEGLVRQVKKATQIAGIEL  454

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD   + Q+L TS       SG+  + AFTYLR+N  LF+ +NWR  V FVK
Sbjct  455  AGENALERYDGGGYAQVLATSRSE----SGN-GLSAFTYLRLNKRLFEPENWRNLVEFVK  509

Query  551  KMKEG  565
             M EG
Sbjct  510  SMSEG  514



>gb|KHN42645.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=548

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 136/188 (72%), Gaps = 9/188 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FFL WYS  LL+HGE+IL SA  IF++ GVK+S K+AGIHWHY  RSHA ELTA
Sbjct  333  NTEYGRFFLDWYSTKLLEHGEKILVSAKGIFNSCGVKLSAKVAGIHWHYKARSHAAELTA  392

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLA+HG + NFTC+EMRD EQP+   C+PE LV QV +A + A+
Sbjct  393  GYYNTRFRDGYLPIAQMLAKHGVVLNFTCMEMRDREQPE--HCSPEGLVHQVKIAARTAE  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q+L TS       +    + AFTYLRMN  LF+ DNWR FV 
Sbjct  451  AELAGENALERYDAGAFSQVLSTS-------NSGSGLAAFTYLRMNKRLFEGDNWRLFVE  503

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  504  FVKSMSEG  511



>ref|XP_006573703.1| PREDICTED: beta-amylase 3, chloroplastic-like [Glycine max]
Length=548

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 136/188 (72%), Gaps = 9/188 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FFL WYS  LL+HGE+IL SA  IF++ GVK+S K+AGIHWHY  RSHA ELTA
Sbjct  333  NTEYGRFFLDWYSTKLLEHGEKILVSAKGIFNSCGVKLSAKVAGIHWHYKARSHAAELTA  392

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQMLA+HG + NFTC+EMRD EQP+   C+PE LV QV +A + A+
Sbjct  393  GYYNTRFRDGYLPIAQMLAKHGVVLNFTCMEMRDREQPE--HCSPEGLVHQVKIAARTAE  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q+L TS       +    + AFTYLRMN  LF+ DNWR FV 
Sbjct  451  AELAGENALERYDAGAFSQVLSTS-------NSGSGLAAFTYLRMNKRLFEGDNWRLFVE  503

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  504  FVKSMSEG  511



>ref|XP_011070282.1| PREDICTED: beta-amylase 3, chloroplastic [Sesamum indicum]
Length=549

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 138/185 (75%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS+ L+DHGE+IL +A  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  335  YGQFFLKWYSEKLIDHGEKILTTAERIFQGTGAKLSGKVAGIHWHYKTRSHAAELTAGYY  394

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYL IA+M ++HG +FNFTC+EMRD EQP +A C+PE LVRQV LAT+ A   L
Sbjct  395  NTRHRDGYLAIARMFSKHGVVFNFTCMEMRDGEQPGEANCSPEGLVRQVKLATKTAGAEL  454

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A  Q+L T        SG+  + AFTYLRMN  LF+ADNWR FV FV+
Sbjct  455  AGENALERYDGGAFSQVLATGRSG----SGN-GLNAFTYLRMNKRLFEADNWRNFVEFVR  509

Query  551  KMKEG  565
             M EG
Sbjct  510  SMSEG  514



>ref|NP_001236350.1| beta-amylase [Glycine max]
 emb|CAI39244.1| beta-amylase [Glycine max]
 gb|KHN01649.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=540

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 139/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HGERIL SA  IF+ TGVK+S K+AGIHWHY  RSHA ELTA
Sbjct  323  NTEYGQFFLEWYSGKLLEHGERILVSAKGIFETTGVKLSGKVAGIHWHYRARSHAAELTA  382

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+MLA+HG +FNFTC+EM+D EQP  A C+PE LV QV +AT  A+
Sbjct  383  GYYNTRNNDGYLPIARMLAKHGVVFNFTCMEMKDREQPDFANCSPEGLVHQVKMATTTAR  442

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS    +  SG   + AFTYLRMN  LF+ADNWR  V 
Sbjct  443  AELAGENALERYDADAYAQVLSTS--KSESGSG---LAAFTYLRMNKRLFEADNWRHLVD  497

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  498  FVRSMSEG  505



>gb|KHG28698.1| Beta-amylase 3, chloroplastic -like protein [Gossypium arboreum]
Length=540

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS+ LL+HG+RIL +A   F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  326  NTEYGQFFLEWYSRKLLEHGDRILAAAKGTFHGTGAKLSAKVAGIHWHYRTRSHAAELTA  385

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY+PIAQM ++HG +FNFTC+EMRD EQP+ A C+PE LVRQV +AT+ A+
Sbjct  386  GYYNTRHHDGYVPIAQMFSKHGVVFNFTCMEMRDGEQPEYANCSPEGLVRQVKMATKIAR  445

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  ++ Q+L TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  446  VELAGENALERYDAGSYAQVLATSRSD----SGN-GLSAFTYLRMNKRLFEGDNWRHLVE  500

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  501  FVKNMSEG  508



>ref|XP_001768786.1| predicted protein [Physcomitrella patens]
 gb|EDQ66339.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 142/194 (73%), Gaps = 6/194 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG+FF+ WYS+MLL HGERIL  A  IF +T   IS K+AGIHWHYGTRSHA ELTA
Sbjct  281  STDYGQFFMEWYSEMLLAHGERILSVATGIFRDTEAVISGKVAGIHWHYGTRSHAAELTA  340

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY PIAQ+ A++G   NFTC EMRD EQP  A C+PE LV+QVA AT+ A 
Sbjct  341  GYYNTRTRDGYAPIAQLFAKYGVTLNFTCFEMRDLEQPSHALCSPEGLVKQVAFATRTAG  400

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD-----REMCAFTYLRMNPDLFQADNW  526
             P+AGENALPR+D  AHEQI+ +S L +    GD       M AFT+LRM+  +F ++NW
Sbjct  401  TPMAGENALPRFDSSAHEQIITSSRLRMPV-EGDCHQDYEPMAAFTFLRMSESMFHSENW  459

Query  527  RRFVAFVKKMKEGK  568
            R FV FV+ M+EG+
Sbjct  460  RLFVPFVRHMEEGR  473



>ref|XP_010919816.1| PREDICTED: beta-amylase 3, chloroplastic isoform X2 [Elaeis guineensis]
Length=509

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  LL+HG+RIL SA  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  294  YGKFFLEWYSGKLLEHGDRILASAEGIFRGTGAKLSGKVAGIHWHYRTRSHAAELTAGYY  353

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGYLP+AQMLA+ G + NFTC+EM+D +QP  A C+PE LV+QV  AT+ A   L
Sbjct  354  NTRYRDGYLPVAQMLAKRGVVLNFTCMEMKDEQQPSHANCSPELLVQQVKKATKAAGAEL  413

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD+ A+ Q+L TS    D   G   + AFTYLRMN  LF+ +NWR FVAF K
Sbjct  414  AGENALERYDESAYSQVLATS--RADPGIG---LSAFTYLRMNKKLFEGENWRNFVAFAK  468

Query  551  KMKEG  565
             M EG
Sbjct  469  SMSEG  473



>ref|XP_007039629.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 ref|XP_007039630.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 ref|XP_007039633.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24130.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24131.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24134.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
Length=575

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HG+RIL +A  IF  TG  +S KIAGIHWHY TRSHA ELTA
Sbjct  360  NTEYGQFFLEWYSGKLLEHGDRILAAAKGIFHGTGAILSGKIAGIHWHYRTRSHAAELTA  419

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIAQML++HG +FNFTC+EMRD EQP  A C+PE LVRQV +AT+ A 
Sbjct  420  GYYNTRHRDGYLPIAQMLSKHGVVFNFTCMEMRDGEQPDQANCSPEGLVRQVKMATRTAG  479

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS       SG+  + AFTYLRMN  LF+  NWR  V 
Sbjct  480  GELAGENALERYDAGAYSQVLATSRSD----SGN-GLSAFTYLRMNKRLFEGGNWRHLVE  534

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  535  FVKNMSEG  542



>ref|XP_004245844.1| PREDICTED: beta-amylase 3, chloroplastic [Solanum lycopersicum]
Length=546

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 137/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  LL+HG+RIL +  +I+  TG K+S KIAGIHWHY TRSHA ELTAGYY
Sbjct  332  YGQFFLEWYSGKLLEHGDRILAAGESIYQGTGAKLSGKIAGIHWHYNTRSHAAELTAGYY  391

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIA+MLA+HG + NFTC+EMRD EQPQ A C+PE LVRQV  A + A+V L
Sbjct  392  NTRHRDGYLPIARMLAKHGVVLNFTCMEMRDGEQPQSANCSPEGLVRQVKTAARTAEVEL  451

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A  Q+L TS       SG+  + AFT+LRMN  LF+ +NWR  V FVK
Sbjct  452  AGENALERYDGGAFSQVLATSMSD----SGN-GLSAFTFLRMNKRLFEPENWRNLVQFVK  506

Query  551  KMKEG  565
             M EG
Sbjct  507  SMSEG  511



>ref|XP_003611409.1| Beta-amylase [Medicago truncatula]
 gb|AES94367.1| beta-amylase [Medicago truncatula]
Length=543

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 137/188 (73%), Gaps = 11/188 (6%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  L++HGE+IL SA +IF  +GVK+S KIAGIHWHY  RSHA ELTA
Sbjct  332  NTEYGDFFLDWYSSKLVEHGEKILVSAKSIFQTSGVKLSAKIAGIHWHYNARSHATELTA  391

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRF DGY+PIAQMLA+HG I NFTC+EM+D+EQP  A C+PE LV QV +AT+ A 
Sbjct  392  GYYNTRFHDGYIPIAQMLAKHGVILNFTCMEMKDNEQPGHANCSPEGLVNQVKMATKIAG  451

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS LS           AFTYLR+N  L + +NWR+FV 
Sbjct  452  GELAGENALERYDSSAYGQVLSTSGLS-----------AFTYLRINKRLLEGENWRQFVD  500

Query  542  FVKKMKEG  565
            FV  M +G
Sbjct  501  FVVSMSDG  508



>ref|XP_006385389.1| beta-amylase family protein [Populus trichocarpa]
 gb|ERP63186.1| beta-amylase family protein [Populus trichocarpa]
Length=547

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 139/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HGE+IL +A  IF  TG ++S K+AGIHWHY TRSHA ELTA
Sbjct  330  NTEYGQFFLEWYSGKLLEHGEKILAAAEGIFQGTGAQLSGKVAGIHWHYRTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M ++HG +FNFTC+EMRD EQP+ A C+P+ LVRQV +AT+ A 
Sbjct  390  GYYNTRHHDGYLPIARMFSKHGVVFNFTCMEMRDGEQPEHANCSPQGLVRQVKMATRTAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS       SG+  + AFTYLRMN  LF+ DNWR+ V 
Sbjct  450  TELAGENALERYDAGAYTQVLATSRSE----SGN-GLTAFTYLRMNKKLFEGDNWRQLVE  504

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  505  FVKSMSEG  512



>gb|AFO84076.1| beta-amylase [Actinidia chinensis]
Length=547

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 139/185 (75%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS MLL+HG+RIL +AN IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  333  YGQFFLDWYSGMLLEHGDRILAAANGIFQGTGAKLSGKVAGIHWHYRTRSHAAELTAGYY  392

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR +DGYLPIA+M+ ++G I NFTC+EMRD EQP +A C+PE LVRQV +AT+ A   L
Sbjct  393  NTRHQDGYLPIARMMGKYGVIMNFTCMEMRDGEQPGNANCSPEGLVRQVKMATKTAGTEL  452

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A+ Q+L TS       SG+  + AFTYLRMN  LF+ +NWR  V FV+
Sbjct  453  AGENALERYDAGAYSQVLTTSRSD----SGN-GLSAFTYLRMNKRLFEGENWRHLVEFVR  507

Query  551  KMKEG  565
             M EG
Sbjct  508  NMSEG  512



>ref|NP_001275172.1| beta-amylase PCT-BMYI [Solanum tuberosum]
 gb|AAK84008.1|AF393847_1 beta-amylase PCT-BMYI [Solanum tuberosum]
Length=545

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 139/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FFL WYS  LL+HG+RIL +  +I+  TG K+S K+AGIHWHY TRSHA ELT+
Sbjct  328  NSEYGQFFLEWYSGKLLEHGDRILAAGESIYQGTGAKLSGKVAGIHWHYNTRSHAAELTS  387

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIA+MLA+HGA+ NFTC+EMRD EQPQ A C+PE LVRQV  A + A+
Sbjct  388  GYYNTRHRDGYLPIARMLAKHGAVLNFTCMEMRDGEQPQSANCSPEGLVRQVKTAARTAE  447

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A  Q+L TS       SG+  + AFT+LRMN  LF+ +NWR  V 
Sbjct  448  VELAGENALERYDGGAFSQVLATSMSD----SGN-GLSAFTFLRMNKRLFEPENWRNLVQ  502

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  503  FVKSMSEG  510



>ref|XP_010531694.1| PREDICTED: beta-amylase 3, chloroplastic-like [Tarenaya hassleriana]
Length=549

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 5/186 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  LL+HG++IL ++  IF  TG K+S KIAGIHWHY TRSHA ELTAGYY
Sbjct  333  YGQFFLEWYSGKLLEHGDKILAASKGIFQGTGAKLSGKIAGIHWHYNTRSHAAELTAGYY  392

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR +DGYLPIAQML +HGA+ NFTC+EMRD EQP  + C+PE LVRQV  AT++A   L
Sbjct  393  NTRDQDGYLPIAQMLGKHGAVLNFTCMEMRDGEQPDCSNCSPEGLVRQVKTATRKAGTEL  452

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDR-EMCAFTYLRMNPDLFQADNWRRFVAFV  547
            AGENAL RYD  A  Q++ TS       SG+R  + AFTYLRMN  LF+ +NW++FV FV
Sbjct  453  AGENALERYDASAFRQVVATSRSD----SGNRVGVAAFTYLRMNKRLFEGENWQQFVEFV  508

