BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015H06 641 bp,

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP25622.1|  hypothetical protein JCGZ_20778                         231   2e-69   Jatropha curcas
ref|XP_008238625.1|  PREDICTED: LOW QUALITY PROTEIN: legumain           229   7e-69   Prunus mume [ume]
ref|XP_006355496.1|  PREDICTED: vacuolar-processing enzyme beta-i...    229   9e-69   Solanum tuberosum [potatoes]
ref|XP_007209951.1|  hypothetical protein PRUPE_ppa004795mg             227   5e-68   Prunus persica
ref|XP_004245733.1|  PREDICTED: vacuolar-processing enzyme beta-i...    227   6e-68   Solanum lycopersicum
ref|XP_003608767.1|  Vacuolar-processing enzyme                         219   5e-67   
ref|XP_008796848.1|  PREDICTED: vacuolar-processing enzyme              223   1e-66   Phoenix dactylifera
tpg|DAA36671.1|  TPA: hypothetical protein ZEAMMB73_569687              217   3e-66   Zea mays [maize]
gb|KDO48392.1|  hypothetical protein CISIN_1g016176mg                   217   6e-66   Citrus sinensis [Valencia orange]
ref|XP_002509577.1|  Vacuolar-processing enzyme precursor               221   2e-65   
ref|XP_009771365.1|  PREDICTED: vacuolar-processing enzyme beta-i...    219   5e-65   Nicotiana sylvestris
gb|KDO48391.1|  hypothetical protein CISIN_1g016176mg                   216   9e-65   Citrus sinensis [Valencia orange]
ref|XP_010933721.1|  PREDICTED: vacuolar-processing enzyme              218   1e-64   Elaeis guineensis
ref|XP_009592399.1|  PREDICTED: vacuolar-processing enzyme              218   1e-64   Nicotiana tomentosiformis
ref|XP_010259032.1|  PREDICTED: vacuolar-processing enzyme-like         218   1e-64   Nelumbo nucifera [Indian lotus]
ref|NP_001152500.1|  LOC100286140                                       217   2e-64   Zea mays [maize]
gb|KJB51882.1|  hypothetical protein B456_008G236100                    218   2e-64   Gossypium raimondii
gb|AES90963.2|  vacuolar processing enzyme                              218   2e-64   Medicago truncatula
ref|XP_003608766.1|  Vacuolar-processing enzyme                         218   2e-64   
ref|XP_010093667.1|  Vacuolar-processing enzyme                         218   2e-64   Morus notabilis
ref|XP_010676183.1|  PREDICTED: vacuolar-processing enzyme              217   3e-64   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KHG28226.1|  Vacuolar-processing enzyme                              216   3e-64   Gossypium arboreum [tree cotton]
emb|CAB42651.2|  putative preprolegumain                                218   3e-64   Nicotiana tabacum [American tobacco]
ref|XP_006391830.1|  hypothetical protein EUTSA_v10023430mg             217   3e-64   Eutrema salsugineum
ref|XP_010695188.1|  PREDICTED: vacuolar-processing enzyme-like         216   3e-64   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KHN09785.1|  Vacuolar-processing enzyme                              217   4e-64   Glycine soja [wild soybean]
ref|XP_002448237.1|  hypothetical protein SORBIDRAFT_06g023820          217   4e-64   Sorghum bicolor [broomcorn]
ref|XP_002886459.1|  F23N19.7                                           218   5e-64   Arabidopsis lyrata subsp. lyrata
gb|EMT33588.1|  Vacuolar-processing enzyme beta-isozyme                 215   5e-64   Aegilops tauschii
ref|XP_006477253.1|  PREDICTED: vacuolar-processing enzyme-like         218   5e-64   Citrus sinensis [Valencia orange]
ref|XP_008668185.1|  PREDICTED: LOC100286140 isoform X1                 217   5e-64   Zea mays [maize]
dbj|BAD25788.1|  putative asparaginyl endopeptidase REP-2               214   6e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007039931.1|  Beta vacuolar processing enzyme                    218   6e-64   Theobroma cacao [chocolate]
ref|XP_003569976.1|  PREDICTED: vacuolar-processing enzyme beta-i...    216   8e-64   Brachypodium distachyon [annual false brome]
ref|XP_006647602.1|  PREDICTED: vacuolar-processing enzyme-like         216   9e-64   Oryza brachyantha
gb|EMS56335.1|  Vacuolar-processing enzyme beta-isozyme                 215   1e-63   Triticum urartu
ref|XP_002452849.1|  hypothetical protein SORBIDRAFT_04g033520          216   1e-63   Sorghum bicolor [broomcorn]
ref|XP_006440379.1|  hypothetical protein CICLE_v10019686mg             216   2e-63   Citrus clementina
gb|AET08888.1|  vacuolar processing enzyme 1                            216   2e-63   Triticum monococcum [einkorn wheat]
ref|XP_002304429.2|  hypothetical protein POPTR_0003s11280g             216   2e-63   Populus trichocarpa [western balsam poplar]
ref|NP_001047562.1|  Os02g0644000                                       214   2e-63   
ref|NP_001236678.1|  vacuolar-processing enzyme precursor               215   2e-63   Glycine max [soybeans]
ref|NP_176458.1|  vacuolar-processing enzyme beta                       215   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418271.1|  PREDICTED: vacuolar-processing enzyme beta-i...    215   3e-63   Camelina sativa [gold-of-pleasure]
gb|AET08892.1|  vacuolar processing enzyme 2                            215   3e-63   Aegilops speltoides
ref|XP_010430341.1|  PREDICTED: vacuolar-processing enzyme beta-i...    214   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_004515742.1|  PREDICTED: vacuolar-processing enzyme-like         214   4e-63   Cicer arietinum [garbanzo]
ref|XP_010473493.1|  PREDICTED: vacuolar-processing enzyme beta-i...    214   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006579475.1|  PREDICTED: seed maturation protein PM40 isof...    214   9e-63   Glycine max [soybeans]
gb|AAF19550.1|AC007190_18  F23N19.7                                     214   1e-62   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41386.1|  asparaginyl endopeptidase REP-2                        213   1e-62   Oryza sativa Japonica Group [Japonica rice]
emb|CDY39808.1|  BnaA09g10600D                                          213   2e-62   Brassica napus [oilseed rape]
gb|AET08895.1|  vacuolar processing enzyme 2                            213   2e-62   Aegilops tauschii
ref|XP_009112700.1|  PREDICTED: vacuolar-processing enzyme beta-i...    213   2e-62   Brassica rapa
ref|XP_006302155.1|  hypothetical protein CARUB_v10020164mg             213   2e-62   Capsella rubella
ref|XP_011018251.1|  PREDICTED: vacuolar-processing enzyme              213   2e-62   Populus euphratica
ref|XP_008437131.1|  PREDICTED: legumain                                212   4e-62   Cucumis melo [Oriental melon]
gb|EPS73966.1|  asparaginyl endopeptidase                               211   4e-62   Genlisea aurea
ref|XP_004976374.1|  PREDICTED: vacuolar-processing enzyme-like         211   6e-62   Setaria italica
gb|AAL40390.1|  C13 cysteine proteinase precursor                       211   6e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_004147613.1|  PREDICTED: vacuolar-processing enzyme-like         211   6e-62   Cucumis sativus [cucumbers]
ref|XP_009382344.1|  PREDICTED: legumain-like                           211   8e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011033921.1|  PREDICTED: vacuolar-processing enzyme-like         210   2e-61   Populus euphratica
sp|O24325.1|VPE1_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    209   2e-61   Phaseolus vulgaris [French bean]
ref|XP_007160985.1|  hypothetical protein PHAVU_001G033500g             209   2e-61   Phaseolus vulgaris [French bean]
ref|NP_001105183.1|  vacuolar processing enzyme1 precursor              209   3e-61   Zea mays [maize]
sp|P49046.1|LEGU_CANEN  RecName: Full=Legumain; AltName: Full=Asp...    209   5e-61   Canavalia ensiformis [horse bean]
emb|CAQ00096.1|  legumain                                               209   5e-61   Hordeum vulgare subsp. vulgare [barley]
gb|KJB65604.1|  hypothetical protein B456_010G103000                    206   5e-61   Gossypium raimondii
emb|CDY03258.1|  BnaC09g10900D                                          209   6e-61   Brassica napus [oilseed rape]
dbj|BAA09615.1|  vacuolar processing enzyme                             209   6e-61   Arabidopsis thaliana [mouse-ear cress]
gb|EYU20379.1|  hypothetical protein MIMGU_mgv1a005412mg                208   9e-61   Erythranthe guttata [common monkey flower]
ref|XP_002455802.1|  hypothetical protein SORBIDRAFT_03g025440          208   9e-61   Sorghum bicolor [broomcorn]
ref|XP_004298668.1|  PREDICTED: legumain                                208   1e-60   Fragaria vesca subsp. vesca
emb|CAB16318.1|  cysteine proteinase precursor                          208   1e-60   Vicia narbonensis
gb|KJB65606.1|  hypothetical protein B456_010G103000                    205   2e-60   Gossypium raimondii
ref|XP_002516472.1|  Vacuolar-processing enzyme precursor, putative     207   2e-60   Ricinus communis
ref|NP_001241716.1|  uncharacterized protein LOC100856894 precursor     207   2e-60   Zea mays [maize]
ref|XP_009398114.1|  PREDICTED: vacuolar-processing enzyme-like         204   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553469.1|  PREDICTED: vacuolar-processing enzyme beta-i...    207   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_003569218.1|  PREDICTED: vacuolar-processing enzyme-like         207   4e-60   Brachypodium distachyon [annual false brome]
gb|ABF00019.1|  legumain precursor                                      206   4e-60   Saccharum officinarum [noble cane]
ref|XP_008369533.1|  PREDICTED: legumain                                206   6e-60   Malus domestica [apple tree]
ref|XP_010646818.1|  PREDICTED: vacuolar-processing enzyme              206   8e-60   Vitis vinifera
emb|CAQ00099.1|  legumain                                               206   9e-60   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004953273.1|  PREDICTED: vacuolar-processing enzyme beta-i...    206   9e-60   Setaria italica
gb|AEY68248.1|  legumain                                                205   1e-59   Saccharum hybrid cultivar SP80-3280
gb|KHG13131.1|  Vacuolar-processing enzyme                              205   1e-59   Gossypium arboreum [tree cotton]
gb|KJB65602.1|  hypothetical protein B456_010G103000                    205   1e-59   Gossypium raimondii
emb|CBI28507.3|  unnamed protein product                                206   2e-59   Vitis vinifera
ref|XP_006382031.1|  hypothetical protein POPTR_0006s24900g             200   2e-59   Populus trichocarpa [western balsam poplar]
gb|AEO79971.1|  vacuolar processing enzyme                              204   2e-59   Arachis diogoi
gb|AIT97058.1|  vacuolar processing enzyme                              200   3e-59   Triticum aestivum [Canadian hard winter wheat]
gb|EMS65516.1|  Vacuolar-processing enzyme                              203   3e-59   Triticum urartu
gb|ACF79136.1|  unknown                                                 204   3e-59   Zea mays [maize]
dbj|BAJ89125.1|  predicted protein                                      199   3e-59   Hordeum vulgare subsp. vulgare [barley]
gb|AET08896.1|  vacuolar processing enzyme 4                            204   3e-59   Aegilops tauschii
gb|AGC54786.1|  beta vacuolar processing enzyme                         204   3e-59   Vitis vinifera
gb|AET08891.1|  vacuolar processing enzyme 4                            204   4e-59   Triticum monococcum [einkorn wheat]
gb|AET08893.1|  vacuolar processing enzyme 4                            204   4e-59   Aegilops speltoides
ref|NP_001291333.1|  vacuolar-processing enzyme precursor               204   4e-59   Sesamum indicum [beniseed]
gb|EYU34366.1|  hypothetical protein MIMGU_mgv1a018579mg                204   4e-59   Erythranthe guttata [common monkey flower]
gb|ABK25457.1|  unknown                                                 203   5e-59   Picea sitchensis
gb|AFW72544.1|  vacuolar processing enzyme 1                            204   5e-59   Zea mays [maize]
emb|CAC18100.1|  putative legumain                                      203   6e-59   Zea mays [maize]
gb|ACG34144.1|  vacuolar processing enzyme precursor                    203   6e-59   Zea mays [maize]
ref|NP_001105613.1|  LOC542609 precursor                                203   7e-59   
ref|NP_001236564.1|  vacuolar processing enzyme 2 precursor             203   7e-59   Glycine max [soybeans]
gb|EYU24761.1|  hypothetical protein MIMGU_mgv1a005235mg                203   8e-59   Erythranthe guttata [common monkey flower]
ref|XP_010526156.1|  PREDICTED: vacuolar-processing enzyme gamma-...    203   9e-59   Tarenaya hassleriana [spider flower]
ref|XP_006296251.1|  hypothetical protein CARUB_v10025418mg             202   1e-58   Capsella rubella
gb|ACQ91103.1|  vacuolar processing enzyme a                            203   1e-58   Populus tomentosa [Chinese white poplar]
ref|XP_006371860.1|  hypothetical protein POPTR_0018s04650g             202   1e-58   Populus trichocarpa [western balsam poplar]
emb|CAB42655.1|  putative preprolegumain                                200   1e-58   Vicia narbonensis
ref|XP_002324151.1|  asparaginyl endopeptidase family protein           202   1e-58   Populus trichocarpa [western balsam poplar]
emb|CBI20614.3|  unnamed protein product                                202   2e-58   Vitis vinifera
gb|EEE54813.1|  hypothetical protein OsJ_02232                          202   2e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009337146.1|  PREDICTED: vacuolar-processing enzyme-like         202   2e-58   Pyrus x bretschneideri [bai li]
emb|CAB64545.1|  legumain-like protease                                 202   2e-58   Zea mays [maize]
ref|NP_001238297.1|  seed maturation protein PM40 precursor             202   2e-58   Glycine max [soybeans]
ref|XP_002276759.2|  PREDICTED: vacuolar-processing enzyme              203   2e-58   Vitis vinifera
ref|NP_001043344.1|  Os01g0559600                                       202   2e-58   
emb|CAN70603.1|  hypothetical protein VITISV_040193                     202   3e-58   Vitis vinifera
ref|XP_008377927.1|  PREDICTED: vacuolar-processing enzyme-like         201   4e-58   Malus domestica [apple tree]
gb|KHN37015.1|  Vacuolar-processing enzyme                              201   4e-58   Glycine soja [wild soybean]
ref|XP_003550283.1|  PREDICTED: vacuolar-processing enzyme-like         201   5e-58   Glycine max [soybeans]
ref|XP_009783032.1|  PREDICTED: vacuolar-processing enzyme-like         197   5e-58   Nicotiana sylvestris
ref|XP_011019533.1|  PREDICTED: vacuolar-processing enzyme isofor...    199   5e-58   Populus euphratica
gb|KJB65608.1|  hypothetical protein B456_010G103000                    196   6e-58   Gossypium raimondii
ref|XP_006646004.1|  PREDICTED: vacuolar-processing enzyme-like         201   6e-58   
ref|XP_010417372.1|  PREDICTED: vacuolar-processing enzyme alpha-...    200   8e-58   Camelina sativa [gold-of-pleasure]
gb|AAF69014.1|AF260827_1  cysteine protease                             201   8e-58   Ipomoea batatas [batate]
gb|AGC94757.1|  vacuolar processing enzyme                              201   8e-58   Malus sikkimensis
ref|XP_008393660.1|  PREDICTED: vacuolar-processing enzyme              201   8e-58   Malus domestica [apple tree]
emb|CDP09908.1|  unnamed protein product                                201   9e-58   Coffea canephora [robusta coffee]
ref|XP_007012236.1|  Gamma vacuolar processing enzyme                   200   9e-58   Theobroma cacao [chocolate]
gb|EYU29312.1|  hypothetical protein MIMGU_mgv1a005315mg                200   9e-58   Erythranthe guttata [common monkey flower]
ref|XP_004291017.1|  PREDICTED: vacuolar-processing enzyme              200   1e-57   Fragaria vesca subsp. vesca
gb|EMS54452.1|  Vacuolar-processing enzyme                              199   1e-57   Triticum urartu
dbj|BAJ95226.1|  predicted protein                                      200   1e-57   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010429610.1|  PREDICTED: vacuolar-processing enzyme alpha-...    200   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002880728.1|  alpha-vacuolar processing enzyme                   200   1e-57   Arabidopsis lyrata subsp. lyrata
ref|NP_001105119.1|  legumain-like protease precursor                   200   1e-57   Zea mays [maize]
gb|AGC94756.1|  vacuolar processing enzyme                              200   1e-57   Malus sieversii
gb|EMT02419.1|  Vacuolar-processing enzyme                              201   1e-57   Aegilops tauschii
gb|EMT06287.1|  Vacuolar-processing enzyme                              198   2e-57   Aegilops tauschii
ref|XP_009361606.1|  PREDICTED: vacuolar-processing enzyme-like         199   3e-57   Pyrus x bretschneideri [bai li]
gb|AGC94758.1|  vacuolar processing enzyme                              199   3e-57   Malus hupehensis
dbj|BAA76745.1|  asparaginyl endopeptidase (VmPE-1A)                    199   3e-57   Vigna mungo [urad dal]
gb|AAK15049.1|AF238384_1  asparaginyl endopeptidase                     199   3e-57   Vigna radiata [mung bean]
gb|KJB06487.1|  hypothetical protein B456_001G023700                    199   4e-57   Gossypium raimondii
ref|XP_010472621.1|  PREDICTED: vacuolar-processing enzyme alpha-...    199   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002308580.1|  asparaginyl endopeptidase family protein           199   4e-57   Populus trichocarpa [western balsam poplar]
gb|KHG30636.1|  Vacuolar-processing enzyme                              198   5e-57   Gossypium arboreum [tree cotton]
ref|XP_011019532.1|  PREDICTED: vacuolar-processing enzyme isofor...    198   5e-57   Populus euphratica
gb|ACR24644.1|  vacuolar processing enzyme                              198   5e-57   Malus hupehensis var. mengshanensis
gb|AFK40405.1|  unknown                                                 195   5e-57   Lotus japonicus
emb|CBX26639.1|  vacuolar processing enzyme 2c                          198   6e-57   Hordeum vulgare subsp. vulgare [barley]
dbj|BAC54829.1|  vacuolar processing enzyme-2                           198   6e-57   Nicotiana tabacum [American tobacco]
ref|XP_007136809.1|  hypothetical protein PHAVU_009G076100g             198   6e-57   Phaseolus vulgaris [French bean]
ref|XP_008797891.1|  PREDICTED: vacuolar-processing enzyme              198   8e-57   Phoenix dactylifera
ref|XP_010053430.1|  PREDICTED: vacuolar-processing enzyme isofor...    196   9e-57   Eucalyptus grandis [rose gum]
ref|XP_004501477.1|  PREDICTED: vacuolar-processing enzyme-like         197   1e-56   Cicer arietinum [garbanzo]
gb|KDP34125.1|  hypothetical protein JCGZ_07696                         197   1e-56   Jatropha curcas
gb|AGC94759.1|  vacuolar processing enzyme                              197   1e-56   Malus micromalus [Kaido crab apple]
ref|XP_010097094.1|  Vacuolar-processing enzyme                         197   1e-56   Morus notabilis
ref|XP_010526069.1|  PREDICTED: vacuolar-processing enzyme gamma-...    197   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_009607675.1|  PREDICTED: vacuolar-processing enzyme-like         197   1e-56   Nicotiana tomentosiformis
ref|XP_011096125.1|  PREDICTED: vacuolar-processing enzyme              197   1e-56   Sesamum indicum [beniseed]
ref|XP_010911246.1|  PREDICTED: vacuolar-processing enzyme              197   2e-56   Elaeis guineensis
emb|CDM87100.1|  unnamed protein product                                197   2e-56   Triticum aestivum [Canadian hard winter wheat]
emb|CDP08231.1|  unnamed protein product                                196   3e-56   Coffea canephora [robusta coffee]
ref|XP_009420869.1|  PREDICTED: vacuolar-processing enzyme-like         196   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW81643.1|  hypothetical protein EUGRSUZ_C03004                     195   3e-56   Eucalyptus grandis [rose gum]
ref|XP_007222246.1|  hypothetical protein PRUPE_ppa004713mg             196   4e-56   Prunus persica
ref|XP_010432633.1|  PREDICTED: vacuolar-processing enzyme gamma-...    196   4e-56   Camelina sativa [gold-of-pleasure]
emb|CAA07639.1|  cysteine proteinase precursor                          196   4e-56   Vicia sativa [spring vetch]
ref|XP_010264202.1|  PREDICTED: vacuolar-processing enzyme-like         196   6e-56   Nelumbo nucifera [Indian lotus]
ref|XP_003525979.1|  PREDICTED: vacuolar-processing enzyme-like         196   6e-56   Glycine max [soybeans]
ref|XP_008220440.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    196   6e-56   Prunus mume [ume]
gb|KHG24041.1|  Vacuolar-processing enzyme                              196   7e-56   Gossypium arboreum [tree cotton]
ref|XP_010669169.1|  PREDICTED: vacuolar-processing enzyme-like         195   8e-56   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KFK32531.1|  hypothetical protein AALP_AA6G255400                    195   8e-56   Arabis alpina [alpine rockcress]
ref|XP_010049168.1|  PREDICTED: vacuolar-processing enzyme-like         195   9e-56   Eucalyptus grandis [rose gum]
ref|XP_004253098.1|  PREDICTED: vacuolar-processing enzyme              195   9e-56   Solanum lycopersicum
ref|XP_010053427.1|  PREDICTED: vacuolar-processing enzyme isofor...    195   1e-55   Eucalyptus grandis [rose gum]
ref|XP_007155624.1|  hypothetical protein PHAVU_003G217500g             195   1e-55   Phaseolus vulgaris [French bean]
gb|EMT14075.1|  Vacuolar-processing enzyme beta-isozyme                 193   1e-55   Aegilops tauschii
ref|XP_003603121.1|  Vacuolar processing enzyme                         195   1e-55   Medicago truncatula
ref|XP_002960690.1|  hypothetical protein SELMODRAFT_75074              194   1e-55   Selaginella moellendorffii
sp|O24326.1|VPE2_PHAVU  RecName: Full=Vacuolar-processing enzyme;...    195   1e-55   Phaseolus vulgaris [French bean]
dbj|BAJ33795.1|  unnamed protein product                                194   1e-55   Eutrema halophilum
ref|XP_006838617.1|  hypothetical protein AMTR_s00002p00230280          194   2e-55   
ref|XP_010447316.1|  PREDICTED: vacuolar-processing enzyme gamma-...    194   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_003580236.1|  PREDICTED: vacuolar-processing enzyme beta-i...    194   2e-55   Brachypodium distachyon [annual false brome]
ref|XP_006412409.1|  hypothetical protein EUTSA_v10025034mg             194   2e-55   Eutrema salsugineum
gb|KJB06489.1|  hypothetical protein B456_001G023700                    194   2e-55   Gossypium raimondii
gb|ABS57371.1|  VPE1                                                    194   3e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006342509.1|  PREDICTED: vacuolar-processing enzyme-like         193   3e-55   Solanum tuberosum [potatoes]
ref|XP_006408834.1|  hypothetical protein EUTSA_v10001970mg             193   4e-55   Eutrema salsugineum
emb|CAH56498.1|  cysteine protease                                      193   4e-55   Solanum lycopersicum
ref|XP_006355320.1|  PREDICTED: vacuolar-processing enzyme              193   4e-55   Solanum tuberosum [potatoes]
gb|EMT00724.1|  Vacuolar-processing enzyme                              193   5e-55   Aegilops tauschii
ref|XP_009407316.1|  PREDICTED: vacuolar-processing enzyme-like         193   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437829.1|  PREDICTED: vacuolar-processing enzyme gamma-...    193   7e-55   Camelina sativa [gold-of-pleasure]
emb|CAQ00097.1|  legumain                                               192   7e-55   Hordeum vulgare subsp. vulgare [barley]
emb|CBM41515.1|  legumain/vacuolar processing enzyme                    192   8e-55   Papaver rhoeas [Flanders poppy]
gb|KJB25635.1|  hypothetical protein B456_004G201300                    192   9e-55   Gossypium raimondii
ref|XP_011081710.1|  PREDICTED: vacuolar-processing enzyme              192   9e-55   Sesamum indicum [beniseed]
dbj|BAA76744.1|  asparaginyl endopeptidase (VmPE-1)                     192   1e-54   Vigna mungo [urad dal]
gb|ACC68680.1|  vacoular processing enzyme 1                            192   1e-54   Solanum tuberosum [potatoes]
ref|XP_009117035.1|  PREDICTED: vacuolar-processing enzyme alpha-...    192   1e-54   Brassica rapa
ref|XP_002993765.1|  hypothetical protein SELMODRAFT_137569             191   1e-54   Selaginella moellendorffii
gb|EMS56147.1|  Vacuolar-processing enzyme                              191   1e-54   Triticum urartu
emb|CAQ00098.1|  legumain                                               192   2e-54   Hordeum vulgare subsp. vulgare [barley]
emb|CBX26638.1|  vacuolar processing enzyme 2b                          192   2e-54   Hordeum vulgare subsp. vulgare [barley]
emb|CBX26640.1|  vacuolar processing enzyme 2d                          192   2e-54   Hordeum vulgare subsp. vulgare [barley]
sp|B8ASK4.1|VPE1_ORYSI  RecName: Full=Vacuolar-processing enzyme ...    192   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_006652582.1|  PREDICTED: vacuolar-processing enzyme-like         192   2e-54   Oryza brachyantha
ref|NP_001053428.1|  Os04g0537900                                       192   2e-54   
emb|CDX76736.1|  BnaC08g33220D                                          191   3e-54   Brassica napus [oilseed rape]
emb|CBX26637.1|  vacuolar processing enzyme 2a                          189   3e-54   Hordeum vulgare subsp. vulgare [barley]
gb|KHN29737.1|  Vacuolar-processing enzyme                              191   4e-54   Glycine soja [wild soybean]
gb|EPS59704.1|  hypothetical protein M569_15100                         189   5e-54   Genlisea aurea