Query  548  KKMKEG  565
            K MKEG
Sbjct  509  KNMKEG  514



>ref|XP_003524296.1| PREDICTED: beta-amylase 3, chloroplastic-like [Glycine max]
 gb|KHN08412.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=547

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HGERIL SA  IF  TGVK+S K+AGIHWHY  RSHA ELTA
Sbjct  330  NTEYGQFFLEWYSGKLLEHGERILVSAKGIFQTTGVKLSGKVAGIHWHYRARSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+MLA+HG +FNFTC+EM+D EQP  A C+PE LV QV +AT  A+
Sbjct  390  GYYNTRHNDGYLPIARMLAKHGVVFNFTCMEMKDREQPDFAYCSPEGLVHQVKMATTTAR  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS    +  SG   + AFTYLRMN  LF+ DNWR  V 
Sbjct  450  AELAGENALERYDADAYAQVLSTS--KSESGSG---LAAFTYLRMNKRLFEGDNWRHLVD  504

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  505  FVRNMSEG  512



>ref|XP_008794866.1| PREDICTED: beta-amylase 3, chloroplastic [Phoenix dactylifera]
Length=547

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 138/185 (75%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  LL HG+RIL +A  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  332  YGKFFLEWYSGKLLGHGDRILAAAEGIFRGTGAKLSGKVAGIHWHYQTRSHAAELTAGYY  391

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGYLP+AQMLA+ G + NFTC+EMRD +QP  A C+PE LV+QV  AT+ A+  L
Sbjct  392  NTRYRDGYLPVAQMLAKRGVVLNFTCMEMRDEQQPGHANCSPELLVQQVKKATKVARAEL  451

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD+ A+ Q+L TS    D   G   + AFTYLRMN  LF+ +NWR FVAFVK
Sbjct  452  AGENALERYDESAYSQVLATS--RADPGVG---LSAFTYLRMNKKLFEGENWRHFVAFVK  506

Query  551  KMKEG  565
             M EG
Sbjct  507  SMAEG  511



>ref|XP_011018667.1| PREDICTED: beta-amylase 3, chloroplastic-like [Populus euphratica]
Length=547

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 139/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HGE+IL +A  IF  TG ++S K+AGIHWHY TRSHA ELTA
Sbjct  330  NTEYGQFFLEWYSGKLLEHGEKILAAAEGIFRGTGAQLSGKVAGIHWHYRTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M ++HG +FNFTC+EMRD EQP+ A C+P+ LVRQV +AT+ A 
Sbjct  390  GYYNTRHHDGYLPIARMFSKHGVVFNFTCMEMRDGEQPEHANCSPQGLVRQVKMATRTAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q++ TS       SG+  + AFTYLRMN  LF+ DNWR+ V 
Sbjct  450  TELAGENALERYDAGAYSQVMATSRSE----SGN-GLTAFTYLRMNKKLFEGDNWRQLVE  504

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  505  FVKSMSEG  512



>ref|XP_010919815.1| PREDICTED: beta-amylase 3, chloroplastic isoform X1 [Elaeis guineensis]
Length=546

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 137/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  LL+HG+RIL SA  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  331  YGKFFLEWYSGKLLEHGDRILASAEGIFRGTGAKLSGKVAGIHWHYRTRSHAAELTAGYY  390

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGYLP+AQMLA+ G + NFTC+EM+D +QP  A C+PE LV+QV  AT+ A   L
Sbjct  391  NTRYRDGYLPVAQMLAKRGVVLNFTCMEMKDEQQPSHANCSPELLVQQVKKATKAAGAEL  450

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD+ A+ Q+L TS    D   G   + AFTYLRMN  LF+ +NWR FVAF K
Sbjct  451  AGENALERYDESAYSQVLATS--RADPGIG---LSAFTYLRMNKKLFEGENWRNFVAFAK  505

Query  551  KMKEG  565
             M EG
Sbjct  506  SMSEG  510



>ref|XP_006385589.1| beta-amylase family protein [Populus trichocarpa]
 gb|ABK95564.1| unknown [Populus trichocarpa]
 gb|ERP63386.1| beta-amylase family protein [Populus trichocarpa]
Length=548

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 138/187 (74%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YG+FFL WYS  LL+HG++IL +A  IF  TG K+S K+AGIHWHYGTRSHA ELTAG
Sbjct  332  TEYGQFFLEWYSGKLLEHGDKILAAAEGIFRGTGAKLSGKVAGIHWHYGTRSHAAELTAG  391

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR  DGYLP+A+M ++HG +FNFTC+EMRD EQPQ A C+PE LVRQV +AT+ A+ 
Sbjct  392  YYNTRHHDGYLPMARMFSKHGVVFNFTCMEMRDGEQPQHANCSPEGLVRQVKMATRTART  451

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD  A  Q++ TS       SG+  + AFTYLRMN  LF+ DNW   V F
Sbjct  452  ELAGENALERYDAGAFSQVMATSRSE----SGN-GLTAFTYLRMNKRLFEGDNWLHLVQF  506

Query  545  VKKMKEG  565
            V+ M EG
Sbjct  507  VESMSEG  513



>gb|KDP45986.1| hypothetical protein JCGZ_11889 [Jatropha curcas]
Length=547

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 136/187 (73%), Gaps = 5/187 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HG+ IL +A  IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  330  NTEYGQFFLEWYSGKLLNHGDGILAAAKGIFQGTGAKLSGKVAGIHWHYRTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+  ++HG +FNFTC+EM+D EQP+ A C+PE LVRQV + T+ A 
Sbjct  390  GYYNTRHHDGYLPIARTFSKHGVVFNFTCMEMQDKEQPESANCSPEGLVRQVKMVTKTAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  AH Q+L TS       SG+  + AFTYLRMN  LF+ADNWR  V 
Sbjct  450  VELAGENALERYDAGAHAQVLATSRSE----SGN-GLVAFTYLRMNKKLFEADNWRNLVE  504

Query  542  FVKKMKE  562
            FVK M E
Sbjct  505  FVKSMSE  511



>ref|XP_004511752.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cicer arietinum]
Length=545

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 135/187 (72%), Gaps = 11/187 (6%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FFL WYS  L++HGE+IL SA  IF  + VK+S KIAGIHWHY  RSHA ELTA
Sbjct  333  NTEYGNFFLDWYSTKLVEHGEKILVSAKNIFQTSEVKLSAKIAGIHWHYNARSHATELTA  392

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+ DGYLPIA+MLA+HG + NFTC+EM+D+EQP  A C+PE LV QV  AT+ A 
Sbjct  393  GYYNTRYHDGYLPIAKMLAKHGVVLNFTCMEMKDNEQPHHANCSPEGLVNQVKNATKIAG  452

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A++Q+L+TS LS           AFTYLRMN  LF+ DNWR FV 
Sbjct  453  GELAGENALERYDSSAYDQVLKTSGLS-----------AFTYLRMNRRLFEGDNWRNFVE  501

Query  542  FVKKMKE  562
            FVK M +
Sbjct  502  FVKNMSD  508



>ref|NP_001065418.2| Os10g0565200 [Oryza sativa Japonica Group]
 dbj|BAF27255.2| Os10g0565200 [Oryza sativa Japonica Group]
Length=522

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 140/187 (75%), Gaps = 8/187 (4%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YG+FFL WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTAG
Sbjct  306  TEYGDFFLGWYSGMLLEHGDRVLAAAEAVFRGTGAALSAKVAGIHWHYRTRSHAAELTAG  365

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR RDGY P+A MLAR GA+ NFTC+EMRD +QP+ A C+PE+LVRQV  A + A+V
Sbjct  366  YYNTRRRDGYAPVAAMLARRGAVLNFTCMEMRDEQQPEHAGCSPEQLVRQVRSAARAARV  425

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD+ A  Q++ T+A +         + AFTYLRMN  LF  DNWR+FV+F
Sbjct  426  GLAGENALERYDEAAFAQVVATAASA--------GLGAFTYLRMNKKLFDGDNWRQFVSF  477

Query  545  VKKMKEG  565
            V+ M +G
Sbjct  478  VRAMADG  484



>ref|XP_010055392.1| PREDICTED: beta-amylase 3, chloroplastic [Eucalyptus grandis]
 gb|KCW71851.1| hypothetical protein EUGRSUZ_E00330 [Eucalyptus grandis]
Length=543

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS+ LL+HG+RIL +A  +F  T VK+S K+AGIHWHY TRSHA ELTA
Sbjct  327  NTEYGKFFLEWYSEKLLEHGDRILAAAKGVFQGTQVKLSGKVAGIHWHYRTRSHAAELTA  386

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+ DGYLPIA+M+ +HG + NFTC+EMRD EQP+ A C+PE LVRQV +A + A 
Sbjct  387  GYYNTRYHDGYLPIARMMGKHGVVLNFTCMEMRDGEQPEHANCSPEGLVRQVKVAAKTAG  446

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD+ A+ Q+L TS       SG+  + AFTYLRMN  LF+ +NWR    
Sbjct  447  TDLAGENALERYDEGAYAQVLLTSRSD----SGN-SLSAFTYLRMNKRLFEENNWRNLAG  501

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  502  FVKSMSEG  509



>ref|XP_007209867.1| hypothetical protein PRUPE_ppa003812mg [Prunus persica]
 gb|EMJ11066.1| hypothetical protein PRUPE_ppa003812mg [Prunus persica]
Length=547

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL HG+RIL +A  +F  +G K+S KIAGIHWHYG+RSHA ELTA
Sbjct  330  NTEYGQFFLEWYSGKLLRHGDRILTAAKGVFQGSGAKLSGKIAGIHWHYGSRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLP A+M +++G + NFTC+EM+D EQP  A C+PE LVRQV +AT+ A 
Sbjct  390  GYYNTRHRDGYLPTARMFSKNGVVLNFTCMEMKDREQPAHANCSPEGLVRQVKMATKSAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A EQ+L TS       SG+  + AFTYLRMN  LF+ADNWR  V 
Sbjct  450  IDLAGENALERYDTGAFEQVLATSRSD----SGN-ALSAFTYLRMNKRLFEADNWRNMVE  504

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  505  FVRGMGDG  512



>ref|XP_007155732.1| hypothetical protein PHAVU_003G226900g [Phaseolus vulgaris]
 gb|ESW27726.1| hypothetical protein PHAVU_003G226900g [Phaseolus vulgaris]
Length=548

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FFL WYS  LL+HGE+IL SA  IF  +GVK+S K+AGIHWHY  RSHA ELTA
Sbjct  331  NTEYGRFFLEWYSGKLLEHGEKILVSAQGIFHTSGVKLSGKVAGIHWHYRARSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY+PIA+MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +AT  A+
Sbjct  391  GYYNTRNNDGYMPIARMLAKHGVVFNFTCMEMKDREQPDFANCSPEGLVRQVKMATTTAR  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS            + AFTYLRMN  LF+ DNWR  V 
Sbjct  451  AELAGENALERYDADAYAQVLSTSKS-----ESSNGLAAFTYLRMNKRLFEGDNWRHLVD  505

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  506  FVRSMSEG  513



>gb|AFQ33620.1| beta-amylase 8 [Citrus trifoliata]
Length=373

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 142/190 (75%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FF+ WYS  L+ HG+RIL +A  IF  TG K+S K+AGIHWHY +RSHA ELTA
Sbjct  156  NSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTA  215

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+ DGY+PIA+MLA+HG I NFTC+EMRD EQP +A C+PE LVRQV +AT+ A 
Sbjct  216  GYYNTRYCDGYIPIARMLAKHGVILNFTCMEMRDREQPGNANCSPEGLVRQVKMATRTAG  275

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A+ Q+L TS L  D  +G   + AFTYLRMN  LF+++NWR  V 
Sbjct  276  VELAGENALERYDADAYAQVLATSNL--DAGNG---LSAFTYLRMNKKLFESENWRNLVE  330

Query  542  FVKKM-KEGK  568
            FV++M  EG+
Sbjct  331  FVQRMSSEGR  340



>ref|XP_006477060.1| PREDICTED: beta-amylase 3, chloroplastic isoform X2 [Citrus sinensis]
 gb|KDO57012.1| hypothetical protein CISIN_1g047891mg [Citrus sinensis]
Length=551

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 141/187 (75%), Gaps = 6/187 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG FF+ WYS  L+ HG+RIL +A  IF  TG K+S K+AGIHWHY +RSHA ELTAGYY
Sbjct  337  YGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYY  396

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGY+PIA+MLA+HG I NFTC+EMRD EQP +A C+PE LVRQV +AT+ A V L
Sbjct  397  NTRYRDGYIPIARMLAKHGVILNFTCMEMRDTEQPGNANCSPEGLVRQVKMATRTAGVEL  456

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A+ Q+L TS L  D  +G   + AFTYLRMN  LF +DNWR  V FV+
Sbjct  457  AGENALERYDADAYAQVLATSNL--DAGNG---LSAFTYLRMNKKLFMSDNWRNLVEFVQ  511

Query  551  KM-KEGK  568
            +M  EG+
Sbjct  512  RMSSEGR  518



>ref|XP_008229498.1| PREDICTED: beta-amylase 3, chloroplastic [Prunus mume]
Length=547

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FF+ WYS  LL HG+RIL +A  +F  +G K+S KIAGIHWHYG+RSHA ELTA
Sbjct  330  NTEYGQFFMEWYSGKLLRHGDRILTAAKGVFQGSGAKLSGKIAGIHWHYGSRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLP A+M +++G + NFTC+EM+D EQP  A C+PE LVRQV +AT+ A 
Sbjct  390  GYYNTRHRDGYLPTARMFSKNGVVLNFTCMEMKDREQPAHANCSPEGLVRQVKMATKSAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A EQIL TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  450  IDLAGENALERYDTGAFEQILATSRSD----SGN-ALSAFTYLRMNKRLFEGDNWRNMVE  504