emb|CDY71653.1|  BnaCnng73810D                                          184   6e-54   Brassica napus [oilseed rape]
sp|P49044.1|VPE_VICSA  RecName: Full=Vacuolar-processing enzyme; ...    190   6e-54   Vicia sativa [spring vetch]
ref|XP_004245113.1|  PREDICTED: vacuolar-processing enzyme-like         190   6e-54   Solanum lycopersicum
ref|XP_007023637.1|  Delta vacuolar processing enzyme, putative         191   6e-54   Theobroma cacao [chocolate]
emb|CDY11506.1|  BnaA09g40720D                                          190   7e-54   Brassica napus [oilseed rape]
ref|NP_001275272.1|  vacoular processing enzyme 2 precursor             189   8e-54   Solanum tuberosum [potatoes]
gb|EPS65165.1|  vacuolar processing enzyme-1b                           189   1e-53   Genlisea aurea
gb|AAD04882.1|  C13 endopeptidase NP1 precursor                         187   1e-53   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006578073.1|  PREDICTED: vacuolar-processing enzyme-like         189   1e-53   Glycine max [soybeans]
dbj|BAC86022.1|  unnamed protein product                                189   1e-53   Homo sapiens [man]
ref|XP_008444493.1|  PREDICTED: vacuolar-processing enzyme-like         189   2e-53   Cucumis melo [Oriental melon]
ref|XP_004142919.1|  PREDICTED: vacuolar-processing enzyme-like         189   2e-53   Cucumis sativus [cucumbers]
ref|XP_009616670.1|  PREDICTED: vacuolar-processing enzyme-like         189   2e-53   Nicotiana tomentosiformis
ref|NP_180165.1|  alpha-vacuolar processing enzyme                      189   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244352.1|  PREDICTED: vacuolar-processing enzyme-like         189   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_004159537.1|  PREDICTED: vacuolar-processing enzyme-like         189   3e-53   
gb|KJB54730.1|  hypothetical protein B456_009G046800                    187   4e-53   Gossypium raimondii
emb|CAQ00100.1|  legumain                                               188   4e-53   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009396761.1|  PREDICTED: vacuolar-processing enzyme-like         187   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO48393.1|  hypothetical protein CISIN_1g016176mg                   182   5e-53   Citrus sinensis [Valencia orange]
ref|XP_004960991.1|  PREDICTED: vacuolar-processing enzyme-like         187   5e-53   Setaria italica
gb|ABR18199.1|  unknown                                                 188   5e-53   Picea sitchensis
gb|KHG17266.1|  Vacuolar-processing enzyme                              187   5e-53   Gossypium arboreum [tree cotton]
ref|XP_010429611.1|  PREDICTED: vacuolar-processing enzyme alpha-...    187   6e-53   Camelina sativa [gold-of-pleasure]
gb|ACB30368.1|  vascular processing enzyme-3                            187   7e-53   Capsicum annuum
gb|EMT06055.1|  Vacuolar-processing enzyme                              187   9e-53   Aegilops tauschii
ref|XP_010669172.1|  PREDICTED: vacuolar-processing enzyme-like         187   1e-52   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006599066.1|  PREDICTED: vacuolar-processing enzyme-like         186   3e-52   Glycine max [soybeans]
gb|KHN27584.1|  Vacuolar-processing enzyme                              186   3e-52   Glycine soja [wild soybean]
ref|XP_002983346.1|  hypothetical protein SELMODRAFT_445464             186   5e-52   Selaginella moellendorffii
ref|XP_009762556.1|  PREDICTED: vacuolar-processing enzyme-like         185   5e-52   Nicotiana sylvestris
gb|AIB06797.1|  cte peptide ligase                                      185   6e-52   Clitoria ternatea
ref|XP_004499511.1|  PREDICTED: vacuolar-processing enzyme gamma-...    184   6e-52   Cicer arietinum [garbanzo]
gb|AES90965.2|  vacuolar processing enzyme                              182   6e-52   Medicago truncatula
ref|XP_003608768.1|  Vacuolar-processing enzyme                         182   8e-52   
ref|XP_009410798.1|  PREDICTED: vacuolar-processing enzyme              184   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60990.1|  vacuolar processing enzyme a                            178   2e-51   Genlisea aurea
ref|XP_009780274.1|  PREDICTED: vacuolar-processing enzyme-like         183   3e-51   Nicotiana sylvestris
ref|XP_009616632.1|  PREDICTED: vacuolar-processing enzyme-like         183   3e-51   Nicotiana tomentosiformis
gb|EMT10444.1|  Vacuolar-processing enzyme                              183   5e-51   Aegilops tauschii
gb|KHG20621.1|  Vacuolar-processing enzyme                              182   6e-51   Gossypium arboreum [tree cotton]
ref|XP_002310920.1|  hypothetical protein POPTR_0008s00410g             182   9e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006853917.1|  hypothetical protein AMTR_s00036p00187360          181   9e-51   Amborella trichopoda
ref|XP_004968980.1|  PREDICTED: vacuolar-processing enzyme-like         182   1e-50   Setaria italica
gb|KJB65607.1|  hypothetical protein B456_010G103000                    178   2e-50   Gossypium raimondii
gb|ABR17022.1|  unknown                                                 176   3e-50   Picea sitchensis
ref|XP_001784456.1|  predicted protein                                  179   5e-50   Physcomitrella patens
ref|XP_002987841.1|  hypothetical protein SELMODRAFT_126781             179   5e-50   Selaginella moellendorffii
ref|XP_006285517.1|  hypothetical protein CARUB_v10006959mg             179   6e-50   Capsella rubella
gb|KJB35710.1|  hypothetical protein B456_006G124900                    179   8e-50   Gossypium raimondii
emb|CAE03020.3|  OSJNBa0091D06.13                                       179   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003622265.1|  Vacuolar processing enzyme-1b                      178   1e-49   Medicago truncatula
dbj|BAD94396.1|  beta-VPE                                               173   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb|EMT17626.1|  Vacuolar-processing enzyme                              181   1e-49   Aegilops tauschii
ref|XP_010112450.1|  Vacuolar-processing enzyme                         177   3e-49   Morus notabilis
ref|XP_004498922.1|  PREDICTED: vacuolar-processing enzyme-like         177   3e-49   
ref|XP_009621616.1|  PREDICTED: vacuolar-processing enzyme gamma-...    176   7e-49   
emb|CDP09909.1|  unnamed protein product                                177   8e-49   
ref|XP_008240642.1|  PREDICTED: vacuolar-processing enzyme-like         176   9e-49   
ref|XP_011033074.1|  PREDICTED: vacuolar-processing enzyme alpha-...    176   1e-48   
ref|XP_006654878.1|  PREDICTED: vacuolar-processing enzyme-like         175   2e-48   
gb|KJB06490.1|  hypothetical protein B456_001G023700                    173   2e-48   
gb|KJB70141.1|  hypothetical protein B456_011G060200                    175   3e-48   
ref|XP_002266627.1|  PREDICTED: vacuolar-processing enzyme              175   3e-48   
gb|KDO80008.1|  hypothetical protein CISIN_1g011066mg                   171   3e-48   
ref|XP_001759301.1|  predicted protein                                  174   6e-48   
ref|XP_006355318.1|  PREDICTED: vacuolar-processing enzyme-like         174   7e-48   
gb|KEH39941.1|  vacuolar processing enzyme                              174   8e-48   
ref|XP_007202848.1|  hypothetical protein PRUPE_ppa014701mg             173   1e-47   
ref|NP_001056504.1|  Os05g0593900                                       173   1e-47   
ref|XP_007216154.1|  hypothetical protein PRUPE_ppa015210mg             173   2e-47   
ref|XP_006450793.1|  hypothetical protein CICLE_v10008097mg             171   2e-47   
gb|KJB35711.1|  hypothetical protein B456_006G124900                    172   3e-47   
emb|CDX75302.1|  BnaA01g04000D                                          172   3e-47   
gb|ACJ84443.1|  unknown                                                 172   3e-47   
ref|XP_010669196.1|  PREDICTED: vacuolar-processing enzyme gamma-...    172   3e-47   
ref|XP_009125229.1|  PREDICTED: vacuolar-processing enzyme gamma-...    172   4e-47   
ref|XP_006450794.1|  hypothetical protein CICLE_v10008097mg             170   4e-47   
dbj|BAA18924.1|  gamma-VPE                                              172   4e-47   
ref|XP_008392598.1|  PREDICTED: vacuolar-processing enzyme-like         172   4e-47   
gb|KDO80007.1|  hypothetical protein CISIN_1g011066mg                   171   4e-47   
emb|CDX68923.1|  BnaC01g05300D                                          172   4e-47   
ref|XP_001769381.1|  predicted protein                                  171   4e-47   
ref|NP_195020.1|  vacuolar-processing enzyme gamma                      172   4e-47   
ref|XP_002867219.1|  GAMMA-VPE                                          172   5e-47   
gb|KDO80009.1|  hypothetical protein CISIN_1g011066mg                   170   1e-46   
ref|XP_009764212.1|  PREDICTED: vacuolar-processing enzyme-like         170   1e-46   
ref|XP_010669185.1|  PREDICTED: vacuolar-processing enzyme gamma-...    170   2e-46   
ref|XP_006450795.1|  hypothetical protein CICLE_v10008097mg             170   2e-46   
ref|XP_008228013.1|  PREDICTED: vacuolar-processing enzyme-like         169   3e-46   
ref|XP_008380412.1|  PREDICTED: vacuolar-processing enzyme              169   4e-46   
emb|CAO02544.1|  putative asparaginyl endopeptidase                     160   7e-46   
emb|CAO02545.1|  putative asparaginyl endopeptidase                     160   9e-46   
ref|XP_009344982.1|  PREDICTED: vacuolar-processing enzyme-like         168   9e-46   
ref|XP_004245119.1|  PREDICTED: vacuolar-processing enzyme-like         167   2e-45   
ref|XP_009379206.1|  PREDICTED: vacuolar-processing enzyme-like         167   2e-45   
ref|XP_009371106.1|  PREDICTED: vacuolar-processing enzyme-like         167   3e-45   
ref|XP_006355317.1|  PREDICTED: vacuolar-processing enzyme-like         167   3e-45   
ref|XP_004305798.1|  PREDICTED: vacuolar-processing enzyme-like         166   4e-45   
ref|XP_010545489.1|  PREDICTED: vacuolar-processing enzyme gamma-...    166   5e-45   
ref|XP_009616671.1|  PREDICTED: vacuolar-processing enzyme-like         166   5e-45   
ref|XP_001755207.1|  predicted protein                                  166   5e-45   
ref|NP_001275777.1|  vacuolar-processing enzyme precursor               166   5e-45   
ref|XP_008370166.1|  PREDICTED: vacuolar-processing enzyme-like         166   5e-45   
gb|KFK29905.1|  hypothetical protein AALP_AA7G193600                    166   6e-45   
ref|XP_006355332.1|  PREDICTED: vacuolar-processing enzyme-like         165   9e-45   
ref|XP_008337583.1|  PREDICTED: vacuolar-processing enzyme-like         165   1e-44   
ref|XP_009794187.1|  PREDICTED: vacuolar-processing enzyme-like         164   2e-44   
ref|XP_010545490.1|  PREDICTED: vacuolar-processing enzyme alpha-...    166   2e-44   
ref|XP_006450041.1|  hypothetical protein CICLE_v10013934mg             164   2e-44   
ref|XP_009783281.1|  PREDICTED: vacuolar-processing enzyme-like         164   3e-44   
ref|XP_009371107.1|  PREDICTED: vacuolar-processing enzyme-like         164   4e-44   
ref|XP_011467518.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    164   5e-44   
ref|XP_008337584.1|  PREDICTED: vacuolar-processing enzyme-like         162   1e-43   
gb|EMT07410.1|  Vacuolar-processing enzyme beta-isozyme                 162   1e-43   
ref|XP_010325045.1|  PREDICTED: vacuolar-processing enzyme-like         162   1e-43   
ref|XP_011465105.1|  PREDICTED: vacuolar-processing enzyme-like         162   2e-43   
ref|XP_008367906.1|  PREDICTED: vacuolar-processing enzyme-like         162   2e-43   
ref|XP_009762559.1|  PREDICTED: vacuolar-processing enzyme-like         160   3e-43   
ref|XP_002441635.1|  hypothetical protein SORBIDRAFT_09g030710          160   9e-43   
ref|XP_010034096.1|  PREDICTED: vacuolar-processing enzyme-like         160   1e-42   
ref|XP_004491991.1|  PREDICTED: vacuolar-processing enzyme-like         160   2e-42   
ref|XP_009371110.1|  PREDICTED: vacuolar-processing enzyme-like         159   3e-42   
ref|XP_008337582.1|  PREDICTED: vacuolar-processing enzyme-like         158   3e-42   
ref|XP_004491990.1|  PREDICTED: vacuolar-processing enzyme-like         159   4e-42   
ref|XP_006355333.1|  PREDICTED: vacuolar-processing enzyme-like         157   7e-42   
dbj|BAD51741.1|  vacuolar processing enzyme 1b                          154   7e-42   
gb|KCW53991.1|  hypothetical protein EUGRSUZ_J03188                     156   1e-41   
dbj|BAD51740.1|  vacuolar processing enzyme 1a                          153   2e-41   
ref|XP_008352319.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    156   2e-41   
gb|KCW53989.1|  hypothetical protein EUGRSUZ_J03187                     152   2e-41   
emb|CAE84598.1|  putative legumain                                      155   2e-41   
ref|XP_010034095.1|  PREDICTED: vacuolar-processing enzyme-like         156   3e-41   
gb|KJB54732.1|  hypothetical protein B456_009G046900                    151   3e-41   
gb|KCW53994.1|  hypothetical protein EUGRSUZ_J03190                     155   4e-41   
gb|KCW53995.1|  hypothetical protein EUGRSUZ_J03190                     155   4e-41   
ref|XP_009616669.1|  PREDICTED: vacuolar-processing enzyme-like         155   5e-41   
ref|XP_008361289.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-pro...    155   7e-41   
gb|KCW53993.1|  hypothetical protein EUGRSUZ_J03190                     154   8e-41   
ref|NP_001131347.1|  uncharacterized protein LOC100192667 precursor     155   1e-40   
ref|XP_008654306.1|  PREDICTED: uncharacterized protein LOC100192...    154   1e-40   
ref|XP_004516951.1|  PREDICTED: vacuolar-processing enzyme-like         154   1e-40   
gb|EYU21190.1|  hypothetical protein MIMGU_mgv1a005661mg                154   1e-40   
ref|XP_010034097.1|  PREDICTED: vacuolar-processing enzyme alpha-...    154   2e-40   
ref|XP_010325261.1|  PREDICTED: vacuolar-processing enzyme-like         153   3e-40   
ref|XP_004245377.1|  PREDICTED: vacuolar-processing enzyme-like         153   3e-40   
ref|XP_010112451.1|  Vacuolar-processing enzyme                         156   3e-40   
ref|XP_004245120.1|  PREDICTED: vacuolar-processing enzyme gamma-...    152   4e-40   
gb|KFK39346.1|  vacuolar processing enzyme                              151   1e-39   
ref|XP_005651789.1|  hypothetical protein COCSUDRAFT_64138              152   2e-39   
ref|XP_006450035.1|  hypothetical protein CICLE_v10013957mg             150   2e-39   
ref|XP_010487991.1|  PREDICTED: vacuolar-processing enzyme gamma-...    150   2e-39   
emb|CAB51545.1|  vacuolar processing enzyme                             150   2e-39   
ref|XP_010034886.1|  PREDICTED: vacuolar-processing enzyme-like         151   4e-39   
ref|XP_004499586.1|  PREDICTED: vacuolar-processing enzyme-like         150   5e-39   
ref|XP_006296792.1|  hypothetical protein CARUB_v10016221mg             150   6e-39   
ref|XP_010487992.1|  PREDICTED: vacuolar-processing enzyme alpha-...    150   6e-39   
ref|XP_006355331.1|  PREDICTED: vacuolar-processing enzyme-like         149   7e-39   
ref|XP_006355330.1|  PREDICTED: vacuolar-processing enzyme-like         149   1e-38   
ref|XP_010508646.1|  PREDICTED: vacuolar-processing enzyme-like i...    149   2e-38   
ref|XP_006368681.1|  hypothetical protein POPTR_0001s07710g             143   2e-38   
ref|XP_010508655.1|  PREDICTED: vacuolar-processing enzyme alpha-...    148   4e-38   
ref|XP_004303795.1|  PREDICTED: vacuolar-processing enzyme-like         147   5e-38   
ref|XP_010466201.1|  PREDICTED: vacuolar-processing enzyme alpha-...    148   5e-38   
gb|KDO80010.1|  hypothetical protein CISIN_1g011066mg                   145   5e-38   
ref|XP_002883236.1|  DELTA-VPE                                          145   2e-37   
ref|XP_004245378.1|  PREDICTED: vacuolar-processing enzyme-like         147   2e-37   
ref|XP_009111229.1|  PREDICTED: vacuolar-processing enzyme-like         145   2e-37   
ref|XP_009145662.1|  PREDICTED: vacuolar-processing enzyme              145   2e-37   
emb|CDY25397.1|  BnaA05g18870D                                          145   2e-37   
dbj|BAA90621.1|  putative asparagine-specific endopeptidase precu...    145   3e-37   
gb|KDD72820.1|  C13 peptidase                                           140   2e-36   
emb|CDY42232.1|  BnaA01g25630D                                          142   5e-36   
ref|XP_010669190.1|  PREDICTED: vacuolar-processing enzyme-like         141   6e-36   
ref|XP_010325264.1|  PREDICTED: vacuolar-processing enzyme-like         141   2e-35   
ref|XP_004499587.1|  PREDICTED: vacuolar-processing enzyme gamma-...    140   2e-35   
ref|XP_004499640.1|  PREDICTED: vacuolar-processing enzyme-like         139   3e-35   
ref|XP_005846964.1|  hypothetical protein CHLNCDRAFT_24292              139   4e-35   
ref|XP_003624089.1|  Vacuolar processing enzyme-1a                      139   7e-35   
gb|AES80307.2|  vacuolar processing enzyme                              138   8e-35   
ref|XP_009123484.1|  PREDICTED: vacuolar-processing enzyme-like         134   8e-35   
ref|XP_007216228.1|  hypothetical protein PRUPE_ppa016772mg             137   1e-34   
ref|XP_006406410.1|  hypothetical protein EUTSA_v10020662mg             137   2e-34   
ref|XP_003623751.1|  Vacuolar processing enzyme-1b                      137   3e-34   
gb|AES79969.2|  vacuolar processing enzyme                              136   3e-34   
gb|KJB44946.1|  hypothetical protein B456_007G281200                    132   5e-34   
gb|KJB06488.1|  hypothetical protein B456_001G023700                    133   7e-34   
ref|XP_001703162.1|  vacuolar processing enzyme                         136   2e-33   
ref|XP_004491693.1|  PREDICTED: vacuolar-processing enzyme-like         134   2e-33   
ref|XP_006382030.1|  hypothetical protein POPTR_0006s24900g             132   3e-33   
emb|CDY12724.1|  BnaC04g29170D                                          133   5e-33   
emb|CDY29802.1|  BnaC05g31880D                                          132   1e-32   
ref|XP_011461721.1|  PREDICTED: vacuolar-processing enzyme-like         127   2e-32   
gb|AFK44897.1|  unknown                                                 130   2e-32   
ref|XP_011396954.1|  Vacuolar-processing enzyme beta-isozyme            132   5e-32   
ref|XP_004517111.1|  PREDICTED: vacuolar-processing enzyme-like         129   7e-32   
ref|XP_003589032.1|  Vacuolar-processing enzyme                         129   2e-31   
ref|XP_006450038.1|  hypothetical protein CICLE_v100139432mg            125   1e-30   
ref|XP_004491694.1|  PREDICTED: vacuolar-processing enzyme-like         126   2e-30   
gb|EMT15482.1|  Vacuolar-processing enzyme                              126   2e-30   
ref|XP_008864865.1|  hypothetical protein H310_02944                    121   6e-29   
gb|AAM60827.1|  vacuolar processing enzyme/asparaginyl endopeptid...    121   9e-29   
ref|NP_188656.1|  delta vacuolar processing enzyme                      121   1e-28   
dbj|BAF51711.1|  tick legumain                                          120   1e-28   
ref|XP_008609519.1|  hypothetical protein SDRG_05574                    120   2e-28   
ref|NP_001189938.1|  delta vacuolar processing enzyme                   121   2e-28   
gb|EAY99261.1|  hypothetical protein OsI_21225                          118   8e-28   
ref|XP_008367907.1|  PREDICTED: vacuolar-processing enzyme-like         116   9e-28   
gb|AAS94231.1|  legumain-like protease precursor                        117   3e-27   
gb|EJY83065.1|  Hemoglobinase-type cysteine proteinase                  117   3e-27   
gb|EJY80671.1|  Hemoglobinase-type cysteine proteinase                  116   3e-27   
gb|KJB65605.1|  hypothetical protein B456_010G103000                    114   5e-27   
gb|KJB65603.1|  hypothetical protein B456_010G103000                    114   6e-27   
emb|CAN76990.1|  hypothetical protein VITISV_028106                     115   7e-27   
gb|KDO29476.1|  hypothetical protein SPRG_06015                         115   1e-26   
gb|KDO80012.1|  hypothetical protein CISIN_1g011066mg                   113   2e-26   
emb|CBJ30537.1|  Vacuolar Processing Enzyme                             114   3e-26   
gb|KHN76941.1|  Legumain                                                113   6e-26   
gb|ACJ85695.1|  unknown                                                 111   6e-26   
emb|CDW88179.1|  peptidase c13 family protein                           113   8e-26   
ref|XP_002402087.1|  legumain, putative                                 112   1e-25   
dbj|BAJ97485.1|  predicted protein                                      112   1e-25   
dbj|BAF95090.1|  2nd tick legumain                                      111   2e-25   
emb|CDW73723.1|  peptidase c13 family protein                           111   3e-25   
gb|EGT38953.1|  hypothetical protein CAEBREN_26195                      110   3e-25   
sp|P42665.1|HGLB_SCHJA  RecName: Full=Hemoglobinase; AltName: Ful...    110   4e-25   
gb|AIG55666.1|  secreted protein                                        110   4e-25   
ref|XP_004491696.1|  PREDICTED: vacuolar-processing enzyme-like         110   5e-25   
emb|CEF69527.1|  Legumain                                               110   5e-25   
gb|KHJ86528.1|  peptidase C13 family protein                            108   5e-25   
ref|XP_003113975.1|  hypothetical protein CRE_27126                     110   6e-25   
emb|CAX72822.1|  legumain                                               110   7e-25   
emb|CAX69882.1|  legumain                                               110   7e-25   
ref|XP_009834817.1|  hypothetical protein H257_10074                    110   8e-25   
emb|CDW79224.1|  peptidase c13 family protein                           110   8e-25   
ref|XP_006822143.1|  PREDICTED: LOW QUALITY PROTEIN: legumain-like      110   9e-25   
gb|AAR30508.1|  SJ32                                                    109   1e-24   
emb|CAX72844.1|  legumain                                               108   1e-24   
ref|XP_004491989.1|  PREDICTED: vacuolar-processing enzyme-like         107   1e-24   
emb|CAX72767.1|  legumain                                               108   2e-24   
ref|XP_002636781.1|  Hypothetical protein CBG23516                      109   2e-24   
gb|ETN69965.1|  peptidase C13 family protein                            108   2e-24   
ref|XP_002869166.1|  hypothetical protein ARALYDRAFT_912980             108   3e-24   
emb|CAX72774.1|  legumain                                               107   7e-24   
gb|EAY99324.1|  hypothetical protein OsI_21293                          105   7e-24   
ref|NP_506137.1|  Protein T28H10.3                                      107   8e-24   
ref|XP_008181646.1|  PREDICTED: legumain-like                           106   9e-24   
ref|XP_003138356.1|  peptidase C13 family protein                       106   1e-23   
gb|ADQ57305.1|  hemoglobinase-type cysteine proteinase                  106   1e-23   
ref|XP_005390389.1|  PREDICTED: legumain                                106   2e-23   
emb|CDJ89964.1|  Peptidase C13 domain containing protein                106   2e-23   
gb|AGM20566.1|  asparaginyl endopeptidase                               106   2e-23   
emb|CAX72707.1|  legumain                                               106   2e-23   
gb|EFO25715.2|  peptidase C13 family protein                            105   2e-23   
gb|EYC21205.1|  hypothetical protein Y032_0020g56                       105   2e-23   
ref|XP_005101870.1|  PREDICTED: legumain-like                           105   3e-23   
ref|XP_001624969.1|  predicted protein                                  105   3e-23   
gb|EYC21206.1|  hypothetical protein Y032_0020g56                       105   3e-23   
ref|XP_009040000.1|  hypothetical protein AURANDRAFT_54735              105   3e-23   
gb|ELT99476.1|  hypothetical protein CAPTEDRAFT_108468                  105   4e-23   
ref|XP_002604561.1|  hypothetical protein BRAFLDRAFT_280591             105   4e-23   
ref|XP_009176518.1|  hypothetical protein T265_11570                    104   5e-23   
gb|ERG87786.1|  legumain                                                105   6e-23   
ref|XP_009176863.1|  hypothetical protein T265_11822                    103   1e-22   
gb|KHN08261.1|  Vacuolar-processing enzyme                            99.0    1e-22   
gb|KFM82870.1|  Legumain                                                103   1e-22   
emb|CBK21815.2|  unnamed protein product                                103   2e-22   
gb|ACY95293.1|  legumain precursor                                      103   2e-22   
emb|CAX72662.1|  legumain                                               103   2e-22   
gb|AIZ77505.1|  legumain-like protease precursor                        103   2e-22   
gb|AFM37368.1|  legumain 1                                              103   2e-22   
emb|CDW77702.1|  vacuolar-processing enzyme-like                        102   3e-22   
ref|XP_006838620.1|  hypothetical protein AMTR_s00002p00231730          100   3e-22   
gb|ACF35524.1|  putative legumain-like protease precursor               102   4e-22   
gb|ABI13175.1|  putative asparaginyl endopeptidase                      102   4e-22   
ref|XP_009011832.1|  hypothetical protein HELRODRAFT_185311             102   4e-22   