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  505  FVRGMAEG  512



>gb|AAG60205.1|AC084763_25 putative chloroplast-targeted beta-amylase [Oryza sativa Japonica 
Group]
 gb|AAP55052.1| Glycosyl hydrolase family 14 protein, expressed [Oryza sativa 
Japonica Group]
Length=544

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 140/187 (75%), Gaps = 8/187 (4%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YG+FFL WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTAG
Sbjct  328  TEYGDFFLGWYSGMLLEHGDRVLAAAEAVFRGTGAALSAKVAGIHWHYRTRSHAAELTAG  387

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR RDGY P+A MLAR GA+ NFTC+EMRD +QP+ A C+PE+LVRQV  A + A+V
Sbjct  388  YYNTRRRDGYAPVAAMLARRGAVLNFTCMEMRDEQQPEHAGCSPEQLVRQVRSAARAARV  447

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD+ A  Q++ T+A +         + AFTYLRMN  LF  DNWR+FV+F
Sbjct  448  GLAGENALERYDEAAFAQVVATAASA--------GLGAFTYLRMNKKLFDGDNWRQFVSF  499

Query  545  VKKMKEG  565
            V+ M +G
Sbjct  500  VRAMADG  506



>ref|XP_006477059.1| PREDICTED: beta-amylase 3, chloroplastic isoform X1 [Citrus sinensis]
Length=554

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 141/187 (75%), Gaps = 6/187 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG FF+ WYS  L+ HG+RIL +A  IF  TG K+S K+AGIHWHY +RSHA ELTAGYY
Sbjct  340  YGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYY  399

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR+RDGY+PIA+MLA+HG I NFTC+EMRD EQP +A C+PE LVRQV +AT+ A V L
Sbjct  400  NTRYRDGYIPIARMLAKHGVILNFTCMEMRDTEQPGNANCSPEGLVRQVKMATRTAGVEL  459

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A+ Q+L TS L  D  +G   + AFTYLRMN  LF +DNWR  V FV+
Sbjct  460  AGENALERYDADAYAQVLATSNL--DAGNG---LSAFTYLRMNKKLFMSDNWRNLVEFVQ  514

Query  551  KM-KEGK  568
            +M  EG+
Sbjct  515  RMSSEGR  521



>ref|XP_004983616.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform X1 [Setaria 
italica]
Length=557

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 139/188 (74%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG+FFL WYS MLL+HG+R+L +A+A+F  TG  +S K+AGIHWHYGTRSHA ELTA
Sbjct  337  STEYGQFFLEWYSGMLLEHGDRVLAAADAVFGGTGATLSAKVAGIHWHYGTRSHAAELTA  396

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY PIA+MLA+ GA+ NFTC+EM+D +QPQ A C+PE+LV+QV  A   A 
Sbjct  397  GYYNTRHHDGYAPIARMLAKRGAVLNFTCMEMKDEQQPQHASCSPEQLVQQVKAAASAAG  456

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q++ T+  +         + AFTYLRMN  LF  DNWR FV+
Sbjct  457  VELAGENALERYDEAAFSQVVSTARGA--------GLAAFTYLRMNKALFDGDNWREFVS  508

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  509  FVRAMADG  516



>ref|XP_004983617.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform X2 [Setaria 
italica]
Length=558

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 139/188 (74%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG+FFL WYS MLL+HG+R+L +A+A+F  TG  +S K+AGIHWHYGTRSHA ELTA
Sbjct  338  STEYGQFFLEWYSGMLLEHGDRVLAAADAVFGGTGATLSAKVAGIHWHYGTRSHAAELTA  397

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY PIA+MLA+ GA+ NFTC+EM+D +QPQ A C+PE+LV+QV  A   A 
Sbjct  398  GYYNTRHHDGYAPIARMLAKRGAVLNFTCMEMKDEQQPQHASCSPEQLVQQVKAAASAAG  457

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q++ T+  +         + AFTYLRMN  LF  DNWR FV+
Sbjct  458  VELAGENALERYDEAAFSQVVSTARGA--------GLAAFTYLRMNKALFDGDNWREFVS  509

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  510  FVRAMADG  517



>tpg|DAA46351.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=363

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL+WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  143  STEYGHFFLAWYSGMLLEHGDRVLAAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTA  202

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY PIA+MLA+ GA+ NFTC+EM+D +QP+ A C+PE LV+QV  A   A 
Sbjct  203  GYYNTRDRDGYAPIARMLAKRGAVLNFTCMEMKDEQQPKHASCSPELLVQQVKTAASAAG  262

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+  +         + AFTYLRMN  LF  DNWR+FV+
Sbjct  263  VELAGENALERYDEAAFSQVASTARGA--------GLAAFTYLRMNKTLFDGDNWRQFVS  314

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  315  FVRAMADG  322



>ref|XP_003539125.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform 1 [Glycine 
max]
 gb|KHN34883.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=554

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 136/188 (72%), Gaps = 9/188 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  L++HGE+IL SA  IF++ GVK+S K+AGIHWHY TRSHA ELTA
Sbjct  339  NTEYGQFFLDWYSTKLVEHGEKILVSAKGIFNSCGVKLSAKVAGIHWHYKTRSHAAELTA  398

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRFRDGYLPIAQM+A+HG + NFTC+EMRD EQ +   C+PE LV QV +A + A 
Sbjct  399  GYYNTRFRDGYLPIAQMVAKHGVVLNFTCMEMRDREQHE--HCSPEGLVHQVKMAARTAG  456

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q+L TS       +    + AFTYLRMN  LF+ DNWR FV 
Sbjct  457  AELAGENALERYDAGAFSQVLSTS-------NSGSGLAAFTYLRMNRRLFEGDNWRHFVE  509

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  510  FVKCMSEG  517



>ref|XP_004300297.1| PREDICTED: beta-amylase 3, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FFL WYS+ LL HG+R+L +A  +F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  336  NTEYGRFFLEWYSEKLLRHGDRLLAAAKGVFQGTGAKLSGKVAGIHWHYRTRSHAAELTA  395

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY+P A+M ++HG + NFTC+EM+D EQP +A C+PE LVRQV +AT+ A 
Sbjct  396  GYYNTRLRDGYIPTAKMFSKHGVVLNFTCMEMKDGEQPDNANCSPEGLVRQVKMATKSAG  455

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A+ Q+L TS       SG+  + AFTYLR+N  LF+ DNWR  V 
Sbjct  456  IDLAGENALERYDSGAYGQVLATSRSD----SGN-ALSAFTYLRLNKRLFEGDNWRNMVE  510

Query  542  FVKKMKEG  565
            FVK M +G
Sbjct  511  FVKGMADG  518



>gb|KDO35878.1| hypothetical protein CISIN_1g017328mg [Citrus sinensis]
Length=373

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 140/190 (74%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FF+ WYS  L+ HG+RIL +A  IF  TG K+S K+AGIHWHY +RSHA ELTA
Sbjct  156  NSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTA  215

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+ DGY+PIA+MLA+HGAI NFTC+EMRD EQP +A C+PE LV+QV +AT+ A 
Sbjct  216  GYYNTRYCDGYIPIARMLAKHGAILNFTCMEMRDREQPGNANCSPEGLVQQVKMATRTAG  275

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A+ Q+L TS L          + AFTYLRM+  LF++DNWR  V 
Sbjct  276  VELAGENALERYDADAYAQVLATSNLDAGN-----GLGAFTYLRMHKKLFESDNWRNLVE  330

Query  542  FVKKM-KEGK  568
            FV++M  EG+
Sbjct  331  FVQRMSSEGR  340



>emb|CAN62440.1| hypothetical protein VITISV_032500 [Vitis vinifera]
Length=543

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            TT YG+FFL WYS  LL+HG+RIL +A  IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  326  TTEYGQFFLKWYSGKLLEHGDRILAAAEGIFQGTGAKLSGKVAGIHWHYKTRSHAAELTA  385

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M+ ++G + NFTC+EM+D EQ + A C+PE LVRQV +AT+ A 
Sbjct  386  GYYNTRNHDGYLPIARMMGKYGVVLNFTCMEMKDREQQEHANCSPEGLVRQVKMATKTAX  445

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  446  TELAGENALERYDSSAYAQVLATSRSD----SGN-GLSAFTYLRMNKRLFEGDNWRSLVE  500

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  501  FVRNMSEG  508



>ref|XP_002282871.1| PREDICTED: beta-amylase 3, chloroplastic [Vitis vinifera]
Length=543

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            TT YG+FFL WYS  LL+HG+RIL +A  IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  326  TTEYGQFFLKWYSGKLLEHGDRILAAAEGIFQGTGAKLSGKVAGIHWHYKTRSHAAELTA  385

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M+ ++G + NFTC+EM+D EQ + A C+PE LVRQV +AT+ A 
Sbjct  386  GYYNTRNHDGYLPIARMMGKYGVVLNFTCMEMKDREQQEHANCSPEGLVRQVKMATKTAG  445

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A+ Q+L TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  446  TELAGENALERYDSSAYAQVLATSRSD----SGN-GLSAFTYLRMNKRLFEGDNWRSLVE  500

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  501  FVRNMSEG  508



>ref|XP_004508980.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cicer arietinum]
Length=545

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FFL WYS  LL+HGERIL SA  IF  +GVK+S KIAGIHWHY +RSHA ELTA
Sbjct  327  NSEYGRFFLEWYSGKLLEHGERILVSAKDIFQTSGVKLSGKIAGIHWHYRSRSHAAELTA  386

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M A+HG +FNFTC+EM+D EQP  A C+PE LV QV  AT+ A+
Sbjct  387  GYYNTRHIDGYLPIAKMFAKHGVVFNFTCMEMKDREQPDHANCSPEGLVHQVKAATRTAK  446

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD   + Q+L TS    D  +G   + AFTYLRMN  LF+ DNWR  V 
Sbjct  447  IELAGENALERYDAGGYAQVLSTSV--SDSGTG---LAAFTYLRMNKKLFEGDNWRNLVD  501

Query  542  FVKKMKEG  565
            FV+ M  G
Sbjct  502  FVRNMSNG  509



>ref|XP_010695452.1| PREDICTED: beta-amylase 3, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=546

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  L++HG+ +L +AN IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  327  NTAYGKFFLGWYSAKLIEHGDNLLAAANGIFKETGAKLSGKVAGIHWHYKTRSHAAELTA  386

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN R +D YLP+A M A+HG +FNFTC+EM+D EQP  A C+PE LV+QV +ATQ A 
Sbjct  387  GYYNARDKDAYLPVANMFAKHGVVFNFTCMEMKDGEQPDHANCSPEGLVKQVKMATQIAG  446

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A+ Q+L TS       SG   + AFTYLRMN  LF+ DNWR  V 
Sbjct  447  IELAGENALERYDASAYGQVLATSKSH----SGS-GLSAFTYLRMNKRLFEGDNWRHLVE  501

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  502  FVKSMSEG  509



>gb|EYU17858.1| hypothetical protein MIMGU_mgv1a003946mg [Erythranthe guttata]
Length=553

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FFL WYS  L++HGE+IL +A  +F+ TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  334  NSEYGHFFLEWYSGNLINHGEKILAAAERVFEGTGAKLSGKVAGIHWHYKTRSHAAELTA  393

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIA+ML++H  + NFTC+EM+D EQP +A C+PE LVRQV +AT+ A+
Sbjct  394  GYYNTRHRDGYLPIARMLSKHRVVLNFTCMEMKDGEQPNEANCSPEGLVRQVKMATKTAR  453

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A+ Q+L TS       SG+  + AFTYLR+N  LF+ +NWR  V 
Sbjct  454  IDLAGENALERYDGGAYSQVLETSRSD----SGN-GLSAFTYLRLNKRLFEPENWRNLVE  508

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  509  FVRSMSEG  516



>ref|XP_004244551.1| PREDICTED: beta-amylase 3, chloroplastic-like [Solanum lycopersicum]
Length=542

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FFL WYS+ LL+HG+ IL SA  IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  326  NSEYGQFFLEWYSRKLLEHGDNILASAEGIFKGTGCKLSGKVAGIHWHYNTRSHAAELTA  385

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR +DGYLPIA+M A+ G +FNFTC+EMRD EQP  A C+PE LVRQV  AT+   
Sbjct  386  GYYNTRNKDGYLPIARMFAKRGVVFNFTCMEMRDGEQPHSANCSPEGLVRQVKNATRNVG  445

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD   + Q+L TS       SG+  + AFTYLR+N  LF+ +NWR  V 
Sbjct  446  VELAGENALERYDGGGYAQVLSTSRAD----SGN-GLSAFTYLRLNKRLFEPENWRNLVE  500

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  501  FVKNMSEG  508



>ref|XP_008658990.1| PREDICTED: uncharacterized protein LOC100502394 isoform X1 [Zea 
mays]
 gb|AFW87825.1| hypothetical protein ZEAMMB73_675891 [Zea mays]
Length=553

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL WYS MLL+HG+R++ +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  333  STEYGHFFLEWYSGMLLEHGDRVMDAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTA  392

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY PIA+MLA+ GA+ NFTC+EM+D +QPQ A C+PE LV+QV  AT  A 
Sbjct  393  GYYNTRGRDGYAPIARMLAKRGAVLNFTCMEMKDEQQPQHASCSPELLVQQVKAATSAAG  452

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYDD A  Q++ T+  +         + AFTYLRMN  LF  DNW RFV+
Sbjct  453  VQLAGENALERYDDAAFSQVVSTARGA--------GLAAFTYLRMNKTLFDGDNWGRFVS  504

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  505  FVRAMADG  512



>emb|CAX51379.1| beta-amylase [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 147/187 (79%), Gaps = 9/187 (5%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDN-TGVKISVKIAGIHWHYGTRSHAPELTA  181
            + YG+FF+SWYS+ML++HG+R+L  A ++F +  GV++SVK+AGIHWH+GT SHAPELTA
Sbjct  268  SEYGQFFMSWYSRMLIEHGDRVLSGAASVFGHEPGVRLSVKVAGIHWHHGTESHAPELTA  327

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIA ML RHGA+ NFTC+EMRD EQP+DA+C PE LVR+VA A + A 
Sbjct  328  GYYNTRRRDGYLPIASMLGRHGAVLNFTCVEMRDEEQPRDARCMPEGLVRRVAAAARGAG  387

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENALPRYDD A++Q+L T+         +  M AFTYLRM  DLFQ DNWRRF A
Sbjct  388  VGLAGENALPRYDDAAYDQVLVTAR--------EERMVAFTYLRMGSDLFQPDNWRRFAA  439

Query  542  FVKKMKE  562
            FV +M E
Sbjct  440  FVTRMSE  446



>dbj|BAJ95735.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 146/185 (79%), Gaps = 9/185 (5%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDN-TGVKISVKIAGIHWHYGTRSHAPELTAGY  187
            YG+FF+SWYS+ML++HG+R+L  A ++F +  GV++SVK+AGIHWH+GT SHAPELTAGY
Sbjct  289  YGQFFMSWYSRMLIEHGDRVLSGAASVFGHEPGVRLSVKVAGIHWHHGTESHAPELTAGY  348

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTR RDGYLPIA ML RHGA+ NFTC+EMRD EQP+DA+C PE LVR+VA A + A V 
Sbjct  349  YNTRRRDGYLPIASMLGRHGAVLNFTCVEMRDEEQPRDARCMPEGLVRRVAAAARGAGVG  408

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENALPRYDD A++Q+L T+         +  M AFTYLRM  DLFQ DNWRRF AFV
Sbjct  409  LAGENALPRYDDAAYDQVLVTAR--------EERMVAFTYLRMGSDLFQPDNWRRFAAFV  460

Query  548  KKMKE  562
             +M E
Sbjct  461  TRMSE  465



>ref|XP_002464915.1| hypothetical protein SORBIDRAFT_01g028700 [Sorghum bicolor]
 gb|EER91913.1| hypothetical protein SORBIDRAFT_01g028700 [Sorghum bicolor]
Length=557

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  337  STEYGHFFLEWYSGMLLEHGDRVLAAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTA  396

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY+PIA+MLA+ GA+ NFTC+EM+D +QPQ A C+PE LV+QV  A  +A 
Sbjct  397  GYYNTRDRDGYMPIARMLAKRGAVLNFTCMEMKDEQQPQHASCSPELLVQQVKAAASKAG  456

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+  +         + AFTYLRMN  LF  DNWR+FV+
Sbjct  457  VELAGENALERYDEAAFSQVTSTARGA--------GLAAFTYLRMNKTLFDGDNWRQFVS  508

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  509  FVRAMADG  516



>gb|KEH31589.1| beta-amylase [Medicago truncatula]
Length=541

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FFL WYS  LL+HG+RIL SA  IF  +GVK+S K+AGIHWHY +RSHA ELTA
Sbjct  323  NSEYGQFFLEWYSGKLLEHGDRILVSAKEIFQTSGVKLSGKVAGIHWHYRSRSHAAELTA  382

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M A H  +FNFTC+EM+D EQP  A C+PE LV QV  AT+ A 
Sbjct  383  GYYNTRHNDGYLPIAKMFANHDVVFNFTCMEMKDREQPGHANCSPEGLVHQVKKATKMAN  442

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD   + Q+L TS    D  SG   + AFTYLRMN  LF+ DNWR  V 
Sbjct  443  IELAGENALERYDSGGYAQVLSTSM--SDSGSG---LAAFTYLRMNKKLFEGDNWRHLVD  497

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  498  FVRNMSEG  505



>gb|AFQ33613.1| beta-amylase 1 [Citrus trifoliata]
Length=551

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 142/190 (75%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FF+ WYS  L+ HG+RIL +A  IF  TG K+S K+AGIHWHY +RSHA ELTA
Sbjct  334  NSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTA  393

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+ DGY+PIA+MLA+HG I NFTC+EMRD EQP +A C+PE LVRQV +AT+ A 
Sbjct  394  GYYNTRYCDGYIPIARMLAKHGVILNFTCMEMRDREQPGNANCSPEGLVRQVKMATRTAG  453

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A+ Q+L TS L  D  +G   + AFTYLRMN  LF+++NWR  V 
Sbjct  454  VELAGENALERYDADAYAQVLATSNL--DAGNG---LSAFTYLRMNKKLFESENWRNLVE  508

Query  542  FVKKM-KEGK  568
            FV++M  EG+
Sbjct  509  FVQRMSSEGR  518



>ref|XP_009772032.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=542

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 136/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  L++HG+RIL +A  I+  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  328  YGQFFLEWYSGKLVEHGDRILAAAEGIYQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYY  387

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR  +GYLPIA+M A+H  +FNFTC+EMRD EQPQ A C+PE LVRQV  AT  A+V L
Sbjct  388  NTRHTNGYLPIARMFAKHRVVFNFTCMEMRDGEQPQSANCSPEGLVRQVKNATTTAEVEL  447

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A+ Q+L TS       SG+  + AFT+LRMN  LF+ +NWR  V FVK
Sbjct  448  AGENALERYDGGAYSQVLATSRSD----SGN-GLSAFTFLRMNKRLFEPENWRNLVQFVK  502

Query  551  KMKEG  565
             M +G
Sbjct  503  NMSDG  507



>ref|XP_002517513.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF45055.1| Beta-amylase, putative [Ricinus communis]
Length=547

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 134/186 (72%), Gaps = 5/186 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YG+FFL WYS  LLDHG+RIL +A  IF  TG K+S K+AGIHWHY TRSHAPELTAG
Sbjct  331  TEYGQFFLEWYSGKLLDHGDRILAAAKGIFQGTGAKLSGKVAGIHWHYRTRSHAPELTAG  390

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR  DGYL +A M ++HG +FNFTC+EMRD EQP  A  +PE LVRQV +AT+ A V
Sbjct  391  YYNTRHHDGYLTVAHMFSKHGVVFNFTCMEMRDGEQPGHANSSPEGLVRQVKMATRSAGV  450

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD   + Q+L TS       SG+  + AFTYLRMN  LF+ D+W+  V F
Sbjct  451  ELAGENALERYDAAGYAQVLATSRSE----SGN-GLTAFTYLRMNKKLFEGDHWQHLVEF  505

Query  545  VKKMKE  562
            VK M E
Sbjct  506  VKSMSE  511



>emb|CDP13430.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FFL WYS  LL+HG+RIL +A  IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  330  NSEYGHFFLEWYSTKLLEHGDRILAAAEGIFQGTGAKLSGKVAGIHWHYKTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIA M+ +HG +FNFTC+EM+D +QP+ A C+P+ LVRQ+ +AT+ A 
Sbjct  390  GYYNTRHRDGYLPIANMMGKHGVVFNFTCMEMKDEQQPEYANCSPQGLVRQIKMATRTAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL R+D  A+ Q+L TS    D  +G   + AFTYLRMN  LF+ +NW+  V 
Sbjct  450  IELAGENALERHDAGAYAQVLATS--RSDAGNG---LSAFTYLRMNKHLFEPNNWQNLVE  504

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  505  FVKSMSEG  512



>ref|XP_009601320.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana tomentosiformis]
Length=546

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 136/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS  L++HG+RIL +A  I+  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  332  YGQFFLEWYSGKLVEHGDRILAAAEGIYQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYY  391

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR  +GYLPIA M A+H  +FNFTC+EMRD EQPQ A C+PE LVRQV  AT+ A+V L
Sbjct  392  NTRHTNGYLPIAHMFAKHRVVFNFTCMEMRDGEQPQSANCSPEGLVRQVKNATRTAEVEL  451

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A+ Q+L TS       SG+  + AFT+LRMN  LF+ +NWR  V FVK
Sbjct  452  AGENALERYDGGAYSQVLATSRSE----SGN-GLSAFTFLRMNKRLFEPENWRNLVQFVK  506

Query  551  KMKEG  565
             M +G
Sbjct  507  NMSDG  511



>ref|XP_010274550.1| PREDICTED: beta-amylase 3, chloroplastic [Nelumbo nucifera]
Length=547

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FFL WYS MLL+HG+R+L +A  IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGQFFLEWYSGMLLEHGDRVLAAAEGIFKGTGAKLSGKVAGIHWHYRTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLPIA+M+ + G + NFTC+EM+D EQP  A C+PE LVRQV +A++ A 
Sbjct  391  GYYNTRHRDGYLPIARMMGKRGVVLNFTCMEMKDWEQPDYANCSPEGLVRQVKMASKTAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD+ A  Q+L TS    D  +G   + AFT+LRMN  LF+  NWR  VA
Sbjct  451  TELAGENALERYDEGAFAQVLATS--RSDAGNG---LSAFTHLRMNKRLFEEGNWRNLVA  505

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  506  FVKNMSEG  513



>ref|XP_006440139.1| hypothetical protein CICLE_v10019566mg [Citrus clementina]
 gb|ESR53379.1| hypothetical protein CICLE_v10019566mg [Citrus clementina]
Length=551

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 143/190 (75%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FF+ WYS  L+ HG+RIL +A  IF  TG K+S K+AGIHWHY +RSHA ELTA
Sbjct  334  NSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTA  393

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+ DGY+PIA+MLA+HGAI NFTC+EMRD EQP +A C+PE LV+QV +AT+ A 
Sbjct  394  GYYNTRYCDGYIPIARMLAKHGAILNFTCMEMRDREQPGNANCSPEGLVQQVKMATRTAG  453

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A+ Q+L TS L  D  +G   + AFTYLRM+  LF++DNWR  V 
Sbjct  454  VELAGENALERYDADAYAQVLATSNL--DAGNG---LGAFTYLRMHKKLFESDNWRNLVE  508

Query  542  FVKKM-KEGK  568
            FV++M  EG+
Sbjct  509  FVQRMSSEGR  518



>tpg|DAA46353.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=534

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL+WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  314  STEYGHFFLAWYSGMLLEHGDRVLAAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTA  373

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY PIA+MLA+ GA+ NFTC+EM+D +QP+ A C+PE LV+QV  A   A 
Sbjct  374  GYYNTRDRDGYAPIARMLAKRGAVLNFTCMEMKDEQQPKHASCSPELLVQQVKTAASAAG  433

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+  +         + AFTYLRMN  LF  DNWR+FV+
Sbjct  434  VELAGENALERYDEAAFSQVASTARGA--------GLAAFTYLRMNKTLFDGDNWRQFVS  485

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  486  FVRAMADG  493



>ref|XP_009759389.1| PREDICTED: beta-amylase 3, chloroplastic-like, partial [Nicotiana 
sylvestris]
Length=418

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FFL WYS  LL+HG+RIL +A +I+  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  208  NSEYGKFFLEWYSGKLLEHGDRILGAAESIYQGTGAKLSGKVAGIHWHYNTRSHAAELTA  267

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  +GYLPIA+M  +H  +FNFTC+EMRD EQPQ A C+PE LVRQV  AT+ ++
Sbjct  268  GYYNTRDTNGYLPIARMFGKHHVVFNFTCMEMRDGEQPQSANCSPEGLVRQVKYATRTSE  327

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A+ Q+L TS       SG+  + AFT+LRMN  LF+ +NW+    
Sbjct  328  VELAGENALERYDEGAYSQVLATSRSG----SGN-ALSAFTFLRMNKRLFEPENWQNLGQ  382

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  383  FVKSMSEG  390



>ref|XP_006414272.1| hypothetical protein EUTSA_v10024842mg [Eutrema salsugineum]
 dbj|BAJ34236.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55725.1| hypothetical protein EUTSA_v10024842mg [Eutrema salsugineum]
Length=548

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 136/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FF+ WYS+ LL+HG+R+L SA  IF  TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  333  YGKFFMEWYSEKLLEHGDRLLASAKGIFQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYY  392

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A   L
Sbjct  393  NTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTEL  452

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V FVK
Sbjct  453  AGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVEFVK  507

Query  551  KMKEG  565
             MKEG
Sbjct  508  NMKEG  512



>ref|XP_008658465.1| PREDICTED: beta-amylase 3, chloroplastic-like [Zea mays]
 tpg|DAA46352.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=551

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL+WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  331  STEYGHFFLAWYSGMLLEHGDRVLAAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY PIA+MLA+ GA+ NFTC+EM+D +QP+ A C+PE LV+QV  A   A 
Sbjct  391  GYYNTRDRDGYAPIARMLAKRGAVLNFTCMEMKDEQQPKHASCSPELLVQQVKTAASAAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+  +         + AFTYLRMN  LF  DNWR+FV+
Sbjct  451  VELAGENALERYDEAAFSQVASTARGA--------GLAAFTYLRMNKTLFDGDNWRQFVS  502

Query  542  FVKKMKEG  565
            FV+ M +G
Sbjct  503  FVRAMADG  510



>ref|XP_006362484.1| PREDICTED: beta-amylase 3, chloroplastic-like [Solanum tuberosum]
Length=541

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 133/188 (71%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FFL WYS+ LL+HG+ IL SA  IF  T  K+S K+AGIHWHY TRSHA ELTA
Sbjct  325  NSEYGQFFLEWYSRKLLEHGDNILASAEGIFKGTSCKLSGKVAGIHWHYNTRSHAAELTA  384

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR +DGYLPIA+M  + G +FNFTC+EMRD EQP  A C+PE LVRQV  AT+   
Sbjct  385  GYYNTRNKDGYLPIARMFVKRGVVFNFTCMEMRDGEQPHSANCSPEGLVRQVKNATRNVG  444

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD   + Q+L TS       SG+  + AFTYLR+N  LF+ +NWR  V 
Sbjct  445  VELAGENALERYDGGGYAQVLSTSRAD----SGN-GLSAFTYLRLNKRLFEPENWRNLVE  499