>gb|KDP25622.1| hypothetical protein JCGZ_20778 [Jatropha curcas]
Length=495

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 151/206 (73%), Gaps = 8/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+Y+KMVIYVEACESGS+FEG++P D N+Y  TAS A ENS G YCPG DP PPPE+ T
Sbjct  207  AGSYEKMVIYVEACESGSIFEGIMPDDINVYVTTASNAQENSWGTYCPGMDPSPPPEFIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI  QY  VK+RT N N    GSHVMEYG+  L+ +KL
Sbjct  267  CLGDLYSVAWMEDSETHNLKRETIKQQYRTVKERTSNYNTYTAGSHVMEYGNSSLKTEKL  326

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP+N A +  P   V+QRDAELL++W+ YKR  DE+S  K ++L+++
Sbjct  327  YLYQGFDPANVNLPPVN-AHVNAPMEVVNQRDAELLFMWQMYKR-SDEQSGKKAQILQQI  384

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
             E ++ R+++D S++ IG  LFG +K
Sbjct  385  KETIKHRSHLDNSIELIGTLLFGPQK  410



>ref|XP_008238625.1| PREDICTED: LOW QUALITY PROTEIN: legumain [Prunus mume]
Length=491

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 147/206 (71%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MVIYVEACESGS+FEG++P D NIY  TAS A ENS G YCPG DP PPPEY T
Sbjct  203  SGSYKEMVIYVEACESGSIFEGIMPSDLNIYVTTASNAQENSFGTYCPGMDPSPPPEYIT  262

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+RHN KKETI  QY+NVKKRT N N    GSHVM+YGS ++  +KL
Sbjct  263  CLGDLYSVAWMEDSERHNLKKETIKQQYQNVKKRTSNSNNYDVGSHVMQYGSKNITVEKL  322

Query  361  SKYQGY----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+    V  P N   +  P   V+QRDAEL ++W+ YKR  + +SE K  +L+++ 
Sbjct  323  YLYQGFDPASVNFPPNNGQLEKPMEVVNQRDAELFFMWQMYKR-SEHRSEKKRHILEQIK  381

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D S++ IG +L+G  K 
Sbjct  382  ETMGHRTHLDASIEFIGTFLYGPGKG  407



>ref|XP_006355496.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Solanum 
tuberosum]
Length=494

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 152/209 (73%), Gaps = 15/209 (7%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK+MV+Y+EACESGS+FEGL+P + NIY  TAS A+E+S G YCPG DP PP EY T
Sbjct  208  AGTYKEMVLYIEACESGSVFEGLMPENLNIYVTTASNAEESSWGTYCPGMDPPPPSEYIT  267

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QYE VK+RT N N    GSHVMEYGS +++ +K+
Sbjct  268  CLGDLYSVAWMEDSESHNLKKETIKQQYEKVKERTSNSNNYNAGSHVMEYGSKEIKPEKV  327

Query  361  SKYQGYVLPPINVATIPMPGT--------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
              YQG+     + AT+ +P           V+QRDA+LL+LWE+YK+L D   E K K+ 
Sbjct  328  YLYQGF-----DPATVNLPANKIDFARLEVVNQRDADLLFLWERYKKLEDNSLE-KAKLR  381

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            KE++E +Q R ++DGS+DA+G +LFG  K
Sbjct  382  KEITETLQHRQHLDGSIDAVGVFLFGPIK  410



>ref|XP_007209951.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
 gb|EMJ11150.1| hypothetical protein PRUPE_ppa004795mg [Prunus persica]
Length=491

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 146/207 (71%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MVIYVEACESGS+FEG++P D NIY  TAS A ENS G YCPG DP PPPEY T
Sbjct  203  SGSYKEMVIYVEACESGSIFEGIMPSDLNIYVTTASNAQENSFGTYCPGMDPSPPPEYIT  262

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+RHN KKETI  QY+NVKKRT N N    GSHVM+YGS ++  +KL
Sbjct  263  CLGDLYSVAWMEDSERHNLKKETIKQQYQNVKKRTSNSNNYDVGSHVMQYGSKNITVEKL  322

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP N   +  P   V+QRDAEL ++W+ YKR  +  SE K  +L+++
Sbjct  323  YLYQGFDPASLNFPP-NNGQLEKPMEVVNQRDAELFFMWQMYKR-SEHGSEKKTHILEQI  380

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             E M  R ++D S++ IG +L+G  K 
Sbjct  381  KETMGHRTHLDASIEFIGTFLYGPGKG  407



>ref|XP_004245733.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Solanum lycopersicum]
Length=498

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 151/209 (72%), Gaps = 15/209 (7%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A TYK+MV+Y+EACESGS+FEGL+P + NIY MTAS A+E+S G YCPG DP PP EY T
Sbjct  211  ARTYKEMVLYIEACESGSVFEGLMPENLNIYVMTASNAEESSWGTYCPGMDPPPPSEYIT  270

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QYE VK+RT N N    GSHVMEYGS +++ +K+
Sbjct  271  CLGDLYSVAWMEDSESHNLKKETIKQQYEKVKERTSNSNNYNAGSHVMEYGSKEIKPEKV  330

Query  361  SKYQGYVLPPINVATIPMPGT--------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
              YQG+     + AT+ +P           V+QRDA+LL+LWE+YK+L D   E K K+ 
Sbjct  331  YLYQGF-----DPATVNLPANKIDFARLEVVNQRDADLLFLWERYKKLEDNSLE-KAKLR  384

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            KE++E M  R ++DGS+DA+G +LFG  K
Sbjct  385  KEITETMLHRQHLDGSIDAVGVFLFGPIK  413



>ref|XP_003608767.1| Vacuolar-processing enzyme [Medicago truncatula]
Length=301

 Score =   219 bits (558),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 149/206 (72%), Gaps = 8/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YKKMV+Y+EACESGSMFEG++P D N+Y  TAS A E+S G YCPG +P PPPEY T
Sbjct  13   SGGYKKMVVYIEACESGSMFEGVMPKDLNVYVTTASNAQESSWGTYCPGVEPAPPPEYIT  72

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ET+  QY++VK+RT N N    GSHVM+YG  ++  +KL
Sbjct  73   CLGDLYSVAWMEDSESHNLKRETVKQQYKSVKERTSNYNNYALGSHVMQYGDTNITDEKL  132

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N   +      V+QRDAE+L++WE YKRL D ++E K ++L+++
Sbjct  133  YLYQGFDPATVNLPPHN-DKLESKMEVVNQRDAEILFMWEMYKRL-DHQTEKKREILEKI  190

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E ++ R ++DGSV+ IG  LFG  K
Sbjct  191  AETVKHRNHLDGSVELIGVLLFGPTK  216



>ref|XP_008796848.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=491

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 149/205 (73%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+Y++MVIYVEACESGS+FEGLLP   NIY  TAS A+E+S G YCPG DP PPPEY T
Sbjct  202  SGSYREMVIYVEACESGSIFEGLLPEGLNIYVTTASNAEESSWGTYCPGMDPAPPPEYIT  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS  HN K+ETI  QYE VK+RT N N    GSHVMEYG    + DKL
Sbjct  262  CLGDLYSVAWMEDSATHNLKEETIEKQYEVVKERTSNYNTYSAGSHVMEYGDKSFKDDKL  321

Query  361  SKYQGYVLPPINVA--TIP--MPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              +QG+     N++   +P  MP   ++QRDA+LL+LW++Y++L D +SE K +VLKE++
Sbjct  322  YLFQGFDPSNANLSGNGLPPTMPTGAINQRDADLLFLWKRYEQL-DARSEKKTQVLKEIT  380

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R ++D S++ IG  +FG+E 
Sbjct  381  ETMMHRLHLDNSINLIGKLIFGSEN  405



>tpg|DAA36671.1| TPA: hypothetical protein ZEAMMB73_569687 [Zea mays]
Length=309

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 143/204 (70%), Gaps = 5/204 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P D NIY  TAS   ENS G YCPG +P PPPEY T
Sbjct  22   SNSYSKMVIYVEACESGSIFEGLMPEDLNIYVTTASNPVENSWGTYCPGMEPSPPPEYIT  81

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN KKETI  QYE VK RT N N    GSHVMEYG    + +KL
Sbjct  82   CLGDLYSVSWMEDSETHNLKKETIKDQYEVVKTRTSNSNKYKEGSHVMEYGDKTFKDEKL  141

Query  361  SKYQGYVLPPINVATI---PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            S YQG+     N+A +   P P   V+QRDA+LL++W++Y++L +  +E K + L E+ E
Sbjct  142  SFYQGFDPANANIANMLLWPGPKGAVNQRDADLLFMWKRYEQL-NGGTEEKLRALIEIKE  200

Query  532  KMQVRAYIDGSVDAIGDYLFGTEK  603
             +Q R ++D S+D +G  +FG EK
Sbjct  201  TVQHRKHLDSSIDFVGRLVFGFEK  224



>gb|KDO48392.1| hypothetical protein CISIN_1g016176mg [Citrus sinensis]
Length=309

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 144/206 (70%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A +YK MVIYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG DP PPPEY T
Sbjct  22   AKSYKGMVIYVEACESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYIT  81

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETIS QY+ VK+RT N N    GSHVMEYG+  ++ +KL
Sbjct  82   CLGDLYSVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKL  141

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP  +   P     V+QRDA+LL++W  YK    E SE K ++LK++
Sbjct  142  YLYQGFDPASTNFPPNKLQ--PDQMGVVNQRDADLLFMWHMYKNAA-EGSEKKSEMLKQI  198

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E M+ R ++D S+D IG  LFG +K
Sbjct  199  TETMRHRKHLDASIDMIGVILFGPDK  224



>ref|XP_002509577.1| Vacuolar-processing enzyme precursor [Ricinus communis]
 sp|P49042.1|VPE_RICCO RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Ricinus communis]
 dbj|BAA04225.1| precursor of vacuolar processing enzyme [Ricinus communis]
 gb|EEF50964.1| Vacuolar-processing enzyme precursor [Ricinus communis]
Length=497

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 148/206 (72%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG YKKMVIYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG +P PPPE+TT
Sbjct  209  AGGYKKMVIYVEACESGSIFEGIMPKDVDIYVTTASNAQESSWGTYCPGMEPSPPPEFTT  268

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKET+  QY +VK RT N N    GSHVM+YG+  ++ DKL
Sbjct  269  CLGDLYSVAWMEDSESHNLKKETVKQQYSSVKARTSNYNTYAAGSHVMQYGNQSIKADKL  328

Query  361  SKYQGY----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              +QG+    V  P N A +  P   V+QRDAEL ++W+ YKR  +  SE K ++L+++ 
Sbjct  329  YLFQGFDPASVNFPPNNAHLNAPMEVVNQRDAELHFMWQLYKR-SENGSEKKKEILQQIK  387

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + ++ R+++D S+  IGD LFG +KA
Sbjct  388  DAIKHRSHLDSSMQLIGDLLFGPKKA  413



>ref|XP_009771365.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Nicotiana 
sylvestris]
Length=493

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 150/206 (73%), Gaps = 15/206 (7%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK+MV+Y+EACESGS+FEG++P D NIY  TAS ADE+S G YCPG DP PPPEY T
Sbjct  206  AGTYKEMVLYIEACESGSVFEGMMPEDLNIYVTTASNADESSWGTYCPGMDPPPPPEYIT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QYE VK+RT N N    GSHVMEYGS +++ +K+
Sbjct  266  CLGDLYSVAWMEDSESHNLKKETIKQQYEKVKERTSNFNNYNAGSHVMEYGSKEIKPEKV  325

Query  361  SKYQGYVLPPINVATIPMPGT--------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
              YQG+     + AT  +P           V+QRDA+LL+LWE+YK+L D   E K K+ 
Sbjct  326  YLYQGF-----DPATANLPANKIDFAHLEVVNQRDADLLFLWERYKKLADNSLE-KAKLR  379

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFG  594
            KE+++ M  R ++DGSVDAIG +LFG
Sbjct  380  KEITDTMLHRQHLDGSVDAIGVFLFG  405



>gb|KDO48391.1| hypothetical protein CISIN_1g016176mg [Citrus sinensis]
Length=394

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 144/206 (70%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A +YK MVIYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG DP PPPEY T
Sbjct  107  AKSYKGMVIYVEACESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYIT  166

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETIS QY+ VK+RT N N    GSHVMEYG+  ++ +KL
Sbjct  167  CLGDLYSVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKL  226

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP  +    M    V+QRDA+LL++W  YK    E SE K ++LK++
Sbjct  227  YLYQGFDPASTNFPPNKLQPDQM--GVVNQRDADLLFMWHMYKNAA-EGSEKKSEMLKQI  283

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E M+ R ++D S+D IG  LFG +K
Sbjct  284  TETMRHRKHLDASIDMIGVILFGPDK  309



>ref|XP_010933721.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
 ref|XP_010933722.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=490

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 147/206 (71%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YK+MVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG DP PPPE+ T
Sbjct  202  SGGYKEMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMDPSPPPEFIT  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI  QYE VK+RT N N    GSHVMEYG    + DKL
Sbjct  262  CLGDLYSVAWMEDSETHNLKEETIQKQYEEVKERTSNYNTYNTGSHVMEYGDKSFKDDKL  321

Query  361  SKYQGYVLPPINV---ATIP-MPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              +QG+     N+   A  P MP   ++QRDA+LL+LW++Y++  DE S+ K + L+E++
Sbjct  322  YLFQGFDPSNANLSGNALAPTMPMEAINQRDADLLFLWKRYEQF-DEGSKKKTEALREIT  380

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E +  R ++D S++ IG  +FG+E  
Sbjct  381  ETLVHRLHLDNSINLIGKLIFGSENG  406



>ref|XP_009592399.1| PREDICTED: vacuolar-processing enzyme [Nicotiana tomentosiformis]
Length=494

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 151/209 (72%), Gaps = 15/209 (7%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK+MV+Y+EACESGS+FEG++P D NIY  TAS A+E+S G YCPG DP PPPEY T
Sbjct  207  AGTYKEMVLYIEACESGSVFEGMMPEDLNIYVTTASNAEESSWGTYCPGMDPPPPPEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QYE VK+RT N N    GSHVMEYGS +++ +K+
Sbjct  267  CLGDLYSVAWMEDSESHNLKKETIKQQYEKVKERTSNFNNYNAGSHVMEYGSKEIKPEKV  326

Query  361  SKYQGYVLPPINVATIPMPGT--------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
              YQG+     + AT  +P           V+QRDA+LL+LWE+YK+L D   E K K+ 
Sbjct  327  YLYQGF-----DPATANLPANKIAFAHVEVVNQRDADLLFLWERYKKLADNSLE-KAKLR  380

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            KE+++ M  R ++DGSVDAIG +LFG  K
Sbjct  381  KEITDTMLHRKHLDGSVDAIGVFLFGPTK  409



>ref|XP_010259032.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=495

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 145/204 (71%), Gaps = 5/204 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK+MVIYVEACESGS+FEG++P D NIY  TAS A+E+S G YCPG +P P PE+ T
Sbjct  210  AGTYKEMVIYVEACESGSIFEGMMPEDLNIYVTTASNAEESSFGTYCPGMEPSPSPEFLT  269

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKET+  QY NVK RT N N    GSHVMEYG+  ++ +KL
Sbjct  270  CLGDLYSVAWMEDSETHNLKKETLRQQYHNVKDRTSNYNTYFVGSHVMEYGNRSIKTEKL  329

Query  361  SKYQGY--VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
              YQG+      +N  T+      V+QRDA+LL+LW++YK+   E    K +  K ++E 
Sbjct  330  YLYQGFDPANENLNQNTLHPHMEVVNQRDADLLFLWQRYKK--SEDGSKKKEAFKRIAET  387

Query  535  MQVRAYIDGSVDAIGDYLFGTEKA  606
            +  R +IDGSV+ IG+ LFGTE++
Sbjct  388  VMHRTHIDGSVELIGNILFGTERS  411



>ref|NP_001152500.1| LOC100286140 [Zea mays]
 gb|ACG47915.1| vacuolar processing enzyme, beta-isozyme precursor [Zea mays]
 tpg|DAA36670.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=457