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  500  FVKNMSEG  507



>gb|KFK45005.1| hypothetical protein AALP_AA1G332100 [Arabis alpina]
Length=548

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG FF+ WYS MLL+HG+++L SA+ IF  +GV +S K+AGIHWHY TRSHA ELTA
Sbjct  330  NTEYGRFFMEWYSGMLLEHGDKLLASASGIFHGSGVTLSGKVAGIHWHYNTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EMRD EQP+ A C+PE LV+QV  AT++A 
Sbjct  390  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMRDGEQPEHANCSPEGLVKQVQNATRQAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  450  TELAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  504

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  505  FVKNMKEG  512



>gb|AFP89361.1| beta-amylase [Citrus limon]
Length=551

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 141/190 (74%), Gaps = 6/190 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG FF+ WYS  L+ HG+RIL +A  IF  TG K+S K+AGIHWHY +RSHA ELTA
Sbjct  334  NSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTA  393

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR+ DGY+PIA+MLA+HG I NFTC+EMRD EQP +A C+PE LVRQV +AT+ A 
Sbjct  394  GYYNTRYCDGYIPIARMLAKHGVILNFTCMEMRDREQPGNANCSPEGLVRQVKMATRTAG  453

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A+ Q+L T  L  D  +G   + AFTYLRMN  L++++NWR  V 
Sbjct  454  VELAGENALERYDADAYAQVLATCNL--DAGNG---LSAFTYLRMNKKLYESENWRNLVE  508

Query  542  FVKKM-KEGK  568
            FV++M  EG+
Sbjct  509  FVQRMSSEGR  518



>emb|CDY42960.1| BnaA01g17940D [Brassica napus]
Length=549

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  +F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDKLLASAKGVFQGTGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQSATRQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TDLAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVKKMKEG
Sbjct  506  FVKKMKEG  513



>ref|XP_009144721.1| PREDICTED: beta-amylase 3, chloroplastic-like [Brassica rapa]
Length=549

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  +F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDKLLASAKGVFQGTGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQSATRQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+    D  +G   + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TDLAGENALERYDSSAFGQVVATN--RSDTGNG---LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVKKMKEG
Sbjct  506  FVKKMKEG  513



>emb|CDY35597.1| BnaC01g21190D [Brassica napus]
Length=548

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  +F  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  330  NSEYGKFFMEWYSGKLLEHGDKLLASAKGVFQGTGAKLSGKVAGIHWHYNTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EMRD EQP+ A C+PE LV+QV  AT++A 
Sbjct  390  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMRDGEQPEHANCSPEGLVKQVQSATRQAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  +  FTYLRMN  LF+  NW++ V 
Sbjct  450  TELAGENALERYDSSAFGQVVATNRSD----SGN-GLTTFTYLRMNKRLFEGQNWQQLVE  504

Query  542  FVKKMKEG  565
            FVKKMKEG
Sbjct  505  FVKKMKEG  512



>ref|XP_011032002.1| PREDICTED: beta-amylase 3, chloroplastic-like [Populus euphratica]
Length=547

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 137/187 (73%), Gaps = 5/187 (3%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YG+FFL WYS  LL+HG++IL +A  IF  TG K+S K+AGIHWHY TRSHA ELTAG
Sbjct  331  TEYGQFFLEWYSGKLLEHGDKILAAAEGIFRGTGAKLSGKVAGIHWHYRTRSHAAELTAG  390

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR  DGYL +A+M +++G +FNFTC+EMRD EQPQ A C+PE LV+QV +AT+ A++
Sbjct  391  YYNTRHHDGYLTMARMFSKYGVVFNFTCMEMRDGEQPQHANCSPEGLVQQVKMATRTARI  450

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD  A+ Q++ TS       SG+  + AFTYLRMN  LF+ DNW   V F
Sbjct  451  ELAGENALERYDAGAYSQVMATSRSE----SGN-GLTAFTYLRMNKRLFEGDNWLHLVQF  505

Query  545  VKKMKEG  565
            V  M EG
Sbjct  506  VTSMSEG  512



>ref|XP_009136825.1| PREDICTED: beta-amylase 3, chloroplastic [Brassica rapa]
Length=548

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA AIF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  330  NSEYGKFFMEWYSGKLLEHGDQLLSSAKAIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  390  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  450  TELAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  504

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  505  FVKNMKEG  512



>ref|XP_009371857.1| PREDICTED: beta-amylase 3, chloroplastic [Pyrus x bretschneideri]
Length=545

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL HG+RIL +A  +F  +G K+S KIAGI+WHYG+RSHA ELTA
Sbjct  328  NTEYGQFFLEWYSGKLLRHGDRILSAAKGVFQGSGAKLSGKIAGIYWHYGSRSHAAELTA  387

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY+P A M +++  + NFTC+EM+D EQP+ A C+PE LVRQV +AT+ A 
Sbjct  388  GYYNTRHRDGYVPTAMMFSKNMVVLNFTCMEMKDSEQPEHANCSPEGLVRQVRMATKSAG  447

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A  Q+L TS       SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  448  IDLAGENALERYDTGAFAQVLATSRSD----SGN-SLSAFTYLRMNKRLFEGDNWRNMVE  502

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  503  FVRSMAEG  510



>emb|CDX90487.1| BnaA03g42940D [Brassica napus]
Length=541

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 136/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FF+ WYS  LL+HG+++L SA AIF  +G K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  333  YGKFFMEWYSGKLLEHGDQLLSSAKAIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYY  392

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A   L
Sbjct  393  NTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTEL  452

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V FVK
Sbjct  453  AGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVEFVK  507

Query  551  KMKEG  565
             MKEG
Sbjct  508  NMKEG  512



>ref|XP_006838474.1| hypothetical protein AMTR_s00002p00150440 [Amborella trichopoda]
 gb|ERN01043.1| hypothetical protein AMTR_s00002p00150440 [Amborella trichopoda]
Length=585

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 134/184 (73%), Gaps = 4/184 (2%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG FFL WYS MLL+HG+RILQ++ AIF  TG K+S K+AGIHWHY +RSH  ELTAGYY
Sbjct  371  YGNFFLQWYSNMLLNHGDRILQASGAIFAGTGAKLSGKVAGIHWHYQSRSHPAELTAGYY  430

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR  DGY PIA++ AR   I NFTC+EMRD EQP  A C PE LVRQVA A Q A + L
Sbjct  431  NTRNTDGYSPIARLFARRDTILNFTCMEMRDSEQPGHAGCGPEGLVRQVASAAQYAGIHL  490

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYDD A E++  +  L  +     +++ AFTYLRMN  LF+++NWRRFV FV+
Sbjct  491  AGENALERYDDAALEKVAASCFLQEN----GQKLAAFTYLRMNKRLFESENWRRFVGFVR  546

Query  551  KMKE  562
             + E
Sbjct  547  SLSE  550



>ref|XP_010440058.1| PREDICTED: beta-amylase 3, chloroplastic [Camelina sativa]
Length=548

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  IF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M ++HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFSKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATKQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TDLAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  506  FVKNMKEG  513



>ref|XP_009802914.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=549

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FFL WYS  LL+HG+RIL +A +I+  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  332  NSEYGKFFLEWYSGKLLEHGDRILGAAESIYQGTGAKLSGKVAGIHWHYNTRSHAAELTA  391

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  +GYLPIA+M  +H  +FNFTC+EMRD EQPQ A C+PE LVRQV  AT+ ++
Sbjct  392  GYYNTRDTNGYLPIARMFGKHHVVFNFTCMEMRDGEQPQSANCSPEGLVRQVKKATRTSE  451

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD  A+ Q+L TS       SG+  + AFT+LRMN  LF+ +NW+    
Sbjct  452  VELAGENALERYDGGAYSQVLATSRSD----SGN-ALSAFTFLRMNKRLFEPENWQNLGQ  506

Query  542  FVKKMKEG  565
            FVK M EG
Sbjct  507  FVKSMSEG  514



>emb|CDY09643.1| BnaC07g34180D [Brassica napus]
Length=548

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 136/185 (74%), Gaps = 5/185 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FF+ WYS  LL+HG+++L SA AIF  +G K+S K+AGIHWHY TRSHA ELTAGY+
Sbjct  333  YGKFFMEWYSGKLLEHGDKLLSSAKAIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYF  392

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A   L
Sbjct  393  NTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTEL  452

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V FVK
Sbjct  453  AGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVEFVK  507

Query  551  KMKEG  565
             MKEG
Sbjct  508  NMKEG  512



>emb|CAB46051.1| putative beta-amylase [Arabidopsis thaliana]
 emb|CAB80980.1| putative beta-amylase [Arabidopsis thaliana]
Length=498

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  IF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  281  NSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  340

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  341  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAG  400

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  401  TELAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  455

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  456  FVKNMKEG  463



>gb|EAZ16358.1| hypothetical protein OsJ_31821 [Oryza sativa Japonica Group]
Length=330

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIF-DNTGVKISVKIAGIHWHYGTRSHAPELT  178
            +T YGEFFLSWYSQMLL+HGER+L  A ++F D  G KISVK+AGIHWHYGTRSHAPELT
Sbjct  117  STEYGEFFLSWYSQMLLEHGERVLSGATSVFGDGAGAKISVKVAGIHWHYGTRSHAPELT  176

Query  179  AGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEA  358
            AGYYNTR RDGYLPIA+MLARHGA+ NFTC+EMRDHEQPQ+AQC PE LVRQVA A + A
Sbjct  177  AGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQVAAAARAA  236

Query  359  QVPLAGENALPRYDDYAHEQIL  424
               L GENALPRYD  A +Q++
Sbjct  237  GFGLPGENALPRYDGKAQDQVV  258



>ref|XP_002868085.1| beta-amylase 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44344.1| beta-amylase 8 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  IF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TELAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  506  FVKNMKEG  513



>ref|NP_567523.1| beta-amylase [Arabidopsis thaliana]
 sp|O23553.3|BAM3_ARATH RecName: Full=Beta-amylase 3, chloroplastic; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 
8; AltName: Full=Chloroplast beta-amylase; Short=CT-BMY; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB58423.1| beta-amylase enzyme [Arabidopsis thaliana]
 gb|AAM65134.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AEE83848.1| beta-amylase [Arabidopsis thaliana]
Length=548

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  IF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TELAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  506  FVKNMKEG  513



>ref|XP_010434720.1| PREDICTED: beta-amylase 3, chloroplastic-like [Camelina sativa]
Length=548

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  IF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TDLAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  506  FVKNMKEG  513



>ref|XP_010449668.1| PREDICTED: beta-amylase 3, chloroplastic-like [Camelina sativa]
Length=548

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  IF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TDLAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  506  FVKNMKEG  513



>ref|XP_006285145.1| hypothetical protein CARUB_v10006488mg [Capsella rubella]
 gb|EOA18043.1| hypothetical protein CARUB_v10006488mg [Capsella rubella]
Length=548

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             + YG+FF+ WYS  LL+HG+++L SA  IF  +G K+S K+AGIHWHY TRSHA ELTA
Sbjct  331  NSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M  +HG + NFTC+EM+D EQP+ A C+PE LV+QV  AT++A 
Sbjct  391  GYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAG  450

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
              LAGENAL RYD  A  Q++ T+       SG+  + AFTYLRMN  LF+  NW++ V 
Sbjct  451  TELAGENALERYDSSAFGQVVATNRSD----SGNG-LTAFTYLRMNKRLFEGQNWQQLVE  505

Query  542  FVKKMKEG  565
            FVK MKEG
Sbjct  506  FVKNMKEG  513



>ref|XP_002978844.1| hypothetical protein SELMODRAFT_233213 [Selaginella moellendorffii]
 gb|EFJ20291.1| hypothetical protein SELMODRAFT_233213 [Selaginella moellendorffii]
Length=472

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 137/203 (67%), Gaps = 14/203 (7%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYG+FFL WYS ML  HGER+L +A A+F  TG+K++ K+AG+HWHYGTR H  ELTA
Sbjct  241  NSPYGQFFLEWYSGMLTSHGERVLSTAEAVFRGTGIKLAGKVAGVHWHYGTRPHPAELTA  300

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY  +A+M  RHG +  FTC+EMRD EQP  A  +PE L+ QV  A ++A 
Sbjct  301  GYYNTRLRDGYTGLARMFGRHGVVMIFTCVEMRDLEQPPHALSSPESLLHQVVSACKQAG  360

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD--------------REMCAFTYLRMN  499
            + LAGENALPR+D+ A+EQ+L+ S +   E   D                MC+FT+LRM+
Sbjct  361  ISLAGENALPRFDEAAYEQVLKKSRMQESEDEDDWISPSSSGCSSTACEPMCSFTFLRMS  420

Query  500  PDLFQADNWRRFVAFVKKMKEGK  568
              LF ++NW  FV FV++M  G+
Sbjct  421  EKLFYSENWHNFVPFVRRMAGGR  443



>gb|AFI56496.1| beta-amylase [Vaccinium corymbosum]
Length=533

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 136/184 (74%), Gaps = 5/184 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WYS M L+HG R+L +A  IF  TG K+S K+AG HWHY +RSHA ELTAGYY
Sbjct  334  YGQFFLKWYSGMPLEHGNRLLAAAKGIFQGTGAKLSGKVAGTHWHYRSRSHAAELTAGYY  393

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR +DGYLPIA+M+ +HG + NFTC+EMRD EQP  A C+PE LVRQV +AT+ A++ L
Sbjct  394  NTRHQDGYLPIARMMGKHGVVLNFTCMEMRDGEQPGHANCSPEGLVRQVKMATKVARIDL  453

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD+ A+ Q+L+TS       SG+  + AFTYLR++  LF+ +NWR  V F K
Sbjct  454  AGENALERYDEGAYAQVLKTSQSD----SGN-GLSAFTYLRLSKRLFEGENWRHLVGFAK  508

Query  551  KMKE  562
              ++
Sbjct  509  ACRK  512



>emb|CAX51380.1| beta-amylase [Hordeum vulgare subsp. vulgare]
Length=293

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 139/188 (74%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL WYS MLL+HG+R+L +A AIF  TGV +S K+AGIHWHY TRSHA ELTA
Sbjct  76   STEYGHFFLKWYSGMLLEHGDRVLAAAEAIFGGTGVTLSAKVAGIHWHYRTRSHAAELTA  135

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY PIA+MLARHGA+ NFTC+EM+D +QP  A C+PE LV+QV  A + A+
Sbjct  136  GYYNTRHHDGYGPIARMLARHGAVLNFTCMEMKDEQQPGHAGCSPELLVQQVRAAARAAR  195

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+  +         + AFTYLRMN +LF  DNWRRFVA
Sbjct  196  VELAGENALERYDEQAFAQVAATAEAA--------GLSAFTYLRMNRNLFDGDNWRRFVA  247

Query  542  FVKKMKEG  565
            FVK M +G
Sbjct  248  FVKTMADG  255



>ref|XP_009397011.1| PREDICTED: beta-amylase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HG+R+L +A AIF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  330  NTHYGKFFLEWYSGTLLEHGDRVLAAAEAIFRGTGAKLSGKVAGIHWHYRTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTRF DGYLP+A+++A  G + NFTC+EMRD +QP  A C+PE +VRQV  A + A 
Sbjct  390  GYYNTRFHDGYLPVAKLMATRGVVLNFTCMEMRDEQQPGHANCSPELIVRQVKQAAKAAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSAL--SIDE*SGDREMCAFTYLRMNPDLFQADNWRRF  535
              LAGENAL RYD+ A+ Q+L TS    SID       + AFTYLRMN  LF+ +NWR F
Sbjct  450  AELAGENALERYDEKAYSQVLATSRADDSID-------LSAFTYLRMNKRLFEGENWRHF  502

Query  536  VAFVKKMKEG  565
            V+FVK M EG
Sbjct  503  VSFVKSMSEG  512



>ref|XP_008361217.1| PREDICTED: beta-amylase 3, chloroplastic-like [Malus domestica]
Length=653

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 133/187 (71%), Gaps = 5/187 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL HG+RIL +A  +F  +G K+S KIAGIHWHY +RSHA ELTA
Sbjct  329  NTEYGQFFLEWYSGKLLRHGDRILSAAKGVFQGSGAKLSGKIAGIHWHYRSRSHAAELTA  388

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLP A+M +++  + NFTC+EM+D EQP+ A C+PE LVRQV +AT+ A 
Sbjct  389  GYYNTRHRDGYLPTAKMFSKNMVVLNFTCMEMKDREQPEHANCSPEGLVRQVKMATKRAG  448

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A  Q+L TS       SG+  + AFTYLRMN  LF  DNWR  V 
Sbjct  449  IDLAGENALERYDTGAFAQVLATSRSD----SGN-ALSAFTYLRMNKRLFDGDNWRNMVE  503

Query  542  FVKKMKE  562
            FV+ M E
Sbjct  504  FVRSMAE  510



>ref|XP_002975660.1| hypothetical protein SELMODRAFT_232533 [Selaginella moellendorffii]
 gb|EFJ23289.1| hypothetical protein SELMODRAFT_232533 [Selaginella moellendorffii]
Length=472

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 138/203 (68%), Gaps = 14/203 (7%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             +PYG+FFL WYS ML+ HGER+L +A A+F   G+K++ K+AG+HWHYGT+ H  ELTA
Sbjct  241  NSPYGQFFLEWYSGMLISHGERVLSAAEAVFRGAGIKLAGKVAGVHWHYGTKPHPAELTA  300

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY  +A+M  RHGA+  FTC+EMRD EQP  A  +PE L+ QV  A ++A 
Sbjct  301  GYYNTRLRDGYTGLARMFGRHGAVMIFTCLEMRDLEQPPHALSSPESLLHQVVSACKQAG  360

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD--------------REMCAFTYLRMN  499
            + LAGENALPR+D+ A+EQ+++ S +   E   D                MC+FT+LRM+
Sbjct  361  ISLAGENALPRFDEAAYEQVVKKSRMQESEEEDDWISASSGGCSSTACEPMCSFTFLRMS  420

Query  500  PDLFQADNWRRFVAFVKKMKEGK  568
              LF ++NW  FV FV++M  G+
Sbjct  421  EKLFYSENWHNFVPFVRRMAGGR  443



>ref|XP_009612895.1| PREDICTED: beta-amylase 3, chloroplastic [Nicotiana tomentosiformis]
Length=546

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 137/186 (74%), Gaps = 6/186 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAP-ELTAGY  187
            YG+FFL WYS  LL+HG+RIL +A +I+  TG K+S K+AGIHWHY TRSHA  ELTAGY
Sbjct  331  YGKFFLEWYSGKLLEHGDRILGAAESIYQGTGAKLSGKVAGIHWHYNTRSHAAAELTAGY  390

Query  188  YNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP  367
            YNTR  +GYLPI++M  +H  +FNFTC+EMRD EQPQ A C+PE LVRQV  AT+ ++V 
Sbjct  391  YNTRDTNGYLPISRMFGKHRVVFNFTCMEMRDGEQPQSANCSPEGLVRQVKKATRTSEVE  450

Query  368  LAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFV  547
            LAGENAL RYD+ A+ Q+L TS       SG+  + AFT+LRMN  LF+ +NW+    FV
Sbjct  451  LAGENALERYDEGAYSQVLATSRSD----SGN-ALSAFTFLRMNKRLFEPENWQNLGQFV  505

Query  548  KKMKEG  565
            K M EG
Sbjct  506  KSMSEG  511



>ref|XP_010110537.1| hypothetical protein L484_023371 [Morus notabilis]
 gb|EXC26755.1| hypothetical protein L484_023371 [Morus notabilis]
Length=544

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 134/187 (72%), Gaps = 7/187 (4%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YG+FFL WYS  L  HG+RIL +A  +F  T  K+S KIAGIHWHY TRSHA ELTAG
Sbjct  330  TEYGQFFLEWYSTKLSAHGDRILAAAKGVFHGTRAKLSGKIAGIHWHYRTRSHAAELTAG  389

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR R+GY  +AQ+ A+H  IFNFTC+EM+D EQPQ   C+PE LV+QV + T+ A++
Sbjct  390  YYNTRNRNGYSALAQIFAKHDVIFNFTCMEMKDGEQPQ--HCSPEGLVQQVKMTTRSARI  447

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
             LAGENAL RYD  A+ ++L TS       SG+  +CAFTYLRMN  LF+ DNWR  V F
Sbjct  448  ELAGENALERYDASAYGRVLATSRSD----SGN-GLCAFTYLRMNKRLFEGDNWRNLVEF  502

Query  545  VKKMKEG  565
            VK M EG
Sbjct  503  VKSMSEG  509



>ref|XP_008373719.1| PREDICTED: beta-amylase 3, chloroplastic [Malus domestica]
Length=546

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 131/188 (70%), Gaps = 5/188 (3%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FF  WYS  LL HG+RIL +A  +F  +G K+S KIAGIHWHYG+RSHA ELTA
Sbjct  329  NTEXGQFFXEWYSGKLLRHGDRILSAAKGVFQGSGAKLSGKIAGIHWHYGSRSHAAELTA  388

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GY NTR RDGY+P A+M +++  + NFTC+EM+D EQP+ A C+PE LVRQV +AT+ A 
Sbjct  389  GYXNTRHRDGYVPTARMFSKNMVVLNFTCMEMKDREQPEHANCSPEGLVRQVKMATKSAG  448

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            + LAGENAL RYD  A   +L T        SG+  + AFTYLRMN  LF+ DNWR  V 
Sbjct  449  IDLAGENALERYDTGAFAXVLATXXSD----SGN-ALSAFTYLRMNKRLFEXDNWRNMVE  503

Query  542  FVKKMKEG  565
            FV+ M EG
Sbjct  504  FVRSMAEG  511



>gb|EMT27036.1| Beta-amylase [Aegilops tauschii]
Length=514

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 138/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL WYS MLL+HG+R+L +A AIF  TGV +S K+AGIHWHY TRSHA ELTA
Sbjct  297  STEYGHFFLKWYSGMLLEHGDRVLAAAEAIFGGTGVTLSAKVAGIHWHYRTRSHAAELTA  356

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY PIAQMLARHG + NFTC+EM+D +QP  A C+PE LV+QV  A + A+
Sbjct  357  GYYNTRHHDGYEPIAQMLARHGTVLNFTCMEMKDEQQPGHAGCSPELLVQQVRAAARAAR  416

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+  +         + AFTYLRMN +LF  DNWRRFVA
Sbjct  417  VELAGENALERYDEQAFAQVAATAEAA--------GLSAFTYLRMNRNLFDGDNWRRFVA  468

Query  542  FVKKMKEG  565
            FVK M +G
Sbjct  469  FVKTMADG  476



>ref|XP_009413253.1| PREDICTED: beta-amylase 3, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=549

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 136/189 (72%), Gaps = 7/189 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS  LL+HG+R+L +A+AIF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  330  NTDYGKFFLEWYSSKLLEHGDRVLAAAHAIFHGTGAKLSGKVAGIHWHYRTRSHAAELTA  389

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGYLP+A+M+A  G I NFTC+EM+D +QP  A C+PE LVRQV  AT  A 
Sbjct  390  GYYNTRHRDGYLPVAKMMAMRGVILNFTCMEMKDEQQPGHAGCSPELLVRQVKQATAAAG  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGD-REMCAFTYLRMNPDLFQADNWRRFV  538
              LAGENAL RYD  A+ Q+L TS        GD   + AFTYLRM   LF+ +NWR+ V
Sbjct  450  AELAGENALERYDGSAYSQVLATSR------GGDGMGLTAFTYLRMTKKLFEGENWRQLV  503

Query  539  AFVKKMKEG  565
            AFVK M EG
Sbjct  504  AFVKSMSEG  512



>ref|XP_003574353.1| PREDICTED: beta-amylase 3, chloroplastic [Brachypodium distachyon]
Length=548

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 135/188 (72%), Gaps = 4/188 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  325  STEYGSFFLEWYSGMLLEHGDRVLAAAEAVFGGTGAMLSAKVAGIHWHYRTRSHAAELTA  384

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY PIA MLA+ G + NFTC+EM+D +QP  A C+PE+LVRQV  A + A 
Sbjct  385  GYYNTRNHDGYAPIAGMLAKRGVVLNFTCMEMKDEQQPGHAGCSPEQLVRQVRAAARAAN  444

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+A           + AFTYLRMN +LF  DNWRRFVA
Sbjct  445  VELAGENALERYDESAFAQVAATAAAGDAG----AGLSAFTYLRMNRNLFDGDNWRRFVA  500

Query  542  FVKKMKEG  565
            FVK M +G
Sbjct  501  FVKTMADG  508



>dbj|BAJ90222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 138/188 (73%), Gaps = 8/188 (4%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +T YG FFL WYS MLL+HG+R+L +A AIF  TGV +S K+AGIHWHY TRSHA ELTA
Sbjct  332  STEYGHFFLKWYSGMLLEHGDRVLAAAEAIFGGTGVTLSAKVAGIHWHYRTRSHAAELTA  391

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGY PIA+MLARHGA+ NFTC+EM+D +QP  A C+PE LV+QV  A + A+
Sbjct  392  GYYNTRHHDGYGPIARMLARHGAVLNFTCMEMKDEQQPGHAGCSPELLVQQVRAAARAAR  451

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            V LAGENAL RYD+ A  Q+  T+  +         +  FTYLRMN +LF  DNWRRFVA
Sbjct  452  VELAGENALERYDEQAFAQVAATAEAA--------GLSTFTYLRMNRNLFDGDNWRRFVA  503

Query  542  FVKKMKEG  565
            FVK M +G
Sbjct  504  FVKTMADG  511



>gb|AFO84077.1| beta-amylase [Actinidia chinensis]
Length=520

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 133/184 (72%), Gaps = 5/184 (3%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG+FFL WY  MLL+HG+RIL +AN IF  TG K+S K+AGIHWH  TRSHA ELTAGYY
Sbjct  333  YGQFFLEWYLGMLLEHGDRILAAANRIFQGTGAKLSGKVAGIHWHCRTRSHAAELTAGYY  392

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            N R ++GYLPIA+M+ ++G + NFTC+EMRD EQ ++A  +PE+LVRQV  AT+ A   L
Sbjct  393  NMRHQNGYLPIARMMGKYGVVMNFTCMEMRDGEQSENASRSPERLVRQVKKATKTAGTEL  452

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGEN L RYD  A+ Q+L TS       SG+  + AFTYLRMN  LF+ +NW+  V FV+
Sbjct  453  AGENVLERYDAGAYSQVLTTSRSD----SGN-GLSAFTYLRMNKRLFEGENWKDLVEFVR  507

Query  551  KMKE  562
             M +
Sbjct  508  NMSQ  511



>gb|EAZ17007.1| hypothetical protein OsJ_32492 [Oryza sativa Japonica Group]
Length=502

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 127/174 (73%), Gaps = 8/174 (5%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTA
Sbjct  241  CTEYGDFFLGWYSGMLLEHGDRVLAAAEAVFRGTGAALSAKVAGIHWHYRTRSHAAELTA  300

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR RDGY P+A MLAR GA+ NFTC+EMRD +QP+ A C+PE+LVRQV  A + A+
Sbjct  301  GYYNTRRRDGYAPVAAMLARRGAVLNFTCMEMRDEQQPEHAGCSPEQLVRQVRSAARAAR  360

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADN  523
            V LAGENAL RYD+ A  Q++ T+A +         + AFTYLRMN  LF  D 
Sbjct  361  VGLAGENALERYDEAAFAQVVATAASA--------GLGAFTYLRMNKKLFDGDK  406



>gb|EYU24930.1| hypothetical protein MIMGU_mgv1a020099mg [Erythranthe guttata]
Length=542