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P D NIY  TAS   ENS G YCPG +P PPPEY T
Sbjct  170  SNSYSKMVIYVEACESGSIFEGLMPEDLNIYVTTASNPVENSWGTYCPGMEPSPPPEYIT  229

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN KKETI  QYE VK RT N N    GSHVMEYG    + +KL
Sbjct  230  CLGDLYSVSWMEDSETHNLKKETIKDQYEVVKTRTSNSNKYKEGSHVMEYGDKTFKDEKL  289

Query  361  SKYQGYVLPPINVATI---PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            S YQG+     N+A +   P P   V+QRDA+LL++W++Y++L +  +E K + L E+ E
Sbjct  290  SFYQGFDPANANIANMLLWPGPKGAVNQRDADLLFMWKRYEQL-NGGTEEKLRALIEIKE  348

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +Q R ++D S+D +G  +FG EK 
Sbjct  349  TVQHRKHLDSSIDFVGRLVFGFEKG  373



>gb|KJB51882.1| hypothetical protein B456_008G236100 [Gossypium raimondii]
Length=491

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 146/206 (71%), Gaps = 8/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+Y++MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PPPE+ T
Sbjct  202  AGSYREMVIYVEACESGSIFEGIMPEDLNIYVTTASNAQESSWGTYCPGMEPSPPPEFIT  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT--WNNGTGGGSHVMEYGSMDLRKDK  357
            CLGDL+S++WMEDS+ HN K+ETI  QY+ V++RT  +N+ T GGSHVMEYGS  ++ +K
Sbjct  262  CLGDLYSVAWMEDSETHNLKRETIEQQYKTVRERTSNFNSYTSGGSHVMEYGSTSIKAEK  321

Query  358  LSKYQGYVLPPINVATIPMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
            L  YQG+    +N     +   T    ++QRDA++L+LW  YK    E    K ++LK++
Sbjct  322  LYLYQGFDPASVNFPPNELSHDTQMEAINQRDADILFLWHMYKN--SEDGSKKKEILKQI  379

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            SE M+ R ++DGS+D IG  L+G  K
Sbjct  380  SETMRHRIHLDGSIDLIGTVLYGPAK  405



>gb|AES90963.2| vacuolar processing enzyme [Medicago truncatula]
Length=494

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 149/207 (72%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YKKMV+Y+EACESGSMFEG++P D N+Y  TAS A E+S G YCPG +P PPPEY T
Sbjct  206  SGGYKKMVVYIEACESGSMFEGVMPKDLNVYVTTASNAQESSWGTYCPGVEPAPPPEYIT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ET+  QY++VK+RT N N    GSHVM+YG  ++  +KL
Sbjct  266  CLGDLYSVAWMEDSESHNLKRETVKQQYKSVKERTSNYNNYALGSHVMQYGDTNITDEKL  325

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N   +      V+QRDAE+L++WE YKRL D ++E K ++L+++
Sbjct  326  YLYQGFDPATVNLPPHN-DKLESKMEVVNQRDAEILFMWEMYKRL-DHQTEKKREILEKI  383

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            +E ++ R ++DGSV+ IG  LFG  K 
Sbjct  384  AETVKHRNHLDGSVELIGVLLFGPTKG  410



>ref|XP_003608766.1| Vacuolar-processing enzyme [Medicago truncatula]
Length=487

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 149/207 (72%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YKKMV+Y+EACESGSMFEG++P D N+Y  TAS A E+S G YCPG +P PPPEY T
Sbjct  199  SGGYKKMVVYIEACESGSMFEGVMPKDLNVYVTTASNAQESSWGTYCPGVEPAPPPEYIT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ET+  QY++VK+RT N N    GSHVM+YG  ++  +KL
Sbjct  259  CLGDLYSVAWMEDSESHNLKRETVKQQYKSVKERTSNYNNYALGSHVMQYGDTNITDEKL  318

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N   +      V+QRDAE+L++WE YKRL D ++E K ++L+++
Sbjct  319  YLYQGFDPATVNLPPHN-DKLESKMEVVNQRDAEILFMWEMYKRL-DHQTEKKREILEKI  376

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            +E ++ R ++DGSV+ IG  LFG  K 
Sbjct  377  AETVKHRNHLDGSVELIGVLLFGPTKG  403



>ref|XP_010093667.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB54447.1| Vacuolar-processing enzyme [Morus notabilis]
Length=501

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 142/207 (69%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+M+IYVEACESGS+FEG++P D NIY  TAS A ENS G YCPG +P PPPEY T
Sbjct  213  SGTYKEMIIYVEACESGSIFEGIMPRDMNIYVTTASNAQENSWGTYCPGMEPSPPPEYIT  272

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI  QYE VKKRT N N    GSHVMEYG+  ++ +KL
Sbjct  273  CLGDLYSVAWMEDSETHNLKRETIKQQYETVKKRTANANDFTAGSHVMEYGNKSIKGEKL  332

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP +   + M    V+QRDAEL ++W+ YKR   E    K ++L ++
Sbjct  333  YLYQGFDPATLNFPPNDPNKLDMRMEVVNQRDAELFFMWQMYKR--TESRNKKREILNQI  390

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             E  + R ++D S++ IG  L+G +K 
Sbjct  391  KEATRHRTHLDKSIELIGSLLYGPQKG  417



>ref|XP_010676183.1| PREDICTED: vacuolar-processing enzyme [Beta vulgaris subsp. vulgaris]
Length=483

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +YK+MVIY+EACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PPPE+ TCL
Sbjct  197  SYKEMVIYIEACESGSVFEGLMPEDLNIYVTTASNAEESSWGTYCPGMNPAPPPEFMTCL  256

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKLSK  366
            GDL+SI+WMEDS+ HN KKETI+ QY+ VK+RT N N    GSHVMEYG+  L+ +KL  
Sbjct  257  GDLYSIAWMEDSETHNLKKETINQQYKKVKERTSNYNTYTAGSHVMEYGNKSLKPEKLYL  316

Query  367  YQGYVLPPINVATIPMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            YQG+    +N+    +P  +    V+QRDA++L+LW+KY+R  D K E K K+L+E++E 
Sbjct  317  YQGFDPATVNLPPNRLPLHSKLGVVNQRDADILFLWKKYERSRD-KPEEKCKILQEITET  375

Query  535  MQVRAYIDGSVDAIGDYLFG  594
            M+ R ++D S++ IG  LFG
Sbjct  376  MKHRMHLDSSIELIGKLLFG  395



>gb|KHG28226.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=454

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 146/207 (71%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+Y++MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PPPE+ T
Sbjct  202  AGSYREMVIYVEACESGSIFEGIMPEDLNIYVTTASNAQESSWGTYCPGMEPSPPPEFIT  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT--WNNGTGGGSHVMEYGSMDLRKDK  357
            CLGDL+S++WMEDS+ HN K+ETI  QY+ V++RT  +N+ T GGSHVMEYGS  ++ +K
Sbjct  262  CLGDLYSVAWMEDSETHNLKRETIEQQYKTVRERTSNFNSYTSGGSHVMEYGSRSIKAEK  321

Query  358  LSKYQGYVLPPINVA----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
            L  YQG+    +N      +  +    V+QRDA++L+LW  YK    E    K ++LK++
Sbjct  322  LYLYQGFDPASVNFPPDEFSHDVQMEAVNQRDADILFLWHMYKN--SEDGSKKKEILKQI  379

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            SE M+ R ++DGS+D IG  L+G  K 
Sbjct  380  SETMRHRTHLDGSIDLIGTVLYGPAKG  406



>emb|CAB42651.2| putative preprolegumain [Nicotiana tabacum]
Length=494

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 149/204 (73%), Gaps = 5/204 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK+MV+Y+EACESGS+FEG++P D NIY  TAS A+E+S G YCPG DP PPPEY T
Sbjct  207  AGTYKEMVLYIEACESGSVFEGMMPEDLNIYVTTASNAEESSWGTYCPGMDPPPPPEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QYE VK+RT N N    GSHVMEYGS +++ +K+
Sbjct  267  CLGDLYSVAWMEDSESHNLKKETIKQQYEKVKERTSNFNNYNAGSHVMEYGSKEIKPEKV  326

Query  361  SKYQGYVLPPINVATIPMPGT---TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N++   +       V+QRDA+LL+LWE+YK L D   E K K+ KE+++
Sbjct  327  YLYQGFDPATANLSANKIAFAHVEVVNQRDADLLFLWERYKELADNSLE-KAKLRKEITD  385

Query  532  KMQVRAYIDGSVDAIGDYLFGTEK  603
             M  R ++DGSVDAIG +LFG  K
Sbjct  386  TMLHRKHLDGSVDAIGVFLFGPTK  409



>ref|XP_006391830.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
 gb|ESQ29116.1| hypothetical protein EUTSA_v10023430mg [Eutrema salsugineum]
Length=484

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 143/203 (70%), Gaps = 9/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTY++MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  198  AGTYREMVIYVEACESGSVFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  257

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY+ VK RT N N    GSHVMEYG+  ++ +KL
Sbjct  258  CLGDLYSVAWMEDSETHNLKKETIKQQYQTVKMRTSNYNSYSEGSHVMEYGNNTIKAEKL  317

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N   +  P   V+QRDA+LL+LW  Y+    E    KD++LKE+
Sbjct  318  YLYQGFDPATVNLPP-NELPVKSPVGVVNQRDADLLFLWHMYRT--SEDGSRKDEILKEI  374

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            +++M+ R ++D SV+ IG  LFG
Sbjct  375  TDQMRHRKHLDASVELIGMILFG  397



>ref|XP_010695188.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
Length=430

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +YK+M+IY+EACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PPPE+ TCL
Sbjct  144  SYKEMLIYIEACESGSVFEGLMPEDLNIYVTTASNAEESSWGTYCPGMNPAPPPEFMTCL  203

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKLSK  366
            GDL+SI+WME S+ HN KKETI+ QYE VK+RT N N    GSHVMEYG+  L+ +KL  
Sbjct  204  GDLYSIAWMEASETHNLKKETINQQYEKVKERTSNYNTYTAGSHVMEYGNKSLKPEKLYL  263

Query  367  YQGYVLPPINVATIPMPGT----TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            YQG+    +N+    +P       V+QRDA++L+LW KY+R  D K E K K+L+E++E 
Sbjct  264  YQGFDPATVNLPPNRLPLDFKLGVVNQRDADILFLWNKYERSRD-KPEEKHKILQEITET  322

Query  535  MQVRAYIDGSVDAIGDYLFG  594
            M+ R ++D S++ IG  LFG
Sbjct  323  MKHRIHLDSSIELIGKLLFG  342



>gb|KHN09785.1| Vacuolar-processing enzyme [Glycine soja]
Length=495

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 147/207 (71%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MVIYVEACESGS+FEG++P D NIY  TAS A ENS G YCPG DP PPPEY T
Sbjct  207  SGSYKEMVIYVEACESGSVFEGIMPKDLNIYVTTASNAQENSWGTYCPGMDPSPPPEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+E++  QY++VK+RT N N    GSHVM+YG  ++  +KL
Sbjct  267  CLGDLYSVAWMEDSEAHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITAEKL  326

Query  361  SKYQGYVLPPINVATIPMPGT------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              YQG+   P  V   P  G        V+QRDAELL++W+ Y+R  + +SE K  +LK+
Sbjct  327  YLYQGF--DPATVNFPPQNGRLETKMEVVNQRDAELLFMWQMYQR-SNHQSENKTDILKQ  383

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++E ++ R +IDGSV+ IG  L+G  K
Sbjct  384  IAETVKHRKHIDGSVELIGVLLYGPGK  410



>ref|XP_002448237.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
 gb|EES12565.1| hypothetical protein SORBIDRAFT_06g023820 [Sorghum bicolor]
Length=493

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 139/203 (68%), Gaps = 5/203 (2%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KMVIYVEACESGS+FEGL+P D NIY  TAS   ENS G YCPG +P PPPEY TCL
Sbjct  208  SYSKMVIYVEACESGSIFEGLMPEDLNIYVTTASNPVENSWGTYCPGMEPSPPPEYITCL  267

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKLSK  366
            GDL+S+SWMEDS  HN KKETI  QYE VK RT N N    GSHVMEYG    + +KL  
Sbjct  268  GDLYSVSWMEDSQTHNLKKETIKDQYEVVKTRTSNSNKYKEGSHVMEYGDKTFKDEKLFL  327

Query  367  YQGYVLPPINVATI---PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKM  537
            YQG+     N+A +   P P   V+QRDA+LL++W++Y++L  E  E K + L E+ E +
Sbjct  328  YQGFDPANANIANMLLWPGPKGAVNQRDADLLFMWKRYEQLNGESVE-KLRALIEIKETV  386

Query  538  QVRAYIDGSVDAIGDYLFGTEKA  606
            Q R ++D S+D IG  LFG EK 
Sbjct  387  QHRKHLDSSIDFIGRLLFGFEKG  409



>ref|XP_002886459.1| F23N19.7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62718.1| F23N19.7 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 142/202 (70%), Gaps = 6/202 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  246  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  305

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY+ VK RT N N   GGSHVMEYG+  ++ +KL
Sbjct  306  CLGDLYSVAWMEDSETHNLKKETIKQQYQTVKMRTSNYNTYSGGSHVMEYGNNSIKSEKL  365

Query  361  SKYQGYVLPPINVATIPMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+    +N+    +P  +    V+QRDA+LL+LW  Y R  ++ S  KD  LKE++
Sbjct  366  YFYQGFDPATVNLPLKKLPVNSQVGVVNQRDADLLFLWHMY-RASEDGSRKKDDTLKELT  424

Query  529  EKMQVRAYIDGSVDAIGDYLFG  594
            E  + R ++D SV+ IG  LFG
Sbjct  425  ETTRHRKHLDASVELIGTILFG  446



>gb|EMT33588.1| Vacuolar-processing enzyme beta-isozyme [Aegilops tauschii]
Length=432

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 140/204 (69%), Gaps = 5/204 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  145  SNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  204

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDS+ +N K+ETI  QYE VKKRT + N    GSHVMEYG M  + +KL
Sbjct  205  CLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDMTFKDEKL  264

Query  361  SKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+     +  P   ++QRDA+LL+LW +Y+ L   KS+ K  VL E+SE
Sbjct  265  YLYQGFNPANTNITNKLFLQAPKAAINQRDADLLFLWRRYELL-HGKSKEKANVLTEISE  323

Query  532  KMQVRAYIDGSVDAIGDYLFGTEK  603
             +  R ++D S+D IG  LFG E 
Sbjct  324  TVAHRKHLDNSIDFIGKLLFGFEN  347



>ref|XP_006477253.1| PREDICTED: vacuolar-processing enzyme-like [Citrus sinensis]
Length=529

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 146/206 (71%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A +YK+MVIYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG DP PPPEY T
Sbjct  242  AKSYKEMVIYVEACESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYIT  301

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI+ QY+ VK+RT N N    GSHVMEYG+  ++ +KL
Sbjct  302  CLGDLYSVAWMEDSETHNLKRETINQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKL  361

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP  +  +P     V+QRDA+LL++W  YK    E SE K ++LK++
Sbjct  362  YLYQGFDPASANFPPNKL--LPDQMGVVNQRDADLLFMWHMYKNAA-EGSEKKSEMLKQI  418

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E M+ R ++D S+D IG  LFG +K
Sbjct  419  TETMRHRKHLDASIDMIGVILFGPDK  444



>ref|XP_008668185.1| PREDICTED: LOC100286140 isoform X1 [Zea mays]
 tpg|DAA36669.1| TPA: vacuolar processing enzyme, beta-isozyme [Zea mays]
Length=493

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 143/204 (70%), Gaps = 5/204 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P D NIY  TAS   ENS G YCPG +P PPPEY T
Sbjct  206  SNSYSKMVIYVEACESGSIFEGLMPEDLNIYVTTASNPVENSWGTYCPGMEPSPPPEYIT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN KKETI  QYE VK RT N N    GSHVMEYG    + +KL
Sbjct  266  CLGDLYSVSWMEDSETHNLKKETIKDQYEVVKTRTSNSNKYKEGSHVMEYGDKTFKDEKL  325

Query  361  SKYQGYVLPPINVATI---PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            S YQG+     N+A +   P P   V+QRDA+LL++W++Y++L +  +E K + L E+ E
Sbjct  326  SFYQGFDPANANIANMLLWPGPKGAVNQRDADLLFMWKRYEQL-NGGTEEKLRALIEIKE  384

Query  532  KMQVRAYIDGSVDAIGDYLFGTEK  603
             +Q R ++D S+D +G  +FG EK
Sbjct  385  TVQHRKHLDSSIDFVGRLVFGFEK  408



>dbj|BAD25788.1| putative asparaginyl endopeptidase REP-2 [Oryza sativa Japonica 
Group]
 dbj|BAG91757.1| unnamed protein product [Oryza sativa Japonica Group]
Length=394

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 139/203 (68%), Gaps = 9/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  107  SNTYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  166

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+E+I  QYE VKKRT + N  G GSHVMEYG    + DKL
Sbjct  167  CLGDLYSVSWMEDSETHNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYGDRTFKDDKL  226

Query  361  SKYQGYVLPPINVATIPM-----PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+   P N           P   V+QRDA+LL+LW +Y+ L D KSE K K L+E+
Sbjct  227  YLYQGF--DPANAEVKNKLSWEGPKAAVNQRDADLLFLWRRYELLHD-KSEEKLKALREI  283

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            S+ +  R  +D SVD +G  LFG
Sbjct  284  SDTVMHRKLLDSSVDLVGKLLFG  306



>ref|XP_007039931.1| Beta vacuolar processing enzyme [Theobroma cacao]
 gb|EOY24432.1| Beta vacuolar processing enzyme [Theobroma cacao]
Length=543

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 147/207 (71%), Gaps = 13/207 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+YK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PPPEYTT
Sbjct  258  AGSYKEMVIYVEACESGSVFEGIMPKDLNIYVTTASNAQESSWGTYCPGMEPSPPPEYTT  317

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT--WNNGTGGGSHVMEYGSMDLRKDK  357
            CLGDL+S++WMEDS+ HN K+ET+  QYE V++RT  +N+ T GGSHVMEYG+  ++ +K
Sbjct  318  CLGDLYSVAWMEDSETHNLKRETVKQQYETVRERTSNFNSYTLGGSHVMEYGNASIKAEK  377

Query  358  LSKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            L  YQG+       PP  +  +      V+QRDA++L+LW  YK    E    K ++L++
Sbjct  378  LCSYQGFDPSSENFPPNELTHM----EAVNQRDADILFLWHMYKN--SEDGSKKTEILRQ  431

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++E ++ R ++DGS+D IG  L+G  K
Sbjct  432  ITETIRHRIHLDGSIDLIGTLLYGPAK  458



>ref|XP_003569976.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Brachypodium 
distachyon]
Length=490

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 141/203 (69%), Gaps = 5/203 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  203  SNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  262

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+ETI  QYE VK+RT + N    GSHVMEYG    + +KL
Sbjct  263  CLGDLYSVSWMEDSENHNLKEETIKKQYEVVKRRTSDLNSYSAGSHVMEYGDKTFKDEKL  322

Query  361  SKYQGYVLPPINVATIPM---PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+        P   ++QRDA+LL+LW +Y+ L  EKS+ K KVL+E+SE
Sbjct  323  YLYQGFNPANANITNKLFWQAPRAAINQRDADLLFLWRRYEML-HEKSKEKVKVLREISE  381

Query  532  KMQVRAYIDGSVDAIGDYLFGTE  600
             +  R ++D SVD IG  LFG E
Sbjct  382  TVMHRKHLDNSVDLIGQLLFGFE  404



>ref|XP_006647602.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=482

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 142/203 (70%), Gaps = 9/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D N+Y  TAS A+E+S G YCPG +P PP EY T
Sbjct  195  SNTYAKMVIYVEACESGSIFEGLMPEDLNVYVTTASNAEESSWGTYCPGMEPSPPAEYIT  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+E+I  QYE VKKRT + N  G GSHVMEYG    + +KL
Sbjct  255  CLGDLYSVSWMEDSETHNLKEESIKEQYEVVKKRTSDMNSYGAGSHVMEYGDKTFKGEKL  314

Query  361  SKYQGYVLPPINVAT-----IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+   P N        +  P   V+QRDA+LL+LW +Y+ L  EKSE K KVL+E+
Sbjct  315  YLYQGF--DPANAEVKNKLLLDDPKAAVNQRDADLLFLWRRYELL-HEKSEEKLKVLREI  371

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            SE +  R ++D SVD +G  LFG
Sbjct  372  SEAVTHRKHLDSSVDFVGKLLFG  394



>gb|EMS56335.1| Vacuolar-processing enzyme beta-isozyme [Triticum urartu]
Length=479

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 141/203 (69%), Gaps = 5/203 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  192  SNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  251

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDS+ +N K+ETI  QYE VKKRT + N    GSHVMEYG    + +KL
Sbjct  252  CLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDKTFKDEKL  311

Query  361  SKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+     +  P   ++QRDA+LL+LW +Y+ L  EKS+ K  VL+E+SE
Sbjct  312  YLYQGFNPANTNITNKLFLQAPKAAINQRDADLLFLWRRYELL-HEKSKEKTNVLREISE  370

Query  532  KMQVRAYIDGSVDAIGDYLFGTE  600
             +  R ++D S+D IG  LFG E
Sbjct  371  TVTHRKHLDSSIDFIGKLLFGYE  393



>ref|XP_002452849.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
 gb|EES05825.1| hypothetical protein SORBIDRAFT_04g033520 [Sorghum bicolor]
Length=495

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIY+EACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  208  SNSYAKMVIYIEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  267

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+ETI  QYE VK+RT + N  G GSHVMEYG    + +KL
Sbjct  268  CLGDLYSVSWMEDSETHNLKEETIKEQYEVVKERTSDSNSYGAGSHVMEYGDKTFKGEKL  327

Query  361  SKYQGYVLPPINVAT-IPMPG--TTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     NV   +  PG    V+QRDA++L+LW++Y+ L  EKSE K +VL+E++ 
Sbjct  328  YLYQGFDPANANVTNKLLRPGLEAVVNQRDADILFLWKRYELL-HEKSEEKQEVLREITG  386

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             ++ R ++D S+D IG  LFG EK 
Sbjct  387  TVRHRKHLDSSIDFIGKLLFGIEKG  411



>ref|XP_006440379.1| hypothetical protein CICLE_v10019686mg [Citrus clementina]
 gb|ESR53619.1| hypothetical protein CICLE_v10019686mg [Citrus clementina]
Length=529

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 144/206 (70%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A +YK MVIYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG DP PPPEY T
Sbjct  242  AKSYKGMVIYVEACESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYIT  301

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETIS QY+ VK+RT N N    GSHVMEYG+  ++ +KL
Sbjct  302  CLGDLYSVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKL  361

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP  +   P     V+QRDA+LL++W  YK    E SE K ++LK++
Sbjct  362  YLYQGFDPASTNFPPNKLQ--PDQMGVVNQRDADLLFMWHMYKNAA-EGSEKKSEMLKQI  418

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E M+ R ++D S+D IG  LFG +K
Sbjct  419  TETMRHRKHLDASIDMIGVILFGPDK  444



>gb|AET08888.1| vacuolar processing enzyme 1 [Triticum monococcum]
 emb|CCC14975.1| VPE2A protein [Triticum urartu]
Length=491

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (70%), Gaps = 5/203 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  204  SNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  263

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDS+ +N K+ETI  QYE VKKRT + N    GSHVMEYG    + +KL
Sbjct  264  CLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDKTFKDEKL  323

Query  361  SKYQGYVLPPINVATIPM---PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+  + +   P   ++QRDA+LL+LW +Y+ L  EKS+ K  VL+E+SE
Sbjct  324  YLYQGFNPANTNITNMLLLQAPKAAINQRDADLLFLWRRYELL-HEKSKEKGNVLREISE  382

Query  532  KMQVRAYIDGSVDAIGDYLFGTE  600
             +  R ++D S+D IG  LFG E
Sbjct  383  TVTHRKHLDSSIDFIGKLLFGFE  405



>ref|XP_002304429.2| hypothetical protein POPTR_0003s11280g [Populus trichocarpa]
 gb|EEE79408.2| hypothetical protein POPTR_0003s11280g [Populus trichocarpa]
Length=495

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 147/211 (70%), Gaps = 16/211 (8%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MV+Y+EACESGS+FEG++P D NIY  TAS A+ENS G YCPG +P PPPEY T
Sbjct  207  SGSYKEMVMYIEACESGSIFEGIMPKDINIYVTTASNAEENSWGTYCPGMEPSPPPEYFT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS +HN ++ETI  QY +VK+RT N N    GSHVM+YG+  ++ +KL
Sbjct  267  CLGDLYSVSWMEDSGKHNLRRETIEQQYHSVKERTSNYNTFTSGSHVMQYGNKSIKGEKL  326

Query  361  SKYQGYVLPPINVATIPMPGTTVH---------QRDAELLYLWEKYKRLGDEKSEMKDKV  513
              YQG+     N A++  P   VH         QRDAEL++LW+ YKR  ++ SE K ++
Sbjct  327  YLYQGF-----NPASVNFPPNNVHIGGRMDVVNQRDAELVFLWQMYKR-SEDGSEKKTQI  380

Query  514  LKEMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            L ++ E M+ R  +D S++ IG  LFG +K 
Sbjct  381  LNQIKETMRHRTQLDSSMELIGTLLFGRKKG  411



>ref|NP_001047562.1| Os02g0644000 [Oryza sativa Japonica Group]
 dbj|BAF09476.1| Os02g0644000, partial [Oryza sativa Japonica Group]
Length=446

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 139/203 (68%), Gaps = 9/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  159  SNTYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  218

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+E+I  QYE VKKRT + N  G GSHVMEYG    + DKL
Sbjct  219  CLGDLYSVSWMEDSETHNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYGDRTFKDDKL  278

Query  361  SKYQGYVLPPINVATIPM-----PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+   P N           P   V+QRDA+LL+LW +Y+ L D KSE K K L+E+
Sbjct  279  YLYQGF--DPANAEVKNKLSWEGPKAAVNQRDADLLFLWRRYELLHD-KSEEKLKALREI  335

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            S+ +  R  +D SVD +G  LFG
Sbjct  336  SDTVMHRKLLDSSVDLVGKLLFG  358



>ref|NP_001236678.1| vacuolar-processing enzyme precursor [Glycine max]
 sp|P49045.1|VPE_SOYBN RecName: Full=Vacuolar-processing enzyme; Short=VPE; Flags: Precursor 
[Glycine max]
 dbj|BAA06030.1| cysteine proteinase [Glycine max]
Length=495

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MVIYVEACESGS+FEG++P D NIY  TAS A ENS G YCPG DP PPPEY T
Sbjct  207  SGSYKEMVIYVEACESGSVFEGIMPKDLNIYVTTASNAQENSWGTYCPGMDPSPPPEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+E++  QY++VK+RT N N    GSHVM+YG  ++  +KL
Sbjct  267  CLGDLYSVAWMEDSEAHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITAEKL  326

Query  361  SKYQGYVLPPINVATIPMPGT------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              YQG+   P  V   P  G        V+QRDAEL  LW+ Y+R  + +SE K  +LK+
Sbjct  327  YLYQGF--DPATVNFPPQNGRLETKMEVVNQRDAELFLLWQMYQR-SNHQSENKTDILKQ  383

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++E ++ R +IDGSV+ IG  L+G  K
Sbjct  384  IAETVKHRKHIDGSVELIGVLLYGPGK  410



>ref|NP_176458.1| vacuolar-processing enzyme beta [Arabidopsis thaliana]
 sp|Q39044.3|VPEB_ARATH RecName: Full=Vacuolar-processing enzyme beta-isozyme; AltName: 
Full=Asparaginyl endopeptidase beta-VPE; AltName: Full=Beta-VPE; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56243.1|AF367254_1 At1g62710/F23N19_8 [Arabidopsis thaliana]
 gb|AAL15381.1| At1g62710/F23N19_8 [Arabidopsis thaliana]
 gb|AEE33996.1| vacuolar-processing enzyme beta [Arabidopsis thaliana]
Length=486

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 140/202 (69%), Gaps = 6/202 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  198  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  257

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY  VK RT N N   GGSHVMEYG+  ++ +KL
Sbjct  258  CLGDLYSVAWMEDSETHNLKKETIKQQYHTVKMRTSNYNTYSGGSHVMEYGNNSIKSEKL  317

Query  361  SKYQGYVLPPINVATIPMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+    +N+    +P  +    V+QRDA+LL+LW  Y R  ++ S  KD  LKE++
Sbjct  318  YLYQGFDPATVNLPLNELPVKSKIGVVNQRDADLLFLWHMY-RTSEDGSRKKDDTLKELT  376

Query  529  EKMQVRAYIDGSVDAIGDYLFG  594
            E  + R ++D SV+ I   LFG
Sbjct  377  ETTRHRKHLDASVELIATILFG  398



>ref|XP_010418271.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  199  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY+ VK RT N N    GSHVMEYG+  ++ +KL
Sbjct  259  CLGDLYSVAWMEDSENHNLKKETIKQQYQTVKMRTSNYNTYSAGSHVMEYGNDSIKSEKL  318

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP  +      G  V+QRDA++L+LW  Y R  +E S  KD  LKE+
Sbjct  319  YLYQGFDPATVNLPPNELLVKSQVG-VVNQRDADILFLWHMY-RTSEEGSRKKDDTLKEL  376

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            +E  + R ++D SV+ IG  LFG
Sbjct  377  TETTRHRKHLDASVELIGTVLFG  399



>gb|AET08892.1| vacuolar processing enzyme 2 [Aegilops speltoides]
 emb|CCC14970.1| VPE2B protein [Aegilops speltoides]
Length=491

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 141/203 (69%), Gaps = 5/203 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  204  SNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  263

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDS+ +N K+ETI  QYE VKKRT + N    GSHVMEYG    + +KL
Sbjct  264  CLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDKTFKDEKL  323

Query  361  SKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+     +  P   ++QRDA+LL+LW +Y+ L  EKS+ K  VL+E+SE
Sbjct  324  YLYQGFNPANTNITNKLFLQAPKAAINQRDADLLFLWRRYELL-HEKSKEKANVLREISE  382

Query  532  KMQVRAYIDGSVDAIGDYLFGTE  600
             +  R ++D S+D IG  LFG E
Sbjct  383  TVAHRKHLDSSIDFIGKLLFGFE  405



>ref|XP_010430341.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Camelina 
sativa]
Length=487

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  199  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY+ VK RT N N    GSHVMEYG+  L+ +KL
Sbjct  259  CLGDLYSVAWMEDSENHNLKKETIKQQYQKVKMRTSNYNTYSAGSHVMEYGNDSLKSEKL  318

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP  +      G  V+QRDA+LL+LW  Y R  ++ S  KD  LKE+
Sbjct  319  YLYQGFDPATVNLPPNELLVKSQVG-VVNQRDADLLFLWHMY-RTSEDGSRKKDDTLKEL  376

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            +E  + R ++D SV+ IG  LFG
Sbjct  377  TETTRHRKHLDSSVELIGTVLFG  399



>ref|XP_004515742.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=494

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 146/208 (70%), Gaps = 16/208 (8%)
 Frame = +1

Query  13   YKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCLG  192
            YKKMVIYVEACESGS+FEG++P++ NIY  TAS A ENS G YCPG DP PPPE+ TCLG
Sbjct  209  YKKMVIYVEACESGSIFEGIMPNNLNIYVTTASNAQENSWGTYCPGLDPAPPPEFITCLG  268

Query  193  DLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKLSKY  369
            DL+S++WMEDS+ HN K+ET+  QY++VK+RT N N    GSHVM+YG  ++  +KL  Y
Sbjct  269  DLYSVAWMEDSETHNLKRETVKEQYKSVKERTSNSNNYALGSHVMQYGDTNITDEKLYLY  328

Query  370  QGYVLPPINVATIPMPG---------TTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             G+     N AT+  P            V+QRDAEL ++W+ YKRL D ++E K  +L++
Sbjct  329  HGF-----NPATVNFPPHNGRLETKMEVVNQRDAELFFMWQLYKRL-DHEAEKKRDILEK  382

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            ++E ++ R ++DGSV+ +G  LFG EK 
Sbjct  383  IAETVKHRNHLDGSVELVGVLLFGPEKG  410



>ref|XP_010473493.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Camelina 
sativa]
Length=487

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  199  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY+ VK RT N N    GSHVMEYG+  L+ +KL
Sbjct  259  CLGDLYSVAWMEDSENHNLKKETIKQQYQTVKMRTSNYNTYSAGSHVMEYGNDSLKSEKL  318

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP  +      G  V+QRDA++L+LW  Y R  ++ S  KD  LKE+
Sbjct  319  YLYQGFDPATVNLPPNELLVKSQVG-VVNQRDADILFLWHMY-RTSEDGSRKKDDTLKEL  376

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            +E  + R ++D SV+ IG  LFG
Sbjct  377  TETTRHRKHLDASVELIGTVLFG  399



>ref|XP_006579475.1| PREDICTED: seed maturation protein PM40 isoform X1 [Glycine max]
 gb|KHN04332.1| Vacuolar-processing enzyme [Glycine soja]
Length=495

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 143/206 (69%), Gaps = 8/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YKKMVIYVEACESGSMFEG++P D  IY  TAS A ENS G YCPG DP PPPEY T
Sbjct  207  SGGYKKMVIYVEACESGSMFEGIMPKDLQIYVTTASNAQENSWGTYCPGMDPSPPPEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+E++  QY++VK+RT N N    GSHVM+YG  ++  +KL
Sbjct  267  CLGDLYSVAWMEDSETHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITAEKL  326

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP N   +      V+QRDAEL ++W+ Y+R  + + E K  +LK++
Sbjct  327  YLYQGFDPAAVNFPPQN-GRLETKMEVVNQRDAELFFMWQMYQR-SNHQPEKKTDILKQI  384

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E ++ R +IDGSV+ IG  L+G  K
Sbjct  385  AETVKHRKHIDGSVELIGVLLYGPGK  410



>gb|AAF19550.1|AC007190_18 F23N19.7 [Arabidopsis thaliana]
Length=536

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 140/202 (69%), Gaps = 6/202 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  248  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  307

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY  VK RT N N   GGSHVMEYG+  ++ +KL
Sbjct  308  CLGDLYSVAWMEDSETHNLKKETIKQQYHTVKMRTSNYNTYSGGSHVMEYGNNSIKSEKL  367

Query  361  SKYQGYVLPPINVATIPMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+    +N+    +P  +    V+QRDA+LL+LW  Y R  ++ S  KD  LKE++
Sbjct  368  YLYQGFDPATVNLPLNELPVKSKIGVVNQRDADLLFLWHMY-RTSEDGSRKKDDTLKELT  426

Query  529  EKMQVRAYIDGSVDAIGDYLFG  594
            E  + R ++D SV+ I   LFG
Sbjct  427  ETTRHRKHLDASVELIATILFG  448



>dbj|BAC41386.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAC41387.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 dbj|BAD25787.1| asparaginyl endopeptidase REP-2 [Oryza sativa Japonica Group]
 gb|EAY86869.1| hypothetical protein OsI_08253 [Oryza sativa Indica Group]
 gb|EAZ23976.1| hypothetical protein OsJ_07703 [Oryza sativa Japonica Group]
Length=496

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 139/203 (68%), Gaps = 9/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  209  SNTYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  268

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+E+I  QYE VKKRT + N  G GSHVMEYG    + DKL
Sbjct  269  CLGDLYSVSWMEDSETHNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYGDRTFKDDKL  328

Query  361  SKYQGYVLPPINVATIPM-----PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+   P N           P   V+QRDA+LL+LW +Y+ L D KSE K K L+E+
Sbjct  329  YLYQGF--DPANAEVKNKLSWEGPKAAVNQRDADLLFLWRRYELLHD-KSEEKLKALREI  385

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            S+ +  R  +D SVD +G  LFG
Sbjct  386  SDTVMHRKLLDSSVDLVGKLLFG  408



>emb|CDY39808.1| BnaA09g10600D [Brassica napus]
Length=484

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 140/202 (69%), Gaps = 7/202 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A TYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  198  AETYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  257

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKET+  QY+ VK RT N N    GSHVMEYG+  ++ +KL
Sbjct  258  CLGDLYSVAWMEDSETHNLKKETVKQQYQTVKMRTSNYNTYSEGSHVMEYGNSSIKSEKL  317

Query  361  SKYQGY----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+    V  P N   +  P   V+QRDA+L++LW+ Y+R   E    KD+++KE++
Sbjct  318  YLYQGFDPATVNYPANELPVKSPVGVVNQRDADLIFLWQMYRR--SEDGPRKDEIMKELT  375

Query  529  EKMQVRAYIDGSVDAIGDYLFG  594
            E  + R ++D SV+ I   LFG
Sbjct  376  ETTRHRKHLDTSVELISTVLFG  397



>gb|AET08895.1| vacuolar processing enzyme 2 [Aegilops tauschii]
 emb|CCC14981.1| VPE2D protein [Aegilops tauschii]
Length=489

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 139/205 (68%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  202  SNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDS+ +N K+ETI  QYE VKKRT + N    GSHVMEYG M  + +KL
Sbjct  262  CLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDMTFKDEKL  321

Query  361  SKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+     +  P   ++QRDA+LL+LW +Y+ L   KS+ K  VL E+ E
Sbjct  322  YLYQGFNPANTNITNKLFLQAPKAAINQRDADLLFLWRRYELL-HGKSKEKANVLTEIGE  380

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +  R ++D S+D IG  LFG E  
Sbjct  381  TVAHRKHLDNSIDFIGKLLFGFENG  405



>ref|XP_009112700.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Brassica 
rapa]
Length=485

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 140/202 (69%), Gaps = 7/202 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A TYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  199  AETYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKET+  QY+ VK RT N N    GSHVMEYG+  ++ +KL
Sbjct  259  CLGDLYSVAWMEDSETHNLKKETVKQQYQTVKMRTSNYNTYSEGSHVMEYGNSSIKSEKL  318

Query  361  SKYQGY----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+    V  P N   +  P   V+QRDA+L++LW+ Y+R   E    KD+++KE++
Sbjct  319  YLYQGFDPATVNYPANELPVKSPVGVVNQRDADLIFLWQMYRR--SEDGPRKDEIMKELT  376

Query  529  EKMQVRAYIDGSVDAIGDYLFG  594
            E  + R ++D SV+ I   LFG
Sbjct  377  ETTRHRKHLDTSVELISTVLFG  398



>ref|XP_006302155.1| hypothetical protein CARUB_v10020164mg, partial [Capsella rubella]
 gb|EOA35053.1| hypothetical protein CARUB_v10020164mg, partial [Capsella rubella]
Length=510

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 140/203 (69%), Gaps = 8/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  222  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  281

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY+ VK RT N N    GSHVMEYG+  ++ +KL
Sbjct  282  CLGDLYSVAWMEDSENHNLKKETIKQQYQTVKMRTSNYNTYSAGSHVMEYGNDSIKAEKL  341

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP  +      G  V+QRDA+LL+LW  Y+R  ++ S  KD  LKE+
Sbjct  342  YLYQGFDPATVSLPPNELPVKSQVG-VVNQRDADLLFLWHMYRR-SEDGSRKKDDTLKEL  399

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            +E  + R ++D SV+ I   LFG
Sbjct  400  TETTRHRKHLDASVELIDTILFG  422



>ref|XP_011018251.1| PREDICTED: vacuolar-processing enzyme [Populus euphratica]
Length=494

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MV+Y+EACESGS+FEG++P   NIY  TAS A+E+S G YCPG DP PP EY T
Sbjct  206  SGSYKEMVMYIEACESGSIFEGIIPKAINIYVTTASNAEESSWGTYCPGMDPSPPSEYVT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKETI  QY +VK+RT N N    GSHVM+YG+  LR +KL
Sbjct  266  CLGDLYSVAWMEDSETHNLKKETIKQQYHSVKERTSNYNTFTSGSHVMQYGNESLRGEKL  325

Query  361  SKYQGY----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+    V  P N   I      V+QRDAEL++LW+ YKR  +  SE K ++L ++ 
Sbjct  326  FLYQGFDPASVNFPPNNGHIGAHMNVVNQRDAELVFLWQMYKR-AEGGSEKKTQILNQIK  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M+ R ++D S++ IG  LFG +K 
Sbjct  385  ETMRHRTHLDSSMELIGTLLFGPKKG  410



>ref|XP_008437131.1| PREDICTED: legumain [Cucumis melo]
Length=495

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 142/207 (69%), Gaps = 7/207 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A  YK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG  P PPPEY T
Sbjct  205  AKGYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSFGTYCPGMQPAPPPEYMT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI  QY+ VK+RT N N    GSHVMEYG+  ++ ++L
Sbjct  265  CLGDLYSVAWMEDSETHNLKRETIDQQYQTVKERTSNPNNLNTGSHVMEYGNSSIKAERL  324

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N          ++QRDA++ +LW+ Y++  D  +E K ++L+E+
Sbjct  325  YLYQGFDPASVNLPPYNGRLEMKSMEAINQRDADIFFLWQMYRKFEDGTNE-KAQILEEI  383

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             E +  R+++DGS+  IG  LFG EK 
Sbjct  384  RETVTHRSHLDGSIRMIGFLLFGPEKG  410



>gb|EPS73966.1| asparaginyl endopeptidase [Genlisea aurea]
Length=471

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 143/204 (70%), Gaps = 9/204 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTY++M+IYVE+CESGS+FEG++P D N+Y  TAS A+E+S G YCPG DP PPPEY T
Sbjct  193  SGTYEEMMIYVESCESGSVFEGIMPTDLNVYVTTASNAEESSWGTYCPGMDPAPPPEYMT  252

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKET+  QYE VK+RT N N    GSHVMEYG+  ++ +KL
Sbjct  253  CLGDLYSVAWMEDSETHNLKKETVKEQYERVKERTSNFNSYNAGSHVMEYGNKSIKAEKL  312

Query  361  SKYQGY------VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              YQG+      +L    +   P+    V+QRDA+LL++WE+YK+L D   E  + + K 
Sbjct  313  CLYQGFDPKAETLLGSNGIRRRPL--QVVNQRDADLLFMWERYKKLKDNSEEKSEHLKKS  370

Query  523  MSEKMQVRAYIDGSVDAIGDYLFG  594
            + + +  R ++D SV+ IG  LFG
Sbjct  371  IIDAIAYRKHLDVSVETIGFILFG  394



>ref|XP_004976374.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=492

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 136/205 (66%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P D NIY  TAS   ENS G YCPG DP PPPEY T
Sbjct  205  SNSYSKMVIYVEACESGSIFEGLMPQDLNIYVTTASNPVENSWGTYCPGMDPSPPPEYIT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS  HN  KETI  QYE VK RT N      GSHVMEYG      +KL
Sbjct  265  CLGDLYSVSWMEDSQTHNLMKETIKDQYEVVKTRTSNLKKYKEGSHVMEYGDKTFTNEKL  324

Query  361  SKYQGYVLPPINVATI---PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N A     P P   V+QRDA+LL++W++Y++L D  SE K + L+E+ E
Sbjct  325  FLYQGFDPANANAANTLLWPGPKGAVNQRDADLLFMWKRYEQL-DGGSEEKLRALREIKE  383

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +Q R ++D S+D IG  +FG E  
Sbjct  384  TVQHRKHLDSSIDFIGRLVFGFENG  408



>gb|AAL40390.1| C13 cysteine proteinase precursor [Oryza sativa Indica Group]
Length=465

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 137/203 (67%), Gaps = 9/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  178  SNTYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  237

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+E+I  QYE VKKRT + N  G GSHVMEYG    + DKL
Sbjct  238  CLGDLYSVSWMEDSETHNLKEESIKKQYEVVKKRTSDMNSYGAGSHVMEYGDRTFKDDKL  297

Query  361  SKYQGYVLPPINVATIPM-----PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+   P N           P    +QRDA+LL+LW +Y+ L D KSE K K L+E+
Sbjct  298  YLYQGF--DPANAEVKNKLSWEGPKAAANQRDADLLFLWRRYELLHD-KSEEKLKALREI  354

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            S+ +  R  +D SVD +G  L G
Sbjct  355  SDTVMHRKLLDSSVDLVGKLLLG  377



>ref|XP_004147613.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 ref|XP_004162670.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 gb|KGN50214.1| hypothetical protein Csa_5G160170 [Cucumis sativus]
Length=490

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 141/207 (68%), Gaps = 7/207 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A  YK+MVIYVEACESGS+FEG+LP D NIY  TAS A E+S G YCPG +P PPPEY T
Sbjct  201  AKGYKEMVIYVEACESGSIFEGILPKDLNIYVTTASNAQESSFGTYCPGMEPAPPPEYMT  260

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI  QY  VK+RT N N    GSHVMEYG+  ++ ++L
Sbjct  261  CLGDLYSVAWMEDSETHNLKRETIDQQYRTVKERTSNPNNLNTGSHVMEYGNSSIKAERL  320

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N          ++QRDA++ +LW+ Y++  D  +E + +VL+E+
Sbjct  321  YLYQGFDPASVNLPPYNGRYEMKSMDAINQRDADIFFLWQMYRKFEDGTNE-RAQVLEEI  379

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             E +  R ++DGS+  IG  LFG EK 
Sbjct  380  RETVTHRTHLDGSIRMIGFLLFGPEKG  406