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 130/185 (70%), Gaps = 16/185 (9%)
 Frame = +2

Query  11   YGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAGYY  190
            YG FFL WYS  L++HGE+IL +A  +F+ TG K+S K+AGIHWHY TRSHA ELTAGYY
Sbjct  337  YGHFFLEWYSGNLINHGEKILAAAERVFEGTGAKLSGKVAGIHWHYKTRSHAAELTAGYY  396

Query  191  NTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPL  370
            NTR RDGYLPIA+ML++            +D EQP +A C+PE LV+QV +AT+ A++ L
Sbjct  397  NTRHRDGYLPIARMLSKP-----------QDGEQPNEANCSPEGLVKQVKMATKTARIDL  445

Query  371  AGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAFVK  550
            AGENAL RYD  A+ Q+L TS       SG+  + AFTYLR+N  LF+ +NWR  V FV+
Sbjct  446  AGENALERYDGGAYSQVLETSRSD----SGN-GLSAFTYLRLNKRLFEPENWRNLVEFVR  500

Query  551  KMKEG  565
             M EG
Sbjct  501  SMSEG  505



>ref|XP_006662424.1| PREDICTED: beta-amylase 1, chloroplastic-like, partial [Oryza 
brachyantha]
Length=453

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNT---GVKISVKIAGIHWHYGTRSHAPE  172
            +T YGEFFLSWYSQML++HGER+L  A ++F +    GVK+SVK+AGIHWHYGTRSHAPE
Sbjct  318  STEYGEFFLSWYSQMLMEHGERVLSGATSVFGDDAPGGVKVSVKVAGIHWHYGTRSHAPE  377

Query  173  LTAGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQ  352
            LTAGYYNTR RDGYLPIA+MLARHGA+ NFTC+EMRDHEQPQ+A+C PE LVRQVA A +
Sbjct  378  LTAGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAECMPEALVRQVAAAAR  437

Query  353  EAQVPLAGENALPRYD  400
             A V LAGENALPRYD
Sbjct  438  AAGVGLAGENALPRYD  453



>gb|EEC67456.1| hypothetical protein OsI_34681 [Oryza sativa Indica Group]
Length=337

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T YG+FFL WYS MLL+HG+R+L +A A+F  TG  +S K+AGIHWHY TRSHA ELTAG
Sbjct  144  TEYGDFFLGWYSGMLLEHGDRVLAAAEAVFRGTGAALSAKVAGIHWHYRTRSHAAELTAG  203

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNTR RDGY P+A MLAR GA+ NFTC+EMRD +QP+ A C+PE+LVRQV  A + A+V
Sbjct  204  YYNTRRRDGYAPVAAMLARRGAVLNFTCMEMRDEQQPEHAGCSPEQLVRQVRSAARAARV  263

Query  365  PLAGENALPRYDDYAHEQI  421
             LAGENAL RYD+ A  Q+
Sbjct  264  GLAGENALERYDEAAFAQV  282



>gb|AEB00844.1| beta-amylase 8 [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 124/189 (66%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYG FFL WYS MLL HGER+   A+A+F  TGV IS K++GIHWHY T SH  ELTA
Sbjct  248  NTPYGRFFLEWYSGMLLLHGERLCAVADAVFSGTGVTISGKVSGIHWHYYTCSHPSELTA  307

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIAQM +RH A     C ++RD E+    Q +PE  +RQ+  A +   
Sbjct  308  GYYNTLLRDGYLPIAQMFSRHRAALCCGCFDLRDAER-SSPQSSPEGTLRQLMAAAKVCN  366

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PL GEN++PR DD +  Q++R+S L     SG     +F Y+RMN  LF++ NW RF  
Sbjct  367  LPLNGENSVPRLDDASLSQVVRSSRLYSGGTSG--ASFSFNYVRMNKSLFESHNWNRFTK  424

Query  542  FVKKMKEGK  568
            FV+KM + +
Sbjct  425  FVRKMSDAR  433



>dbj|BAJ96156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 124/189 (66%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYG FFL WYS MLL HGER+   A+A+F  TGV IS K++GIHWHY T SH  ELTA
Sbjct  331  NTPYGRFFLEWYSGMLLLHGERLCAVADAVFSGTGVTISGKVSGIHWHYYTCSHPSELTA  390

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIAQM +RH A     C ++RD E+    Q +PE  +RQ+  A +   
Sbjct  391  GYYNTLLRDGYLPIAQMFSRHRAALCCGCFDLRDAER-SSPQSSPEGTLRQLMAAAKVCN  449

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PL GEN++PR DD +  Q++R+S L     SG     +F Y+RMN  LF++ NW RF  
Sbjct  450  LPLNGENSVPRLDDASLSQVVRSSRLYSGGTSG--ASFSFNYVRMNKSLFESHNWNRFTK  507

Query  542  FVKKMKEGK  568
            FV+KM + +
Sbjct  508  FVRKMSDAR  516



>ref|XP_008783150.1| PREDICTED: beta-amylase 3, chloroplastic-like [Phoenix dactylifera]
Length=550

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 122/188 (65%), Gaps = 4/188 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TP+G+FFL WYS MLL HGER+    N IF  TG KIS K+AGIHWHYGT SH  ELTA
Sbjct  335  NTPFGQFFLEWYSGMLLLHGERLCTVTNGIFGGTGAKISGKVAGIHWHYGTSSHPSELTA  394

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIA+M  R+      TC +MRD E+    + +PE  +RQ+  A +   
Sbjct  395  GYYNTFIRDGYLPIARMFGRYRMTLCCTCFDMRDSEERSTPKSSPEGFLRQLVYAARMCN  454

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMC-AFTYLRMNPDLFQADNWRRFV  538
            +PL GEN++ R DD +  Q+++++ L     SG  E   +F Y+RMN +LF + NW RF 
Sbjct  455  LPLLGENSVTRLDDTSLNQVIKSARLYS---SGAYEASLSFNYVRMNRNLFDSHNWNRFT  511

Query  539  AFVKKMKE  562
             FV+KM +
Sbjct  512  KFVRKMSD  519



>ref|XP_003566188.1| PREDICTED: beta-amylase 3, chloroplastic-like [Brachypodium distachyon]
Length=556

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 126/189 (67%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            +TPYG FFL WYS MLL HGER+   A+AIF  TGV IS K++GIHWHY T SH  ELTA
Sbjct  340  STPYGRFFLEWYSGMLLLHGERLCTIADAIFSGTGVTISGKVSGIHWHYYTCSHPSELTA  399

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIAQM +R+ A    +C ++RD E+  ++Q +PE  +RQ+  A +   
Sbjct  400  GYYNTLLRDGYLPIAQMFSRYKAALCCSCFDLRDAER-NNSQSSPEGTLRQLMAAAKICN  458

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PL GEN++ R DD +  Q++R+S L     SG     +F Y+RMN  LF+  NW RF  
Sbjct  459  LPLNGENSVTRLDDTSLSQVIRSSRLYSGGTSGTS--FSFNYVRMNKSLFEFQNWNRFTK  516

Query  542  FVKKMKEGK  568
            FV+KM + +
Sbjct  517  FVRKMSDAR  525



>emb|CBI33977.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
            TT YG+FFL WYS  LL+HG+RIL +A  IF  TG K+S K+AGIHWHY TRSHA ELTA
Sbjct  299  TTEYGQFFLKWYSGKLLEHGDRILAAAEGIFQGTGAKLSGKVAGIHWHYKTRSHAAELTA  358

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNTR  DGYLPIA+M+ ++G + NFTC+EM+D EQ + A C+PE LVRQV +AT+ A 
Sbjct  359  GYYNTRNHDGYLPIARMMGKYGVVLNFTCMEMKDREQQEHANCSPEGLVRQVKMATKTAG  418

Query  362  VPLAGENALPRYDDYAHEQ  418
              LAGENAL RYD  A+ Q
Sbjct  419  TELAGENALERYDSSAYAQ  437



>ref|NP_001132696.1| hypothetical protein [Zea mays]
 gb|ACF81646.1| unknown [Zea mays]
 gb|AFW80506.1| hypothetical protein ZEAMMB73_795959 [Zea mays]
Length=537

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 126/188 (67%), Gaps = 3/188 (2%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            TPYG FFL WYS MLL HGER+   A+AIF  TGV IS K+AGIHWHY T SH  ELTAG
Sbjct  322  TPYGHFFLEWYSGMLLLHGERLCMIADAIFSGTGVTISGKVAGIHWHYYTCSHPSELTAG  381

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNT  RDGYLPIAQM A++ A    +C ++RD E+  D++ +PE  +RQ+A A +   +
Sbjct  382  YYNTLLRDGYLPIAQMFAKYKAALCCSCFDLRDTER-TDSESSPEGTLRQLAGAAKMCGL  440

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
            PL GEN++ R DD +  Q++R+S L     SG     +F Y+RMN  LF+  NW RF  F
Sbjct  441  PLNGENSMTRLDDASLNQVIRSSRLYSGRTSGTS--FSFNYVRMNKSLFEFHNWNRFTKF  498

Query  545  VKKMKEGK  568
            V++M + +
Sbjct  499  VRQMSDAR  506



>gb|EMT28216.1| Beta-amylase [Aegilops tauschii]
Length=395

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 122/189 (65%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYG FFL WYS MLL HGER+   A+A+F  TGV IS K++GIHWHY T SH  ELTA
Sbjct  180  NTPYGRFFLEWYSGMLLLHGERLCAVADAVFSGTGVTISGKVSGIHWHYYTCSHPSELTA  239

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIAQM +RH A     C ++RD E+    Q +PE  +RQ+  A +   
Sbjct  240  GYYNTLLRDGYLPIAQMFSRHRAALCCGCFDLRDEER-SGPQSSPEGTLRQLMAAAKVWN  298

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PL GEN++ R DD +  Q++R+S       SG     +F Y+RMN  LF++ NW RF  
Sbjct  299  LPLNGENSVARLDDASLSQVVRSSRRYSGGTSGTS--FSFNYVRMNKSLFESHNWNRFTK  356

Query  542  FVKKMKEGK  568
            FV+KM + +
Sbjct  357  FVRKMSDAR  365



>ref|XP_002454872.1| hypothetical protein SORBIDRAFT_03g000480 [Sorghum bicolor]
 gb|EER99991.1| hypothetical protein SORBIDRAFT_03g000480 [Sorghum bicolor]
Length=442

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 125/188 (66%), Gaps = 3/188 (2%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            TPYG FFL WYS MLL HGER+  +A+AIF  TGV IS K+AGIHWHY T SH  ELTAG
Sbjct  227  TPYGHFFLEWYSGMLLLHGERLCMTADAIFSGTGVTISGKVAGIHWHYYTCSHPSELTAG  286

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNT  RDGYLPIAQM A++ A     C ++RD E+  +++ +PE  +R +A A +   +
Sbjct  287  YYNTLLRDGYLPIAQMFAKYKAALCCGCFDLRDVER-TNSESSPEGTLRHLAGAAKMCNI  345

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
            PL GEN++ R DD +  Q++R+S L     SG     +F Y+RMN  LF+  NW RF  F
Sbjct  346  PLNGENSVTRLDDASLNQVIRSSRLYSGRTSGTS--FSFNYVRMNKSLFEFHNWNRFTKF  403

Query  545  VKKMKEGK  568
            V++M + +
Sbjct  404  VRQMSDAR  411



>emb|CDM82306.1| unnamed protein product [Triticum aestivum]
 emb|CDM82546.1| unnamed protein product [Triticum aestivum]
Length=361

 Score =   191 bits (486),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 121/189 (64%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYG FFL WYS MLL HGER+   A+A+F  TGV IS K++GIHWHY T SH  ELTA
Sbjct  146  NTPYGRFFLEWYSGMLLLHGERLCAVADAVFSGTGVTISGKVSGIHWHYYTCSHPSELTA  205

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIAQM +RH A     C ++RD E+    Q +PE  +RQ+  A +   
Sbjct  206  GYYNTLLRDGYLPIAQMFSRHRAALCCGCFDLRDEER-SGPQSSPEGTLRQLMAAAKVWN  264

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PL GEN+  R DD +  Q++R+S       SG     +F Y+RMN  LF++ NW RF  
Sbjct  265  LPLNGENSAARLDDASLSQVVRSSRRYSGGTSG--ASFSFNYVRMNKSLFESHNWNRFTK  322

Query  542  FVKKMKEGK  568
            FV+KM + +
Sbjct  323  FVRKMSDAR  331



>ref|XP_010915994.1| PREDICTED: beta-amylase 1, chloroplastic-like [Elaeis guineensis]
Length=550

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 123/188 (65%), Gaps = 4/188 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T YG+FFL WYS MLL HGER+    NAIF  TGVKIS KIAGIHWHY T SH  ELTA
Sbjct  335  NTTYGQFFLEWYSGMLLLHGERLCAVTNAIFWGTGVKISGKIAGIHWHYDTSSHPSELTA  394

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  RDGYLPIA+M  R+      TC +MRD E+  + + +PE  +RQ+  A +   
Sbjct  395  GYYNTFIRDGYLPIARMFGRYRMTLCCTCFDMRDSEERSNPKSSPEGFLRQLVYAARMCN  454

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMC-AFTYLRMNPDLFQADNWRRFV  538
            +PL GEN++ R DD +  Q++++S L     SG  E   +F Y+RMN +LF + NW RF 
Sbjct  455  LPLLGENSVTRLDDISLNQVIKSSRLYS---SGAYEASLSFNYVRMNRNLFDSHNWNRFT  511

Query  539  AFVKKMKE  562
             FV+KM +
Sbjct  512  RFVRKMSD  519



>ref|NP_001130896.1| hypothetical protein [Zea mays]
 gb|ACF79279.1| unknown [Zea mays]
 tpg|DAA52707.1| TPA: hypothetical protein ZEAMMB73_078483 [Zea mays]
Length=539