>ref|XP_009382344.1| PREDICTED: legumain-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 146/202 (72%), Gaps = 8/202 (4%)
 Frame = +1

Query  13   YKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCLG  192
            YK+MVIYVEACESGS+FEGL+P + +IY  TAS A E+S G YCPG DP PP E+TTCLG
Sbjct  221  YKEMVIYVEACESGSIFEGLMPENLDIYVTTASNAVESSWGTYCPGMDPPPPREFTTCLG  280

Query  193  DLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKLSKY  369
            DL+S++WMEDS+ HN K+ET+  Q+E VK RT N+ T   GSHVMEYG   ++ D LS Y
Sbjct  281  DLYSVAWMEDSETHNLKEETVGKQFEEVKMRTSNHDTYNTGSHVMEYGDKSVKSDVLSLY  340

Query  370  QGYVLPPI-----NVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            QG+  P I     N   + MP   ++QRDA+LL++W+ Y++  DE+S  K ++L+E+++ 
Sbjct  341  QGFE-PAIANVTENALRLRMPMGVINQRDADLLFMWKMYEQ-SDERSSKKKEILEEITKT  398

Query  535  MQVRAYIDGSVDAIGDYLFGTE  600
            +  R ++D S+D IG+ +FG+E
Sbjct  399  LMHRVHLDSSIDYIGNQIFGSE  420



>ref|XP_011033921.1| PREDICTED: vacuolar-processing enzyme-like [Populus euphratica]
Length=494

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 146/207 (71%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YK+MV+Y+EACESGS+FEG++P D NIY  TAS A+E+S G YCPG +P PPPEY T
Sbjct  206  SGNYKEMVMYIEACESGSIFEGIMPKDINIYVTTASNAEESSWGTYCPGMEPSPPPEYVT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS +HN ++ETI  QY +VK+RT N N    GSHVM+YG+  ++ +KL
Sbjct  266  CLGDLYSVSWMEDSGKHNLRRETIEQQYHSVKERTSNYNTFTSGSHVMQYGNESIKGEKL  325

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+       PP NV  I      V+QRDAEL++LW+ YKR  ++ SE K ++L ++
Sbjct  326  YLYQGFDPASVNFPPNNVH-IGGRMDVVNQRDAELVFLWQMYKR-SEDGSEKKTQILNQI  383

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             E ++ R  +D S++ IG  LFG +K 
Sbjct  384  KETVRHRTRLDSSMELIGTLLFGPKKG  410



>sp|O24325.1|VPE1_PHAVU RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Legumain-like proteinase; Short=LLP; Flags: Precursor 
[Phaseolus vulgaris]
 emb|CAB17078.1| asparagine-specific endopeptidase precursor [Phaseolus vulgaris]
Length=484

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 143/206 (69%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP D N+YA TAS ADE+S G YCPG DP PPPEY+T
Sbjct  196  SGTYKNLVFYLEACESGSIFEGLLPEDINVYATTASNADESSWGTYCPGEDPSPPPEYST  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSDRHN + ET+  QY+ VK+RT + G   GSHVM+YG + L KD L 
Sbjct  256  CLGDLYSVAWMEDSDRHNLRTETLHQQYKLVKERTISGGLYYGSHVMQYGDVGLSKDILF  315

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G       L  ++  ++      V+QRDA+L++ W+K+++   E S  K++  K++ 
Sbjct  316  HYLGTDPANENLTFVDENSLWSSSKAVNQRDADLVHFWDKFRK-APEGSPKKNEARKQVL  374

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV+ +G  LFG EKA
Sbjct  375  EVMSHRMHIDDSVELVGKLLFGIEKA  400



>ref|XP_007160985.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
 gb|ESW32979.1| hypothetical protein PHAVU_001G033500g [Phaseolus vulgaris]
Length=484

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 143/206 (69%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP D N+YA TAS ADE+S G YCPG DP PPPEY+T
Sbjct  196  SGTYKNLVFYLEACESGSIFEGLLPEDINVYATTASNADESSWGTYCPGEDPSPPPEYST  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSDRHN + ET+  QY+ VK+RT + G   GSHVM+YG + L KD L 
Sbjct  256  CLGDLYSVAWMEDSDRHNLRTETLHQQYKLVKERTISGGLYYGSHVMQYGDVGLSKDILF  315

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G       L  ++  ++      V+QRDA+L++ W+K+++   E S  K++  K++ 
Sbjct  316  HYLGTDPANENLTFVDENSLWSSSKAVNQRDADLVHFWDKFRK-APEGSPKKNEARKQVL  374

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV+ +G  LFG EKA
Sbjct  375  EVMSHRMHIDDSVELVGKLLFGIEKA  400



>ref|NP_001105183.1| vacuolar processing enzyme1 precursor [Zea mays]
 gb|AAL58571.1| vacuolar processing enzyme 1 [Zea mays]
Length=494

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 145/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIY+EACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  207  SNSYAKMVIYIEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPPPPSEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ +N K+ET+  QYE VKKRT + N  G GSHVMEYG    +++KL
Sbjct  267  CLGDLYSVSWMEDSETNNLKEETVKEQYEVVKKRTSDFNSYGAGSHVMEYGDKTFKEEKL  326

Query  361  SKYQGYVLPPINVATIPM---PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     NV    +       V+QRDA++L+LW++Y+ L  EKSE K +VL+E++ 
Sbjct  327  YLYQGFDPANANVTNKLLWSGQEAVVNQRDADILFLWKRYELL-HEKSEEKQEVLREITG  385

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             ++ R ++D S++ IG  LFG EK 
Sbjct  386  TVRHRKHLDNSINFIGKLLFGAEKG  410



>sp|P49046.1|LEGU_CANEN RecName: Full=Legumain; AltName: Full=Asparaginyl endopeptidase; 
Flags: Precursor [Canavalia ensiformis]
 dbj|BAA06596.1| asparaginyl endopeptidase [Canavalia ensiformis]
Length=475

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 144/208 (69%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YK+MVIY+EACESGS+FEG++P D NIY  TAS A ENS G YCPG +P PP EY T
Sbjct  187  SGGYKEMVIYIEACESGSIFEGIMPKDLNIYVTTASNAQENSFGTYCPGMNPPPPEEYVT  246

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+ET+  QY++V+KRT N N    GSHVM+YG  ++  +KL
Sbjct  247  CLGDLYSVSWMEDSETHNLKRETVQQQYQSVRKRTSNSNSYRFGSHVMQYGDTNITAEKL  306

Query  361  SKYQGYVLPPINVATIPMPGT------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              Y G+   P  V   P  G        V+QRDAELL++W+ Y+R  + + E K  +L++
Sbjct  307  YLYHGF--DPATVNFPPHNGNLEAKMEVVNQRDAELLFMWQMYQR-SNHQPEKKTHILEQ  363

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            ++E ++ R ++DGSV+ IG  L+G  K+
Sbjct  364  ITETVKHRNHLDGSVELIGVLLYGPGKS  391



>emb|CAQ00096.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26636.1| vacuolar processing enzyme 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 139/205 (68%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + TY KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  205  SNTYAKMVIYVEACESGSIFEGLMPADLNIYVTTASNAEESSWGTYCPGMEPSPPSEYIT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDS+ +N K+ETI  QYE VKKRT + N    GSHVMEYG    + +KL
Sbjct  265  CLGDLYSISWMEDSETNNLKEETIKKQYEVVKKRTSDMNSYSAGSHVMEYGDKTFKDEKL  324

Query  361  SKYQGYVLPPINVATIPM---PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+            ++QRDA+LL+LW +Y+ L  EKS+ K  VL+E+SE
Sbjct  325  YLYQGFNPANTNITNKLFWQARKAAINQRDADLLFLWRRYELL-HEKSKEKVNVLREISE  383

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +  R ++D S+D IG  LFG E  
Sbjct  384  TVTHRKHLDSSIDFIGKLLFGFENG  408



>gb|KJB65604.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=394

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK MV Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  106  SGTYKSMVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  165

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT N  +  GSHVM+YG + L KD L 
Sbjct  166  CLGDLYSVAWMEDSDMHNLRTETLHQQYELVKKRTINGNSAYGSHVMQYGDVGLSKDSLF  225

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  226  AYLGTNPANDNFTFVDENSLVPPTKAVNQRDADLVHFWYKYRK-APEGSVRKTEAQKQFV  284

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID SV  IG  LFG E+
Sbjct  285  EAMSHRMHIDHSVKLIGKLLFGIER  309



>emb|CDY03258.1| BnaC09g10900D [Brassica napus]
Length=490

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A TYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  193  AETYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  252

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKET+  QY+ VK RT N N    GSHVMEYG+  ++ +KL
Sbjct  253  CLGDLYSVAWMEDSETHNLKKETVKQQYQTVKMRTSNYNTYSEGSHVMEYGNSSIKSEKL  312

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LP   +     P   V+QRDA+L++LW+ Y+    E    KD+++KE+
Sbjct  313  YLYQGFDPATANLPSNELPVKSSPVGVVNQRDADLIFLWQMYRT--SEDGSRKDEIMKEL  370

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
            +E  + R  +D SV+ IG  LFG
Sbjct  371  TETTRHRKQLDTSVELIGTVLFG  393



>dbj|BAA09615.1| vacuolar processing enzyme [Arabidopsis thaliana]
Length=484

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 139/201 (69%), Gaps = 6/201 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  198  SGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  257

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDS+ HN KKETI  QY  ++   +N  + GGSHVMEYG+  ++ +KL 
Sbjct  258  CLGDLYSVAWMEDSETHNLKKETIKQQYHTMRTSNYNTYS-GGSHVMEYGNNSIKSEKLY  316

Query  364  KYQGYVLPPINVATIPMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
             YQG+    +N+    +P  +    V+QRDA+LL+LW  + R  ++ S  KD  LKE++E
Sbjct  317  LYQGFEPATVNLPLNELPAKSKIGVVNQRDADLLFLWHMH-RTSEDGSRKKDDTLKELTE  375

Query  532  KMQVRAYIDGSVDAIGDYLFG  594
              + R ++D SV+ I   LFG
Sbjct  376  TTRHRKHLDASVELIATILFG  396



>gb|EYU20379.1| hypothetical protein MIMGU_mgv1a005412mg [Erythranthe guttata]
Length=484

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYKK+V Y+EACE+GS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  196  SGTYKKLVFYLEACEAGSIFEGLLPKGLNIYATTASNAEESSWGTYCPGDYPSPPPEYET  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SI+WMEDSD HN + ET+S QYE VKKRT N  +  GSHVM+YG + L  + L 
Sbjct  256  CLGDLYSIAWMEDSDIHNLRTETLSQQYELVKKRTANENSYYGSHVMQYGDVKLNAESLF  315

Query  364  KYQGYVLPPINVATI----PMPGTT-VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N+  +    P+P +  V+QRDA+LL+ W K++R   E S+ K    K++S
Sbjct  316  TYLGTDPANDNLTFVDENSPLPSSKPVNQRDADLLHFWHKFRR-APEGSDRKFAAQKQLS  374

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R ++D S+  IG  LFG +K
Sbjct  375  EAMAHRTHVDSSIKLIGKLLFGIDK  399



>ref|XP_002455802.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
 gb|EES00922.1| hypothetical protein SORBIDRAFT_03g025440 [Sorghum bicolor]
Length=481

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 142/207 (69%), Gaps = 11/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  192  AGTYKSLVFYLEACESGSIFEGLLPDDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  251

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDSD HN + E++  QY+ VK RT    T   GSHVM+YGS++L   KL
Sbjct  252  CLGDLYSVSWMEDSDFHNLRTESLKQQYKLVKDRTAVQDTFSYGSHVMQYGSLELNVQKL  311

Query  361  SKYQGYVLPPINVA-------TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N         ++P     V+QRDA+L+Y W+KY++L D+ S+ K++  K
Sbjct  312  FSYIG--TNPANDGNTFVEDNSLPSFSKAVNQRDADLVYFWQKYRKLADDSSK-KNEARK  368

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTE  600
            E+ E M  R+++D SV+ IG  LFG+E
Sbjct  369  ELLEVMAHRSHVDNSVELIGSLLFGSE  395



>ref|XP_004298668.1| PREDICTED: legumain [Fragaria vesca subsp. vesca]
Length=493

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 145/202 (72%), Gaps = 6/202 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MVIYVEACESGS+FEG++P D NIY  TAS A+ENS G YCPG +P PPPEY T
Sbjct  205  SGSYKEMVIYVEACESGSIFEGIMPSDLNIYVATASNAEENSFGTYCPGMNPPPPPEYIT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+RHN KKETI  QY+ VK+RT N N    GSHVM+YGS +L ++KL
Sbjct  265  CLGDLYSVAWMEDSERHNLKKETIKEQYQTVKERTSNFNNYNIGSHVMQYGSKNLTEEKL  324

Query  361  SKYQGY----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              Y G+    V  P N   +      V+QRDAE+ ++W+ YKR  +  SE K ++LK++ 
Sbjct  325  YLYLGFDPASVNFPPNNGQLEQHMEVVNQRDAEIFFMWQLYKR-SEHGSEKKREILKQIR  383

Query  529  EKMQVRAYIDGSVDAIGDYLFG  594
            + M  R +IDGS+  IG +L+G
Sbjct  384  DTMNHRNHIDGSIKFIGTFLYG  405



>emb|CAB16318.1| cysteine proteinase precursor [Vicia narbonensis]
Length=488

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YKKMVIYVEACESGS+FEG++P D N+Y  TAS A ENS G YCPG DP PPPEY T
Sbjct  200  SGGYKKMVIYVEACESGSIFEGIMPKDINVYVTTASNAQENSWGTYCPGVDPAPPPEYIT  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ET+  QY +V++RT N      GSHVM+YG  ++  +KL
Sbjct  260  CLGDLYSVAWMEDSETHNLKRETVKQQYMSVRERTSNYKNYPLGSHVMQYGDTNITDEKL  319

Query  361  SKYQGYVL----PPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              Y G+      P  N   +      V+QRDAE+L++W  Y+RL D ++E K   L+++S
Sbjct  320  YLYHGFDPADGEPSSNNDILEAKMEVVNQRDAEILFMWHMYQRL-DHQTEKKKDTLEKIS  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E ++ R ++DGSV+ IG  LFG  K 
Sbjct  379  ETVKHRNHLDGSVELIGVLLFGPTKG  404



>gb|KJB65606.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=395

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 134/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK MV Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  107  SGTYKSMVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  166

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT N  +  GSHVM+YG + L KD L 
Sbjct  167  CLGDLYSVAWMEDSDMHNLRTETLHQQYELVKKRTINGNSAYGSHVMQYGDVGLSKDSLF  226

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  227  AYLGTNPANDNFTFVDENSLVPPTKAVNQRDADLVHFWYKYRK-APEGSVRKTEAQKQFV  285

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV  IG  LFG E+ 
Sbjct  286  EAMSHRMHIDHSVKLIGKLLFGIERG  311



>ref|XP_002516472.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
 gb|EEF45813.1| Vacuolar-processing enzyme precursor, putative [Ricinus communis]
Length=492

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 138/208 (66%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  204  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  263

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SI+WMEDSD HN + ET+  QYE VK+RT N  +  GSHVM+YG + L ++ L 
Sbjct  264  CLGDLYSIAWMEDSDVHNLQTETLHQQYELVKRRTSNGNSAYGSHVMQYGDVGLSRENLF  323

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y    ++  ++  P   V+QRDA+L++ W+KY++  D  S  KD+  K+
Sbjct  324  LYMGTNPANDNYTF--VDENSLTPPSKAVNQRDADLVHFWDKYRKAPD-GSARKDQAQKQ  380

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
              E M  R +ID SV  IG  LFG EKA
Sbjct  381  FVEAMSHRMHIDHSVKLIGKLLFGLEKA  408



>ref|NP_001241716.1| uncharacterized protein LOC100856894 precursor [Zea mays]
 emb|CAC18099.1| putative legumain [Zea mays]
 gb|ACF88247.1| unknown [Zea mays]
 gb|AFW83035.1| putative uncharacterized protein Precursor [Zea mays]
Length=486

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 142/207 (69%), Gaps = 11/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D N+YA TAS ADE+S G YCPG  P PPPEY T
Sbjct  197  AGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNADESSWGTYCPGEFPSPPPEYDT  256

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY+ VK RT  + T   GSHVM+YG+++L   +L
Sbjct  257  CLGDLYSVAWMEDSDFHNLRTESLKQQYKLVKDRTAVHDTFSYGSHVMQYGALELNVQRL  316

Query  361  SKYQGYVLPPINVA-------TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N         ++P     V+QRDA+L+Y W+KY++L D  S  K++  K
Sbjct  317  FSYIG--TDPANDGNTFIEDNSLPSFSKAVNQRDADLVYFWQKYRKLADS-SHAKNEARK  373

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTE  600
            E+ E M  R+++D SV+ IG  LFG+E
Sbjct  374  ELLEVMAHRSHVDSSVELIGSLLFGSE  400



>ref|XP_009398114.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=396

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +YK+MVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG DP PPPEY TCL
Sbjct  110  SYKEMVIYVEACESGSIFEGLMPKDLNIYVTTASNAEESSWGTYCPGMDPPPPPEYITCL  169

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKLSK  366
            GDL+S++WMEDS+ HN K+ET+S QYE VK RT N N    GSHVMEYG  +++ +KL  
Sbjct  170  GDLYSVAWMEDSETHNLKEETVSKQYEAVKVRTSNYNTYSVGSHVMEYGDKNIKPEKLYL  229

Query  367  YQGYVLPPINVA----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            YQG+     N+     +  M   T++QRDA+LL+LW++Y+RL  E SE K + + E++E 
Sbjct  230  YQGFDPANANITENGLSQRMQMGTINQRDADLLFLWKRYERLA-ESSEDKRRTVMEITET  288

Query  535  MQVRAYIDGSVDAIGDYLFGT  597
            M  R ++D S+D IG  +FG+
Sbjct  289  MMHRTHLDRSIDLIGKLIFGS  309



>ref|XP_010553469.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Tarenaya 
hassleriana]
Length=493

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 146/206 (71%), Gaps = 12/206 (6%)
 Frame = +1

Query  1    EAGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYT  180
            ++GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG DP PPPEY 
Sbjct  203  KSGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMDPPPPPEYI  262

Query  181  TCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDK  357
            TCLGDL+S++WMEDS+ HN K+ET+  QY+ VK RT N N   GGSHVMEYG+  ++ +K
Sbjct  263  TCLGDLYSVAWMEDSESHNLKRETLKQQYQTVKTRTSNYNTYSGGSHVMEYGNTSIKSEK  322

Query  358  LSKYQGYVLPPINVATIPMPGT-------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
            L  YQG+   P NV  IP  G         V+QRDA+LL+LW  Y+R  +  S  K ++L
Sbjct  323  LYLYQGF--DPANV-NIPPNGLWIGSRMGVVNQRDADLLFLWHLYQR-SENGSRKKREIL  378

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFG  594
            +E++E  + R +ID SV+ +G +LFG
Sbjct  379  REITETTRHRKHIDASVELVGTFLFG  404



>ref|XP_003569218.1| PREDICTED: vacuolar-processing enzyme-like [Brachypodium distachyon]
Length=488

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 139/205 (68%), Gaps = 7/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D  IYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  199  AGTYKSLVFYLEACESGSIFEGLLPNDIGIYATTASNAEESSWGTYCPGEYPSPPPEYDT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SI+WMEDSD HN + E++  QY+ VKKRT   N    GSHVM+YGS+DL  + L
Sbjct  259  CLGDLYSIAWMEDSDVHNLRTESLKQQYDLVKKRTAPENSYSYGSHVMQYGSLDLNAEHL  318

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W+KY++L  E S  K+   KE+
Sbjct  319  FLYIGSNPANDNTTFVEGNSLPSFSRAVNQRDADLVYFWQKYRKLA-ESSPAKNDARKEL  377

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTE  600
             E M  R+++D SV+  G+ LFG+E
Sbjct  378  LEMMAHRSHVDNSVELTGNLLFGSE  402



>gb|ABF00019.1| legumain precursor [Saccharum officinarum]
Length=488

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 141/207 (68%), Gaps = 11/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+YK +V Y+EACESGS+FEGLLP D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  199  AGSYKSLVFYLEACESGSIFEGLLPDDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDSD HN + E++  QY+ VK RT    T   GSHVM+YGS++L   KL
Sbjct  259  CLGDLYSVSWMEDSDFHNLRTESLKQQYKLVKDRTAAQDTFSYGSHVMQYGSLELNVQKL  318

Query  361  SKYQGYVLPPINVA-------TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N         ++P     V+QRDA+L+Y W+KY++L D  S+ K++  K
Sbjct  319  FSYIG--TNPANDGNTFVEDNSLPSFSKAVNQRDADLVYFWQKYRKLADGSSK-KNEARK  375

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTE  600
            E+ E M  R+++D SV+ IG  LFG+E
Sbjct  376  ELLEVMSHRSHVDNSVELIGSLLFGSE  402



>ref|XP_008369533.1| PREDICTED: legumain [Malus domestica]
Length=501

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 143/207 (69%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MVIY+EACESGS+FEG++P D NIY  TAS A ENS G YCPG DP PPPEY T
Sbjct  213  SGSYKEMVIYIEACESGSIFEGIMPKDLNIYVTTASNAQENSFGTYCPGMDPPPPPEYIT  272

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+RHN KKETI  QY  VK+RT N N    GSHVMEYGS ++ ++KL
Sbjct  273  CLGDLYSVSWMEDSERHNLKKETIEQQYLVVKQRTSNSNNYDVGSHVMEYGSKNITQEKL  332

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G+      LPP N   +  P   V+QRDAE+ Y+W+ YKR  +  S    ++L E+
Sbjct  333  YLYLGFDPASVNLPP-NNGQLEKPMEVVNQRDAEIFYMWQMYKR-SEHGSGKSREILNEI  390

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             E M+ R ++D S+  IG +L+G  K 
Sbjct  391  KETMRHRTHLDASIQFIGTFLYGPGKG  417



>ref|XP_010646818.1| PREDICTED: vacuolar-processing enzyme [Vitis vinifera]
Length=494

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 141/206 (68%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MV+YVEACESGS+FEGL+P D NIY  TAS  DE S G YCPG +P PPPEY T
Sbjct  206  SGSYKEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESWGTYCPGMEPAPPPEYIT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDLFS++W+EDS+ HN KK+TI  QY+ VK RT N+ T   GSHVM YG+  ++ + L
Sbjct  266  CLGDLFSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSVGSHVMVYGNESIKTELL  325

Query  361  SKYQGYVLP----PINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+       P N   + +    ++QRDA+LL+LW++YKR   +    K ++LK+++
Sbjct  326  YLYQGFDPATDKLPQNKFDLDIRMDVINQRDADLLFLWQRYKR--SKADSEKKEILKQLT  383

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + MQ R ++D S++ IG  L G E  
Sbjct  384  QTMQHRVHLDQSIELIGMLLLGPENG  409



>emb|CAQ00099.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26641.1| vacuolar processing enzyme 3 [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  195  AGTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDT  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY  VKKRT   +    GSHVM+YGS+DL  + L
Sbjct  255  CLGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLDLNAEHL  314

Query  361  SKYQGYVLPPINVAT-------IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N  T       +P     V+QRDA+L+Y W+KY++L  E S  K+   K
Sbjct  315  FSYIGS--NPANENTTFVEDNALPSLSRAVNQRDADLVYFWQKYRKLA-ESSPAKNNARK  371

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGT  597
            ++ E M  R++ID SV+ IG+ LFG+
Sbjct  372  QLLEMMGHRSHIDSSVELIGNLLFGS  397



>ref|XP_004953273.1| PREDICTED: vacuolar-processing enzyme beta-isozyme-like [Setaria 
italica]
Length=494

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P D NIY  TAS A+E+S G YCPG  P PP EY T
Sbjct  207  SNSYAKMVIYVEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMIPSPPSEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDS+ HN K+ETI  QYE VK+RT + N  G GSHVMEYG    + +KL
Sbjct  267  CLGDLYSVSWMEDSETHNLKEETIKEQYEAVKERTSDSNSYGAGSHVMEYGDKTFKGEKL  326

Query  361  SKYQGYVLPPINVATIPM---PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     ++    +     + V+QRDA++L+LW++Y+ L +EKS+ K +VL+E++ 
Sbjct  327  YLYQGFNPENADITYKLLWQGQKSVVNQRDADILFLWKRYELL-NEKSKEKLEVLREITG  385

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +  R ++D SVD IG  LFG E  
Sbjct  386  TVTHRKHLDSSVDFIGKLLFGVENG  410



>gb|AEY68248.1| legumain [Saccharum hybrid cultivar SP80-3280]
Length=488

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 141/207 (68%), Gaps = 11/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  199  AGTYKSLVFYLEACESGSIFEGLLPDDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDSD HN + E++  QY+ VK RT    T   GSHVM+YGS++L   KL
Sbjct  259  CLGDLYSVSWMEDSDFHNLRTESLKQQYKLVKDRTAAQDTFSYGSHVMQYGSLELNVQKL  318

Query  361  SKYQGYVLPPINVA-------TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N         ++P    + +QRDA+L+Y W+KY++L D  S+ K++  K
Sbjct  319  FSYIG--TNPANDGNTFVEDNSLPSFFKSCNQRDADLVYFWQKYRKLADGSSK-KNEARK  375

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTE  600
            E+ E M  R+++D SV+ IG  LFG+E
Sbjct  376  ELLEVMSHRSHVDNSVELIGSLLFGSE  402



>gb|KHG13131.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YK MV Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  200  SGNYKSMVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT N  +  GSHVM+YG + L KD L 
Sbjct  260  CLGDLYSVAWMEDSDMHNLRTETLHQQYELVKKRTINGNSAYGSHVMQYGDVGLSKDSLF  319

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  320  AYLGTNPANDNFTFVDENSLVPPTKAVNQRDADLVHFWYKYRK-APEGSVRKTEAQKQFV  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M +R +ID SV  IG  LFG E+
Sbjct  379  EAMSLRMHIDHSVKLIGKLLFGIER  403



>gb|KJB65602.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=488

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK MV Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  200  SGTYKSMVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT N  +  GSHVM+YG + L KD L 
Sbjct  260  CLGDLYSVAWMEDSDMHNLRTETLHQQYELVKKRTINGNSAYGSHVMQYGDVGLSKDSLF  319

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  320  AYLGTNPANDNFTFVDENSLVPPTKAVNQRDADLVHFWYKYRK-APEGSVRKTEAQKQFV  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID SV  IG  LFG E+
Sbjct  379  EAMSHRMHIDHSVKLIGKLLFGIER  403



>emb|CBI28507.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 141/204 (69%), Gaps = 7/204 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MV+YVEACESGS+FEGL+P D NIY  TAS  DE S G YCPG +P PPPEY T
Sbjct  278  SGSYKEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESWGTYCPGMEPAPPPEYIT  337

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDLFS++W+EDS+ HN KK+TI  QY+ VK RT N+ T   GSHVM YG+  ++ + L
Sbjct  338  CLGDLFSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSVGSHVMVYGNESIKTELL  397

Query  361  SKYQGYVLP----PINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+       P N   + +    ++QRDA+LL+LW++YKR   +    K ++LK+++
Sbjct  398  YLYQGFDPATDKLPQNKFDLDIRMDVINQRDADLLFLWQRYKR--SKADSEKKEILKQLT  455

Query  529  EKMQVRAYIDGSVDAIGDYLFGTE  600
            + MQ R ++D S++ IG  L G E
Sbjct  456  QTMQHRVHLDQSIELIGMLLLGPE  479



>ref|XP_006382031.1| hypothetical protein POPTR_0006s24900g [Populus trichocarpa]
 gb|ERP59828.1| hypothetical protein POPTR_0006s24900g [Populus trichocarpa]
Length=310

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 135/208 (65%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  22   SGTYKSLVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  81

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT  + +  GSHVM+YG + L KD L 
Sbjct  82   CLGDLYSVAWMEDSDIHNLRTETLHQQYELVKRRTSYDNSPYGSHVMQYGDVGLSKDDLF  141

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            +Y G       Y     N  ++      V+QRDA+L++ W KY++   E S  K +  K+
Sbjct  142  QYMGTNPANDNYTFVEEN--SLRPHSKVVNQRDADLVHFWTKYRK-APEGSSRKVEAQKQ  198

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
              E M  R +ID S+  IG  LFG EKA
Sbjct  199  FVEAMSHRMHIDHSIKLIGKLLFGIEKA  226



>gb|AEO79971.1| vacuolar processing enzyme [Arachis diogoi]
Length=487

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 137/208 (66%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YK +V Y+EACESGS+FEGLLP D NIYA TAS A E+S G YCPG DP PPPEY+T
Sbjct  199  SGGYKSLVFYLEACESGSIFEGLLPEDINIYATTASNAVESSWGTYCPGEDPSPPPEYST  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SISWMEDSD HN + ET+  QY+ VK RT N     GSH M+YG + + ++ L 
Sbjct  259  CLGDLYSISWMEDSDTHNLRTETLHQQYKLVKDRTLNGNAYYGSHAMQYGDVGISENLLF  318

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            +Y G       Y    ++  ++  P   V+QRDA+L++ WEK+++   E S  K    K+
Sbjct  319  QYLGTNPANDNYTF--VDENSLRTPSKAVNQRDADLIHFWEKFRK-APEGSSSKITAQKQ  375

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + E M  R +ID SV  IG+ LFGTEK 
Sbjct  376  VVEVMSHRMHIDNSVKLIGNLLFGTEKG  403



>gb|AIT97058.1| vacuolar processing enzyme [Triticum aestivum]
Length=311

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 136/203 (67%), Gaps = 7/203 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACE+GS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PP EY T
Sbjct  22   AGTYKSLVFYLEACEAGSVFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPSEYDT  81

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY+ VKKRT   +    GSHVM+YGS+DL    L
Sbjct  82   CLGDLYSISWMEDSDVHNLRTESLKQQYDLVKKRTAAQDSYSYGSHVMQYGSLDLNDQHL  141

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W KY++L +  +E K+   K++
Sbjct  142  FLYIGSNPANDNTTFVEDNSLPSFSRAVNQRDADLVYFWRKYQKLAESSTE-KNDARKQL  200

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
             E M  R++ID SV+ IG+ LFG
Sbjct  201  LEMMSHRSHIDNSVELIGNLLFG  223



>gb|EMS65516.1| Vacuolar-processing enzyme [Triticum urartu]
Length=441

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  152  AGTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDT  211

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY  VKKRT   +    GSHVM+YGS+DL  + L
Sbjct  212  CLGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLDLNAEHL  271

Query  361  SKYQGYVLPPINVAT-------IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N  T       +P     V+QRDA+L+Y W+KY++L  E S  K+   K
Sbjct  272  FSYIGS--NPANENTTFVEDNALPSFSRAVNQRDADLVYFWQKYRKLA-ESSPEKNDARK  328

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGT  597
            ++ E M  R++ID S++ IG+ LFG+
Sbjct  329  QLLEMMGHRSHIDNSIELIGNLLFGS  354



>gb|ACF79136.1| unknown [Zea mays]
 gb|ACF85763.1| unknown [Zea mays]
 gb|ACF88139.1| unknown [Zea mays]
 tpg|DAA58991.1| TPA: legumain-like protease Precursor [Zea mays]
Length=481

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 139/206 (67%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  192  AGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  251

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY  VK RT    T   GSHVM+YGS++L    L
Sbjct  252  CLGDLYSVAWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLELNVKHL  311

Query  361  SKYQGYVLPP------INVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              Y G   P       I   ++P     V+QRDA+L+Y W+KY++L D   E K++  KE
Sbjct  312  FSYIG-TNPANDDNTFIEDNSLPSFSKAVNQRDADLVYFWQKYRKLADSSPE-KNEARKE  369

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTE  600
            + E M  R+++D SV+ IG  LFG+E
Sbjct  370  LLEVMAHRSHVDSSVELIGSLLFGSE  395



>dbj|BAJ89125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 136/201 (68%), Gaps = 5/201 (2%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGLLP D NIY  TAS A ENS G YCPG    PP EY TC+
Sbjct  24   SYSKMIIYVEACESGSIFEGLLPEDLNIYVTTASNAVENSWGAYCPGMKSSPPTEYDTCI  83

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKLSK  366
            GD++S+SWMEDS+ HN KKET+  QYE VK RT  +     GSHVMEYG    + +KL  
Sbjct  84   GDIYSVSWMEDSETHNLKKETLKQQYEVVKSRTSKSKEFDKGSHVMEYGDKTFKDEKLFH  143

Query  367  YQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKM  537
            YQG+     NVA    +P     ++QRDA++L++W++Y++L +  SE K  VL+E+ E +
Sbjct  144  YQGFNPANSNVANRLLLPDLEGAINQRDADILFMWKRYEKL-NGGSEEKLGVLREIKETV  202

Query  538  QVRAYIDGSVDAIGDYLFGTE  600
              R ++D S+D IG  +FG E
Sbjct  203  AHRKHLDSSIDFIGKLVFGFE  223



>gb|AET08896.1| vacuolar processing enzyme 4 [Aegilops tauschii]
 emb|CCC14982.1| VPE4D protein [Aegilops tauschii]
Length=493

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  204  AGTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDT  263

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY  VKKRT   +    GSHVM+YGS+DL  + L
Sbjct  264  CLGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLDLNAEHL  323

Query  361  SKYQGYVLPPINVAT-------IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N  T       +P     V+QRDA+L+Y W+KY++L  E S  K+   K
Sbjct  324  FSYIGS--NPANENTTFVEDNALPSFSRAVNQRDADLVYFWQKYRKLA-ESSPEKNDARK  380

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGT  597
            ++ E M  R++ID SV+ IG+ LFG+
Sbjct  381  QLLEMMGHRSHIDNSVEPIGNLLFGS  406



>gb|AGC54786.1| beta vacuolar processing enzyme [Vitis vinifera]
Length=494

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 141/208 (68%), Gaps = 11/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK+MV+YVEACESGS+FEGL+P D NIY  TAS  DE S G YCPG +P PPPEY T
Sbjct  206  SGSYKEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESWGTYCPGMEPAPPPEYIT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL S++W+EDS+ HN KK+TI  QY+ VK RT N+ T   GSHVM YG+  ++ + L
Sbjct  266  CLGDLLSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSVGSHVMVYGNESIKTELL  325

Query  361  SKYQGYVLP----PINVATIPMPGTTVHQRDAELLYLWEKYKR--LGDEKSEMKDKVLKE  522
              YQG+       P N   + +    ++QRDA+LL+LW++YKR   G EK E    +LK+
Sbjct  326  YLYQGFDPATDKLPQNKFDLDIRMDVINQRDADLLFLWQRYKRSKAGSEKKE----ILKQ  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            +++ MQ R ++D S++ IG  L G E  
Sbjct  382  LTQTMQHRVHLDQSIELIGMLLLGPENG  409



>gb|AET08891.1| vacuolar processing enzyme 4 [Triticum monococcum]
 emb|CCC14976.1| VPE4A protein [Triticum urartu]
Length=493

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  204  AGTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDT  263

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY  VKKRT   +    GSHVM+YGS+DL  + L
Sbjct  264  CLGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLDLNAEHL  323

Query  361  SKYQGYVLPPINVAT-------IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N  T       +P     V+QRDA+L+Y W+KY++L  E S  K+   K
Sbjct  324  FSYIGS--NPANENTTFVEDNALPSFSRAVNQRDADLVYFWQKYRKLA-ESSPEKNDARK  380

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGT  597
            ++ E M  R++ID SV+ IG+ LFG+
Sbjct  381  QLLEMMGHRSHIDNSVELIGNLLFGS  406



>gb|AET08893.1| vacuolar processing enzyme 4 [Aegilops speltoides]
 emb|CCC14971.1| VPE4B protein [Aegilops speltoides]
Length=493

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  204  AGTYKSLVFYLEACESGSIFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPPEYDT  263

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY  VKKRT   +    GSHVM+YGS+DL  + L
Sbjct  264  CLGDLYSISWMEDSDVHNLRTESLKQQYNLVKKRTAAQDSYSYGSHVMQYGSLDLNAEHL  323

Query  361  SKYQGYVLPPINVAT-------IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N  T       +P     V+QRDA+L+Y W+KY++L  E S  K+   K
Sbjct  324  FSYIGS--NPANENTTFVEDNALPSFSGAVNQRDADLVYFWQKYRKLA-ESSPEKNDARK  380

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGT  597
            ++ E M  R++ID SV+ IG+ LFG+
Sbjct  381  QLLEMMGHRSHIDNSVELIGNLLFGS  406



>ref|NP_001291333.1| vacuolar-processing enzyme precursor [Sesamum indicum]
 gb|AAF89679.1| asparaginyl endopeptidase [Sesamum indicum]
Length=489

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 149/211 (71%), Gaps = 16/211 (8%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS+FEGL+P D +IY  TAS A+E+S G YCPG DP PPPEY T
Sbjct  201  SGTYKEMVIYVEACESGSVFEGLMPDDLDIYVTTASNAEESSWGTYCPGMDPPPPPEYIT  260

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ET+  QY+ VK+RT N N    GSHVMEYG+  ++ +KL
Sbjct  261  CLGDLYSVAWMEDSESHNLKRETVEQQYQQVKERTSNFNTYNAGSHVMEYGNKSIKSEKL  320

Query  361  SKYQGYVLPPINVATIPMPGT---------TVHQRDAELLYLWEKYKRLGDEKSEMKDKV  513
              YQG+     + AT  MP +          V+QRDA+LL+LWE+YKRL D  ++ K ++
Sbjct  321  YLYQGF-----DPATENMPPSENHLKPHMDVVNQRDADLLFLWERYKRL-DGGAKKKSEL  374

Query  514  LKEMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             K +++ M  R ++D S+D IG +LFG E  
Sbjct  375  FKLITDTMLHRKHMDDSIDIIGAFLFGPENG  405



>gb|EYU34366.1| hypothetical protein MIMGU_mgv1a018579mg [Erythranthe guttata]
Length=491

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 148/207 (71%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIY+EACESGS+FEGL+P + NIY  TAS A+E+S G YCPG DP PPPEY T
Sbjct  203  SGTYKEMVIYIEACESGSVFEGLMPDNLNIYVTTASNAEESSWGTYCPGMDPPPPPEYIT  262

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SI+WMEDS+ HN K+ETI  QY+ VK+RT N N    GSHVMEYG+   + +KL
Sbjct  263  CLGDLYSIAWMEDSETHNLKRETIEQQYDQVKERTSNYNTYNAGSHVMEYGNTSFKWEKL  322

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N   +      V+QRDA++L+LWE+YK++ D  ++ K + LK +
Sbjct  323  YLYQGFDPATENLPP-NGIEVKERMDVVNQRDADVLFLWERYKKMED-GTKAKAEFLKVI  380

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            +E M  R ++DGSVD IG  LFG +K 
Sbjct  381  TETMLHREHLDGSVDIIGLALFGPDKG  407



>gb|ABK25457.1| unknown [Picea sitchensis]
Length=453

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 142/210 (68%), Gaps = 14/210 (7%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A TYK+MVIYVEACESGS+FEGLLP   NIY  TAS A+E+S G YCPG  P PP EY T
Sbjct  195  ADTYKQMVIYVEACESGSIFEGLLPEGMNIYVTTASNAEESSWGTYCPGMKPSPPLEYDT  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN  KET+  QY+ VK+RT N+ T G GSHVM+YG + + +D L
Sbjct  255  CLGDLYSVAWMEDSEVHNTMKETLKQQYQVVKERTSNHQTYGMGSHVMQYGDIPISEDPL  314

Query  361  SKYQGYVLPPINVATI---PMP-------GTTVHQRDAELLYLWEKYKRLGDEKSEMKDK  510
            S Y G+   P N   I    +P          ++QRDA+LLYLW+KYKR   + +E K +
Sbjct  315  SLYIGF--DPANADAIFENRLPQYLREKDAAAINQRDADLLYLWQKYKRSKPDSTE-KLE  371

Query  511  VLKEMSEKMQVRAYIDGSVDAIGDYLFGTE  600
              +E+ E M  R Y+D S++ IG  LFG++
Sbjct  372  AQQELIESMSHRLYLDKSINFIGKLLFGSD  401



>gb|AFW72544.1| vacuolar processing enzyme 1 [Zea mays]
Length=500

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 144/211 (68%), Gaps = 11/211 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIY+EACESGS+FEGL+P D NIY  TAS A+E+S G YCPG +P PP EY T
Sbjct  207  SNSYAKMVIYIEACESGSIFEGLMPEDLNIYVTTASNAEESSWGTYCPGMEPPPPSEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYE------NVKKRTWN-NGTGGGSHVMEYGSMD  342
            CLGDL+S+SWMEDS+ +N K+ETI  QYE       VKKRT + N  G GSHVMEYG   
Sbjct  267  CLGDLYSVSWMEDSETNNLKEETIKEQYEVSQHCAQVKKRTSDFNSYGAGSHVMEYGDKT  326

Query  343  LRKDKLSKYQGYVLPPINVATIPM---PGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKV  513
             + +KL  YQG+     NV    +       V+QRDA++L+LW++Y+ L  EKSE K +V
Sbjct  327  FKGEKLYLYQGFDPANANVTNKLLWSGQEAVVNQRDADILFLWKRYELL-HEKSEEKQEV  385

Query  514  LKEMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            L+E++  ++ R ++D S++ IG  LFG EK 
Sbjct  386  LREITGTVRHRKHLDNSINFIGKLLFGAEKG  416



>emb|CAC18100.1| putative legumain [Zea mays]
Length=485

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  196  AGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY  VK RT    T   GSHVM+YGS++L    L
Sbjct  256  CLGDLYSVAWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLELNVKHL  315

Query  361  SKYQGYVLP-----PINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G          I   ++P     V+QRDA+L+Y W+KY++L D   E K++  +E+
Sbjct  316  FSYIGTNPANDDNTSIEDNSLPSFSKAVNQRDADLVYFWQKYRKLADSSHE-KNEARREL  374

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTE  600
             E M  R+++D SV+ IG  LFG+E
Sbjct  375  LEVMAHRSHVDSSVELIGSLLFGSE  399



>gb|ACG34144.1| vacuolar processing enzyme precursor [Zea mays]
Length=486

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 141/207 (68%), Gaps = 11/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  197  AGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  256

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY+ VK RT  + T   GSHVM+YG+++L   +L
Sbjct  257  CLGDLYSVAWMEDSDFHNLRTESLKQQYKLVKDRTAVHDTFSYGSHVMQYGALELNVQRL  316

Query  361  SKYQGYVLPPINVA-------TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N         ++P     V+QRDA+L+Y W+KY++L D  S  K +  K
Sbjct  317  FSYIG--TDPANDGNTFIEDNSLPSFSKAVNQRDADLVYFWQKYRKLADS-SPPKSEARK  373

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTE  600
            E+ E M  R+++D SV+ IG  LFG+E
Sbjct  374  ELLEVMAHRSHVDSSVELIGSLLFGSE  400



>ref|NP_001105613.1| LOC542609 precursor [Zea mays]
 gb|AAD04883.1| C13 endopeptidase NP1 precursor [Zea mays]
Length=485

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 139/206 (67%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  196  AGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY  VK RT    T   GSHVM+YGS++L    L
Sbjct  256  CLGDLYSVAWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLELNVKHL  315

Query  361  SKYQGYVLPP------INVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              Y G   P       I   ++P     V+QRDA+L+Y W+KY++L D   E K++  +E
Sbjct  316  FSYIG-TNPANDDNTFIEDNSLPSLSKAVNQRDADLVYFWQKYRKLADSSPE-KNEARRE  373

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTE  600
            + E M  R+++D SV+ IG  LFG+E
Sbjct  374  LLEVMAHRSHVDSSVELIGSLLFGSE  399



>ref|NP_001236564.1| vacuolar processing enzyme 2 precursor [Glycine max]
 gb|AAL58570.1| vacuolar processing enzyme 2 [Glycine max]
Length=482

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 137/206 (67%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP D NIYA TAS A+E+S G YCPG  P PPPEYTT
Sbjct  194  SGTYKNLVFYLEACESGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYTT  253

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSDRHN + ET+  QY+ VK+RT +  +  GSHVM+YG + L +D L 
Sbjct  254  CLGDLYSVAWMEDSDRHNLRTETLHQQYKLVKERTISGDSYYGSHVMQYGDVGLSRDVLF  313

Query  364  KYQGYVLPPINVATIP-----MPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N   +       P   V+QRDA+L++ W+K+++   E S  K+   K++ 
Sbjct  314  HYLGTDPANDNFTFVDENSLWSPSKPVNQRDADLIHFWDKFRK-APEGSLRKNTAQKQVL  372

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D SV  IG  LFG EK 
Sbjct  373  EAMSHRMHVDNSVKLIGKLLFGIEKG  398



>gb|EYU24761.1| hypothetical protein MIMGU_mgv1a005235mg [Erythranthe guttata]
Length=492

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIY+EACESGS+FEGL+P + NIY  TAS A+E+S G YCPG DP PPPEY T
Sbjct  204  SGTYKEMVIYIEACESGSVFEGLMPDNLNIYVTTASNAEESSWGTYCPGMDPPPPPEYIT  263

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI  QY+ VK+RT N N    GSHVMEYG+   + +KL
Sbjct  264  CLGDLYSVAWMEDSESHNLKRETIEQQYDQVKERTSNYNTYNAGSHVMEYGNTSFKWEKL  323