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 125/188 (66%), Gaps = 3/188 (2%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            TPYG FFL WYS MLL HGER+   A+AIF  TGV IS K+AGIHWHY T SH  ELT+G
Sbjct  324  TPYGHFFLKWYSGMLLLHGERLCMIADAIFSGTGVTISGKVAGIHWHYYTCSHPSELTSG  383

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYNT  RDGYLPIAQM A++ A    +C ++RD E+  +++ +PE  +RQ+A A +   +
Sbjct  384  YYNTLLRDGYLPIAQMFAKYKATLCCSCFDLRDAER-TNSESSPEGTLRQLAGAAKMCNL  442

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVAF  544
            PL GEN+  R DD +  Q++R+S L     SG     +F Y+RMN  LF+  NW RF  F
Sbjct  443  PLNGENSATRLDDASLNQVIRSSRLYSGRTSGTS--FSFNYVRMNKSLFEFHNWNRFTKF  500

Query  545  VKKMKEGK  568
            V++M + +
Sbjct  501  VRQMSDAR  508



>gb|EEC70262.1| hypothetical protein OsI_01068 [Oryza sativa Indica Group]
Length=397

 Score =   190 bits (482),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 125/189 (66%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYG FFL WYS MLL HGER+   A+A+F  +GV I+ K++GIHWHY T SH  ELTA
Sbjct  183  NTPYGRFFLEWYSGMLLLHGERLCMVADAVFSGSGVTIAGKVSGIHWHYYTCSHPSELTA  242

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  R+GYLPI QM AR+ A    +C ++RD E+  +++ +PE  +RQ+ +A +   
Sbjct  243  GYYNTLLRNGYLPITQMFARYKAALCCSCFDLRDEER-NNSKSSPEGTLRQLMVAAKMCN  301

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PL GEN++ R DD +  Q++R+S L     SG     +F Y+RMN  LF+  NW RF  
Sbjct  302  LPLNGENSVTRLDDTSLNQVIRSSRLYSGGTSGTS--FSFNYVRMNKSLFEFHNWNRFTK  359

Query  542  FVKKMKEGK  568
            FV++M + +
Sbjct  360  FVRQMSDAR  368



>gb|EEE54197.1| hypothetical protein OsJ_01033 [Oryza sativa Japonica Group]
Length=397

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 125/189 (66%), Gaps = 3/189 (2%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             TPYG FFL WYS MLL HGER+   A+A+F  +GV I+ K++GIHWHY T SH  ELTA
Sbjct  183  NTPYGRFFLEWYSGMLLLHGERLCMVADAVFSGSGVTIAGKVSGIHWHYYTCSHPSELTA  242

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYNT  R+GYLPI QM AR+ A    +C ++RD E+  +++ +PE  +RQ+ +A +   
Sbjct  243  GYYNTLLRNGYLPITQMFARYKAALCCSCFDLRDEER-NNSKSSPEGTLRQLMVAAKMCN  301

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRFVA  541
            +PL GEN++ R DD +  Q++R+S L     SG     +F Y+RMN  LF+  NW RF  
Sbjct  302  LPLNGENSVTRLDDTSLNQVIRSSRLYSGGTSGTS--FSFNYVRMNKSLFEFHNWNRFTK  359

Query  542  FVKKMKEGK  568
            FV++M + +
Sbjct  360  FVRQMSDAR  368



>dbj|BAA02286.1| beta-amylase [Ipomoea batatas]
Length=499

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T  G+FFL+WYS  L+ HG+++L+ AN +F    V I+ K++GIHW Y   SHA ELTAG
Sbjct  259  TDMGKFFLTWYSNKLIIHGDQVLEEANKVFVGLRVNIAAKVSGIHWWYNHVSHAAELTAG  318

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            +YN   RDGY PIA+MLARH A  NFTC+EMRD EQP +A+ AP++LV+QV  +  +  +
Sbjct  319  FYNVAGRDGYRPIARMLARHHATLNFTCLEMRDSEQPAEAKSAPQELVQQVLSSGWKEYI  378

Query  365  PLAGENALPRYDDYAHEQIL---RTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRF  535
             +AGENALPRYD  A+ QIL   R + ++++      +M   TYLR++ DL Q DN+  F
Sbjct  379  DVAGENALPRYDATAYNQILLNVRPNGVNLNG-PPKLKMSGLTYLRLSDDLLQTDNFELF  437

Query  536  VAFVKKM  556
              FVKKM
Sbjct  438  KKFVKKM  444



>gb|ACJ83786.1| unknown [Medicago truncatula]
Length=283

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 120/186 (65%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T  G+FFL+WYS  LL HG+ IL  AN +F    VK++ KIAGIHW Y T SHA ELT+G
Sbjct  23   TEKGKFFLTWYSNKLLTHGDEILDEANKVFLGCKVKLAAKIAGIHWWYKTESHAAELTSG  82

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYN   RDGY P+A+M ARH AI NFTC+EMR+ EQP++A+   ++LV+QV        +
Sbjct  83   YYNLSDRDGYRPVARMFARHNAILNFTCLEMRNSEQPEEAKSCAQELVQQVLSDGWRENL  142

Query  365  PLAGENALPRYDDYAHEQILRTSALSIDE*SGDRE--MCAFTYLRMNPDLFQADNWRRFV  538
             +AGENALPRYD   + QIL  +  +     G  +  M   TYLR+  +LFQ  N+  F 
Sbjct  143  EVAGENALPRYDSEGYNQILLNARPNGVNKKGPPKLRMYGVTYLRLTEELFQKQNFDIFK  202

Query  539  AFVKKM  556
             FVKKM
Sbjct  203  IFVKKM  208



>pdb|1FA2|A Chain A, Crystal Structure Of Beta-Amylase From Sweet Potato
Length=498

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T  G+FFL+WYS  L+ HG+++L+ AN +F    V I+ K++GIHW Y   SHA ELTAG
Sbjct  258  TDMGKFFLTWYSNKLIIHGDQVLEEANKVFVGLRVNIAAKVSGIHWWYNHVSHAAELTAG  317

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            +YN   RDGY PIA+MLARH A  NFTC+EMRD EQP +A+ AP++LV+QV  +  +  +
Sbjct  318  FYNVAGRDGYRPIARMLARHHATLNFTCLEMRDSEQPAEAKSAPQELVQQVLSSGWKEYI  377

Query  365  PLAGENALPRYDDYAHEQI---LRTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRF  535
             +AGENALPRYD  A+ Q+   LR + ++++      +M   TYLR++ DL Q DN+  F
Sbjct  378  DVAGENALPRYDATAYNQMLLKLRPNGVNLNG-PPKLKMSGLTYLRLSDDLLQTDNFELF  436

Query  536  VAFVKKM  556
              FVKKM
Sbjct  437  KKFVKKM  443



>sp|P10537.4|AMYB_IPOBA RecName: Full=Beta-amylase; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase [Ipomoea batatas]
Length=499

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 128/187 (68%), Gaps = 4/187 (2%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T  G+FFL+WYS  L+ HG+++L+ AN +F    V I+ K++GIHW Y   SHA ELTAG
Sbjct  259  TDMGKFFLTWYSNKLIIHGDQVLEEANKVFVGLRVNIAAKVSGIHWWYNHVSHAAELTAG  318

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            +YN   RDGY PIA+MLARH A  NFTC+EMRD EQP +A+ AP++LV+QV  +  +  +
Sbjct  319  FYNVAGRDGYRPIARMLARHHATLNFTCLEMRDSEQPAEAKSAPQELVQQVLSSGWKEYI  378

Query  365  PLAGENALPRYDDYAHEQIL---RTSALSIDE*SGDREMCAFTYLRMNPDLFQADNWRRF  535
             +AGENALPRYD  A+ Q+L   R + ++++      +M   TYLR++ DL Q DN+  F
Sbjct  379  DVAGENALPRYDATAYNQMLLNVRPNGVNLNG-PPKLKMSGLTYLRLSDDLLQTDNFELF  437

Query  536  VAFVKKM  556
              FVKKM
Sbjct  438  KKFVKKM  444



>dbj|BAD93289.1| beta-amylase [Glycine max]
Length=496

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 124/188 (66%), Gaps = 2/188 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  256  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  315

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  316  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  375

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  376  IRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  435

Query  536  VAFVKKMK  559
              FV KM+
Sbjct  436  KKFVLKMR  443



>gb|AAA33941.1| beta-amylase [Glycine max]
Length=474

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  256  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  315

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  316  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  375

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  376  IRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  435

Query  536  VAFVKKM  556
              FV KM
Sbjct  436  KKFVLKM  442



>ref|NP_001236247.1| beta-amylase precursor [Glycine max]
 sp|P10538.3|AMYB_SOYBN RecName: Full=Beta-amylase; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase [Glycine max]
 emb|CAA50551.1| unnamed protein product [Glycine max]
Length=496

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  256  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  315

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  316  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  375

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  376  IRVAGENALPRYDATAYNQIILNAKPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  435

Query  536  VAFVKKM  556
              FV KM
Sbjct  436  KKFVLKM  442



>pdb|1BYA|A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With 
Beta-Maltose And Maltal: Active Site Components And Their 
Apparent Role In Catalysis
 pdb|1BYB|A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With 
Beta-Maltose And Maltal: Active Site Components And Their 
Apparent Role In Catalysis
 pdb|1BYC|A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With 
Beta-Maltose And Maltal: Active Site Components And Their 
Apparent Role In Catalysis
 pdb|1BYD|A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With 
Beta-Maltose And Maltal: Active Site Components And Their 
Apparent Role In Catalysis
Length=495

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  255  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  314

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  315  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  374

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  375  IRVAGENALPRYDATAYNQIILNAKPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  434

Query  536  VAFVKKM  556
              FV KM
Sbjct  435  KKFVLKM  441



>pdb|1BTC|A Chain A, Three-Dimensional Structure Of Soybean Beta-Amylase 
Determined At 3.0 Angstroms Resolution: Preliminary Chain Tracing 
Of The Complex With Alpha-Cyclodextrin
Length=491

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  251  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  310

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  311  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  370

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  371  IRVAGENALPRYDATAYNQIILNAKPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  430

Query  536  VAFVKKM  556
              FV KM
Sbjct  431  KKFVLKM  437



>pdb|2DQX|A Chain A, Mutant Beta-Amylase (W55r) From Soy Bean
Length=495

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  255  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  314

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  315  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  374

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  375  IRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  434

Query  536  VAFVKKM  556
              FV KM
Sbjct  435  KKFVLKM  441



>gb|KHN22864.1| Beta-amylase [Glycine soja]
Length=489

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 124/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F +  VK+++K++GIHW Y   +HA ELTA
Sbjct  249  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLSCKVKLAIKVSGIHWWYKVENHAAELTA  308

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA++L+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  309  GYYNLNNRDGYRPIARLLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  368

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  369  IQVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNMF  428

Query  536  VAFVKKM  556
              FV KM
Sbjct  429  KKFVLKM  435



>pdb|1Q6C|A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed 
With Maltose
 pdb|1WDP|A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism 
Of Soybean Beta-Amylase
 pdb|1BFN|A Chain A, Beta-AmylaseBETA-Cyclodextrin Complex
Length=495

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  255  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  314

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  315  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  374

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  375  IRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  434

Query  536  VAFVKKM  556
              FV KM
Sbjct  435  KKFVLKM  441



>ref|XP_007149944.1| hypothetical protein PHAVU_005G112400g [Phaseolus vulgaris]
 gb|ESW21938.1| hypothetical protein PHAVU_005G112400g [Phaseolus vulgaris]
Length=587

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 126/186 (68%), Gaps = 2/186 (1%)
 Frame = +2

Query  5    TPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTAG  184
            T  G FFL+WYS  LL HG+ IL  AN +F    VK++ K+AGIHW Y T SHA ELTAG
Sbjct  324  TEKGNFFLTWYSNKLLTHGDDILDEANNVFLGCKVKLAAKVAGIHWWYKTESHAAELTAG  383

Query  185  YYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQV  364
            YYN   RDGY PIA+ML+RH AI NFTC+EMR++EQP +AQ   E+LVRQV     +  +
Sbjct  384  YYNLHHRDGYRPIARMLSRHNAILNFTCLEMRNYEQPVEAQSGAEELVRQVLSCGWKENL  443

Query  365  PLAGENALPRYDDYAHEQILRTSALS-IDE*SGDR-EMCAFTYLRMNPDLFQADNWRRFV  538
             +AGENAL RYD  A++QIL+ +  + I +    R +M   TYLR++ DL +  N+  F 
Sbjct  444  KVAGENALARYDREAYDQILQNARPNGISKLGRPRLKMYGVTYLRLSDDLMKQKNFEIFT  503

Query  539  AFVKKM  556
            AFV+KM
Sbjct  504  AFVRKM  509



>dbj|BAD93288.1| beta-amylase [Glycine max]
Length=496

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  256  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  315

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  316  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  375

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  376  IRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  435

Query  536  VAFVKKM  556
              FV KM
Sbjct  436  KKFVLKM  442



>pdb|1Q6D|A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant (M51t) 
With Increased Ph Optimum
Length=495

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    TTPYGEFFLSWYSQMLLDHGERILQSANAIFDNTGVKISVKIAGIHWHYGTRSHAPELTA  181
             T  G+FFL+WYS  LL+HG++IL  AN  F    VK+++K++GIHW Y   +HA ELTA
Sbjct  255  VTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTA  314

Query  182  GYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDAQCAPEKLVRQVALATQEAQ  361
            GYYN   RDGY PIA+ML+RH AI NFTC+EMRD EQP DA+  P++LV+QV        
Sbjct  315  GYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSGGWRED  374

Query  362  VPLAGENALPRYDDYAHEQILRTSALSIDE*SGDREMCAF--TYLRMNPDLFQADNWRRF  535
            + +AGENALPRYD  A+ QI+  +       +G  ++  F  TYLR++ DL Q  N+  F
Sbjct  375  IRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIF  434

Query  536  VAFVKKM  556
              FV KM
Sbjct  435  KKFVLKM  441



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960