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              YQG+      LPP N   +      V+QRDA++L+LWE+YK++ D  ++ K + LK +
Sbjct  324  YLYQGFDPATENLPP-NGIKVKERMDVVNQRDADVLFLWERYKKMED-GTKAKAEFLKVI  381

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            +E M  R ++DGSVD IG  LFG +K 
Sbjct  382  TETMLHREHLDGSVDIIGLALFGPDKG  408



>ref|XP_010526156.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=496

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 134/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK MV Y+EACESGS+F+GLLP   NIYA TAS A+E+S G YCPG DP PPPEY T
Sbjct  208  SGTYKSMVFYLEACESGSIFQGLLPEGLNIYATTASNAEESSWGTYCPGEDPSPPPEYET  267

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDS  HN + E++  QYE VK+RT N G   GSHVM++G + L KD L 
Sbjct  268  CLGDLYSVAWMEDSGLHNLRTESLHQQYELVKRRTANVGAAYGSHVMQFGDIGLSKDHLY  327

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++ +P    +QRDA+L++ W+KY++   E S  K +  KE+ 
Sbjct  328  LYMGTNPANDNFTFVEENSLKLPSRVTNQRDADLVHFWDKYRK-APEGSVRKVQAQKEVL  386

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV  IG  LFG  K 
Sbjct  387  EAMAHRLHIDNSVKLIGKLLFGMIKG  412



>ref|XP_006296251.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
 gb|EOA29149.1| hypothetical protein CARUB_v10025418mg [Capsella rubella]
Length=481

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 137/205 (67%), Gaps = 7/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG DP PP EY T
Sbjct  193  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEDPSPPSEYET  252

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD+HN + E++  QYE VKKRT   G+  GSHV+E+G + L K+KL 
Sbjct  253  CLGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGSSYGSHVLEFGDIGLSKEKLV  312

Query  364  KYQGYVLPPINV------ATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
             Y G      N       +++ +P    +QRDA+L++ W+KY++   E S  K +  K++
Sbjct  313  LYMGTNPANENFTFVDENSSLRLPSRVTNQRDADLVHFWDKYRK-APEGSARKVEAQKQV  371

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTE  600
             E M  R ++D SV  IG  LFG E
Sbjct  372  LEAMSHRLHVDNSVLLIGKLLFGLE  396



>gb|ACQ91103.1| vacuolar processing enzyme a [Populus tomentosa]
Length=493

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 135/206 (66%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  205  SGTYKSLVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT +  +  GSHVM+YG + L K+ L 
Sbjct  265  CLGDLYSVAWMEDSDIHNLRTETLHQQYELVKRRTSDENSAYGSHVMQYGDVGLSKEDLF  324

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
            +Y G      N       ++  P   V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  325  QYMGTNPANDNFTFLEDNSLRPPSKAVNQRDADLVHFWAKYRK-APEGSSRKVEAQKQFV  383

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID S+  IG  LFG EKA
Sbjct  384  EAMSHRMHIDHSIKLIGKLLFGIEKA  409



>ref|XP_006371860.1| hypothetical protein POPTR_0018s04650g [Populus trichocarpa]
 gb|ERP49657.1| hypothetical protein POPTR_0018s04650g [Populus trichocarpa]
Length=478

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 136/208 (65%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG +P PPPEY T
Sbjct  201  SGTYKSLVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGENPSPPPEYET  260

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT N+ +  GSHVM+YG + L KD + 
Sbjct  261  CLGDLYSVAWMEDSDIHNLQTETLHQQYELVKRRTSNDNSPYGSHVMQYGDVGLSKDNIF  320

Query  364  KYQGYVLPPINVATIPMP-------GTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G    P N     M           V+QRDA+L++ W+KY++   E S  K +  K+
Sbjct  321  LYMG--TNPANDNFTFMDENLLRPRSKAVNQRDADLVHFWDKYRK-APEGSSRKVEAQKQ  377

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
              E M  R +ID S+  IG  LFG EKA
Sbjct  378  FVEAMSHRMHIDHSIKLIGKLLFGIEKA  405



>emb|CAB42655.1| putative preprolegumain [Vicia narbonensis]
Length=380

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 135/206 (66%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG +P PPPEY T
Sbjct  129  AGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGENPSPPPEYET  188

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CL DL+S++WMEDSD HN + ET+  QYE VK+RT N  +  GSHVM+YG ++L KD L 
Sbjct  189  CLADLYSVAWMEDSDIHNLQTETLHQQYELVKERTSNGNSNYGSHVMQYGDIELSKDSLF  248

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++  P   ++QRDA+L++ W+K+++   + S  K    KE+ 
Sbjct  249  LYLGSNPSNENFTFVGRNSLVPPSKAINQRDADLIHFWDKFRK-APQGSPRKAAAQKEVL  307

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID S+  +G  LFG +K 
Sbjct  308  EAMSHRMHIDDSIKLVGKLLFGMKKG  333



>ref|XP_002324151.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEF02716.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 136/208 (65%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG +P PPPEY T
Sbjct  201  SGTYKSLVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGENPSPPPEYET  260

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT N+ +  GSHVM+YG + L KD + 
Sbjct  261  CLGDLYSVAWMEDSDIHNLQTETLHQQYELVKRRTSNDNSPYGSHVMQYGDVGLSKDNIF  320

Query  364  KYQGYVLPPINVATIPMP-------GTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G    P N     M           V+QRDA+L++ W+KY++   E S  K +  K+
Sbjct  321  LYMG--TNPANDNFTFMDENLLRPRSKAVNQRDADLVHFWDKYRK-APEGSSRKVEAQKQ  377

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
              E M  R +ID S+  IG  LFG EKA
Sbjct  378  FVEAMSHRMHIDHSIKLIGKLLFGIEKA  405



>emb|CBI20614.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 138/207 (67%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTY  +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG DP PPPEY T
Sbjct  205  SGTYNSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDPSPPPEYET  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT N+ +  GSHVM+YG + L K+ L 
Sbjct  265  CLGDLYSVAWMEDSDVHNLRTETLRQQYELVKKRTANDNSVYGSHVMQYGDLGLNKEDLV  324

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y    ++  ++ +P   V+QRDA+L++ W+K+++   E S  K +  K+
Sbjct  325  LYMGTNPANDNYTF--VDNNSLRLPSKAVNQRDADLVHFWDKFRK-APEGSPRKAEAQKQ  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  R +ID ++  +G  LFG +K
Sbjct  382  FLEAMSHRTHIDHAIKLVGRLLFGMKK  408



>gb|EEE54813.1| hypothetical protein OsJ_02232 [Oryza sativa Japonica Group]
Length=503

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 140/206 (68%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+  N+YA TAS ADE+S G YCPG  P PPPEY T
Sbjct  214  AGTYKSLVFYLEACESGSIFEGLLPNGINVYATTASNADESSWGTYCPGEYPSPPPEYDT  273

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY  VK+RT    T   GSHVMEYGS++L    +
Sbjct  274  CLGDLYSVAWMEDSDVHNLRTESLKQQYNLVKERTSVQHTYYSGSHVMEYGSLELNAHHV  333

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W+KY++L  E S  K++  K++
Sbjct  334  FMYMGSNPANDNATFVEDNSLPSFSRAVNQRDADLVYFWQKYRKL-PESSPEKNEARKQL  392

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
             E M  R+++D SV+ IG+ LFG+E+
Sbjct  393  LEMMAHRSHVDNSVELIGNLLFGSEE  418



>ref|XP_009337146.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=495

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 133/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK MV Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  207  AGTYKSMVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYET  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN K ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  267  CLGDLYSVAWMEDSDIHNLKSETLRQQYELVKTRTANDNSGLGSHVMQYGDVGLSKNNLF  326

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+L++ W KY++   E S  K +  KE  
Sbjct  327  VYMGTNPANENFTFLGQNSLRPSSKAVNQRDADLVHFWHKYRK-APEGSPRKVQAQKEFV  385

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  386  EAMSHRMHIDETMKLIGKLLFGIEK  410



>emb|CAB64545.1| legumain-like protease [Zea mays]
Length=481

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 138/206 (67%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  192  AGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  251

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY  VK RT    T   GSHVM+YGS+ L    L
Sbjct  252  CLGDLYSVAWMEDSDFHNLRTESLKQQYNLVKDRTAVQDTFSYGSHVMQYGSLGLNVKHL  311

Query  361  SKYQGYVLPP------INVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              Y G   P       I   ++P     V+QRDA+L+Y W+KY++L D   E K++  +E
Sbjct  312  FSYIG-TNPANDDNTFIEDNSLPSFSKAVNQRDADLVYFWQKYRKLADSSPE-KNEARRE  369

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTE  600
            + E M  R+++D SV+ IG  LFG+E
Sbjct  370  LLEVMAHRSHVDSSVELIGSLLFGSE  395



>ref|NP_001238297.1| seed maturation protein PM40 precursor [Glycine max]
 gb|AAF89646.1|AF169019_1 seed maturation protein PM40 [Glycine max]
Length=496

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 142/207 (69%), Gaps = 9/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGS-MFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYT  180
            +G YKKMVIYVEACESG+ + +G++P D  IY  TAS A ENS G YCPG DP PPPEY 
Sbjct  207  SGGYKKMVIYVEACESGNHVLKGIMPKDLQIYVTTASNAQENSWGTYCPGMDPSPPPEYI  266

Query  181  TCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDK  357
            TCLGDL+S++WMEDS+ HN K+E++  QY++VK+RT N N    GSHVM+YG  ++  +K
Sbjct  267  TCLGDLYSVAWMEDSETHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITAEK  326

Query  358  LSKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            L  YQG+       PP N   +      V+QRDAEL ++W+ Y+R  + + E K  +LK+
Sbjct  327  LYLYQGFDPAAVNFPPQN-GRLETKMEVVNQRDAELFFMWQMYQR-SNHQPEKKTDILKQ  384

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++E ++ R +IDGSV+ IG  L+G  K
Sbjct  385  IAETVKHRKHIDGSVELIGVLLYGPGK  411



>ref|XP_002276759.2| PREDICTED: vacuolar-processing enzyme [Vitis vinifera]
Length=526

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 138/207 (67%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTY  +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG DP PPPEY T
Sbjct  238  SGTYNSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDPSPPPEYET  297

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT N+ +  GSHVM+YG + L K+ L 
Sbjct  298  CLGDLYSVAWMEDSDVHNLRTETLRQQYELVKKRTANDNSVYGSHVMQYGDLGLNKEDLV  357

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y    ++  ++ +P   V+QRDA+L++ W+K+++   E S  K +  K+
Sbjct  358  LYMGTNPANDNYTF--VDNNSLRLPSKAVNQRDADLVHFWDKFRK-APEGSPRKAEAQKQ  414

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  R +ID ++  +G  LFG +K
Sbjct  415  FLEAMSHRTHIDHAIKLVGRLLFGMKK  441



>ref|NP_001043344.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAA84650.1| asparaginyl endopeptidase [Oryza sativa]
 dbj|BAB85400.1| putative C13 endopeptidase NP1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF05258.1| Os01g0559600 [Oryza sativa Japonica Group]
 dbj|BAG90492.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70891.1| hypothetical protein OsI_02429 [Oryza sativa Indica Group]
Length=501

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 140/206 (68%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+  N+YA TAS ADE+S G YCPG  P PPPEY T
Sbjct  212  AGTYKSLVFYLEACESGSIFEGLLPNGINVYATTASNADESSWGTYCPGEYPSPPPEYDT  271

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY  VK+RT    T   GSHVMEYGS++L    +
Sbjct  272  CLGDLYSVAWMEDSDVHNLRTESLKQQYNLVKERTSVQHTYYSGSHVMEYGSLELNAHHV  331

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W+KY++L  E S  K++  K++
Sbjct  332  FMYMGSNPANDNATFVEDNSLPSFSRAVNQRDADLVYFWQKYRKL-PESSPEKNEARKQL  390

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
             E M  R+++D SV+ IG+ LFG+E+
Sbjct  391  LEMMAHRSHVDNSVELIGNLLFGSEE  416



>emb|CAN70603.1| hypothetical protein VITISV_040193 [Vitis vinifera]
Length=493

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 138/208 (66%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTY  +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG DP PPPEY T
Sbjct  205  SGTYNSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDPSPPPEYET  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT N+ +  GSHVM+YG + L K+ L 
Sbjct  265  CLGDLYSVAWMEDSDVHNLRTETLRQQYELVKKRTANDNSVYGSHVMQYGDLGLNKEDLV  324

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y    ++  ++ +P   V+QRDA+L++ W+K+++   E S  K +  K+
Sbjct  325  LYMGTNPANDNYTF--VDNNSLRLPSKAVNQRDADLVHFWDKFRK-APEGSPRKAEAQKQ  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
              E M  R +ID ++  +G  LFG +K 
Sbjct  382  FLEAMSHRTHIDHAIKLVGRLLFGMKKG  409



>ref|XP_008377927.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
 ref|XP_008357361.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=492

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 132/205 (64%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK MV Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSMVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYET  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN K ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEDSDIHNLKSETLHQQYELVKTRTANDNSGFGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+L++ W KY +   E S  K +  KE  
Sbjct  326  VYMGTNPANENFTFLGQNSLRPSSKAVNQRDADLVHFWHKYSK-APEGSPRKVQAQKEFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  385  EAMSHRMHIDETMKLIGKLLFGIEK  409



>gb|KHN37015.1| Vacuolar-processing enzyme [Glycine soja]
Length=474

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 136/206 (66%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP D NIYA TAS A+E+S G YCPG  P PPPEY+T
Sbjct  186  SGTYKNLVFYLEACESGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYST  245

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSDRHN + ET+  QY+ VK+RT +  +  GSHVM+YG + L  D L 
Sbjct  246  CLGDLYSVAWMEDSDRHNLRTETLHQQYKLVKERTISGDSYYGSHVMQYGDVGLSSDVLF  305

Query  364  KYQGYVLPPINVATIP-----MPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N   +       P   V+QRDA+L++ W+K+++   E S  K+   K++ 
Sbjct  306  HYLGTDPANDNFTFVDENSLWSPSKPVNQRDADLIHFWDKFRK-APEGSLRKNAAQKQVL  364

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D SV  IG  LFG EK 
Sbjct  365  EAMSHRMHVDNSVKLIGKLLFGIEKG  390



>ref|XP_003550283.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=481

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 136/206 (66%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP D NIYA TAS A+E+S G YCPG  P PPPEY+T
Sbjct  193  SGTYKNLVFYLEACESGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYST  252

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSDRHN + ET+  QY+ VK+RT +  +  GSHVM+YG + L  D L 
Sbjct  253  CLGDLYSVAWMEDSDRHNLRTETLHQQYKLVKERTISGDSYYGSHVMQYGDVRLSSDVLF  312

Query  364  KYQGYVLPPINVATIP-----MPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N   +       P   V+QRDA+L++ W+K+++   E S  K+   K++ 
Sbjct  313  HYLGTDPANDNFTFVDENSLWSPSKPVNQRDADLIHFWDKFRK-APEGSLRKNAAQKQVL  371

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D SV  IG  LFG EK 
Sbjct  372  EAMSHRMHVDNSVKLIGKLLFGIEKG  397



>ref|XP_009783032.1| PREDICTED: vacuolar-processing enzyme-like, partial [Nicotiana 
sylvestris]
Length=331

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 136/207 (66%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  43   SGTYKHLVFYIEACESGSIFEGLLPEGLNIYATTASNAEEDSWGTYCPGDYPGPPPEYQT  102

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+++SWMEDS++HN ++ET+  QYE VK+RT N+     SHVM+YG + L  D LS
Sbjct  103  CLGDLYAVSWMEDSEKHNLQRETLGMQYELVKRRTANSFPYASSHVMQYGDLKLMDDPLS  162

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y     N +   +    V+QRDA+LL+ W+K+ +   + S  K +  K+
Sbjct  163  LYMGTNPANDNYTFLDENSSL--LSAKPVNQRDADLLHFWDKFLK-APQGSIRKIEAQKQ  219

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++E M  R +ID S+  +G  LFG EK
Sbjct  220  LTEAMSHRMHIDDSIALVGKLLFGIEK  246



>ref|XP_011019533.1| PREDICTED: vacuolar-processing enzyme isoform X2 [Populus euphratica]
Length=395

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 133/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  107  SGTYKSLVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  166

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT  + +  GSHVM+YG + L KD L 
Sbjct  167  CLGDLYSVAWMEDSDMHNLRTETLHQQYELVKRRTSEDNSPYGSHVMQYGDVGLSKDDLF  226

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  227  LYMGTNPANDNFTFVEDNSLRPHSKAVNQRDADLVHFWAKYRK-APEGSTRKIEAQKQFV  285

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID S+  IG  LFG EKA
Sbjct  286  EAMSHRMHIDHSIKLIGKLLFGIEKA  311



>gb|KJB65608.1| hypothetical protein B456_010G103000 [Gossypium raimondii]
Length=302

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 128/198 (65%), Gaps = 6/198 (3%)
 Frame = +1

Query  25   VIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCLGDLFS  204
            V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY TCLGDL+S
Sbjct  21   VFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYETCLGDLYS  80

Query  205  ISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSKYQGY--  378
            ++WMEDSD HN + ET+  QYE VKKRT N  +  GSHVM+YG + L KD L  Y G   
Sbjct  81   VAWMEDSDMHNLRTETLHQQYELVKKRTINGNSAYGSHVMQYGDVGLSKDSLFAYLGTNP  140

Query  379  ---VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKMQVRA  549
                   ++  ++  P   V+QRDA+L++ W KY++   E S  K +  K+  E M  R 
Sbjct  141  ANDNFTFVDENSLVPPTKAVNQRDADLVHFWYKYRK-APEGSVRKTEAQKQFVEAMSHRM  199

Query  550  YIDGSVDAIGDYLFGTEK  603
            +ID SV  IG  LFG E+
Sbjct  200  HIDHSVKLIGKLLFGIER  217



>ref|XP_006646004.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=516

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 139/206 (67%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP D N+YA TAS ADE+S G YCPG  P PPPEY T
Sbjct  227  AGTYKSLVFYLEACESGSIFEGLLPDDINVYATTASNADESSWGTYCPGEYPSPPPEYDT  286

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMED D HN + E++  QY  VK+RT    T   GSHVM+YGS++L    L
Sbjct  287  CLGDLYSVAWMEDCDVHNLRTESLRQQYNLVKERTSVQHTYDSGSHVMQYGSIELNAHHL  346

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W+KY++L  E S  K++  K++
Sbjct  347  FLYMGSNPANDNSTFVEDNSLPSFSRAVNQRDADLVYFWQKYRKLA-EGSPEKNEARKQL  405

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
             E M  R+++D SV+ IG+ LFG+E+
Sbjct  406  LEMMAHRSHVDNSVELIGNLLFGSEE  431



>ref|XP_010417372.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Camelina 
sativa]
Length=484

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 135/206 (66%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A E+S G YCPG DP PP EY T
Sbjct  196  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYET  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD+HN + E++  QYE VKKRT   G+  GSHV+E+G + L K+KL 
Sbjct  256  CLGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGSSYGSHVLEFGDIGLSKEKLV  315

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       +     N +  P P    +QRDA+L++ W+KY++   E S  K +  K+
Sbjct  316  LYMGTNPANENFTFVDENASLRP-PSRVTNQRDADLVHFWDKYRK-APEGSARKVEAQKQ  373

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTE  600
            + E M  R ++D SV  IG  LFG E
Sbjct  374  VIEAMSHRLHVDNSVLLIGKLLFGLE  399



>gb|AAF69014.1|AF260827_1 cysteine protease [Ipomoea batatas]
Length=492

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 130/207 (63%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG YK +V Y+EACESGS+FEG+LP D NIYA TAS A E+S G YCPG  P PPPEY T
Sbjct  202  AGAYKSLVFYLEACESGSIFEGILPKDINIYATTASNAIESSWGTYCPGEYPSPPPEYET  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SI+WMEDSD HN + E++  QY  VK RT N  T  GSHVM+YG ++L  D L 
Sbjct  262  CLGDLYSIAWMEDSDIHNLRTESLKQQYNLVKDRTLNGNTAYGSHVMQYGDLELNADSLF  321

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       +         +  P   V+QRDA+LL+ W+K+ R   E S  K +  K+
Sbjct  322  MYMGTNPANENFTFVDEKSLKLSAPRRAVNQRDADLLHFWDKF-RNAPEGSARKSEAQKQ  380

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
             +E +  R ++D S+  +G  LFG EK
Sbjct  381  FTEAITHRTHLDNSIALVGKLLFGMEK  407



>gb|AGC94757.1| vacuolar processing enzyme [Malus sikkimensis]
Length=494

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 134/207 (65%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEDSDVHNLRSETLHQQYELVKTRTANDNSGFGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPIN-------VATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G    P N         ++      V+QRDA+LL+ W KY++   E S  K +  K+
Sbjct  326  VYMG--TNPANDNHTFLGENSLRPSSKAVNQRDADLLHFWHKYRK-APEGSARKIQAQKD  382

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  R +ID ++  IG  LFG EK
Sbjct  383  FVEAMSHRMHIDQTMKLIGKLLFGIEK  409



>ref|XP_008393660.1| PREDICTED: vacuolar-processing enzyme [Malus domestica]
 ref|XP_008360960.1| PREDICTED: vacuolar-processing enzyme-like [Malus domestica]
Length=494

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 133/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEDSDVHNLRSETLHQQYELVKMRTANDNSGFGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+LL+ W KY++   E S  K +  K+  
Sbjct  326  VYMGTNPANDNYTFLGENSLRPSSKAVNQRDADLLHFWHKYRK-APEGSARKIQAQKDFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  385  EAMSHRMHIDQTMKLIGKLLFGIEK  409



>emb|CDP09908.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 144/206 (70%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK+MVIYVEACESGS FEGL+P + NIY  TAS A+E+S   YCP  DP  PPE+  
Sbjct  212  SGTYKEMVIYVEACESGSFFEGLMPENLNIYVTTASNAEESSYATYCPDMDP-SPPEHFP  270

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETI  QY+ VK+RT N+ T   GSHVMEYG+  +  +KL
Sbjct  271  CLGDLYSVAWMEDSESHNLKRETIVQQYKKVKERTSNHHTYDAGSHVMEYGNKSIHAEKL  330

Query  361  SKYQGYVLP----PINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
              YQG+       P N   I      V+QR A+L+++W++YK++ D  +E K ++LK+++
Sbjct  331  YLYQGFDPATENYPANQIDIHPRMDVVNQRSADLVFMWDRYKKMEDGSAE-KGELLKQIT  389

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + M  R ++DGS+D IG +LFG E+ 
Sbjct  390  DTMLHRNHLDGSMDIIGAFLFGPERG  415



>ref|XP_007012236.1| Gamma vacuolar processing enzyme [Theobroma cacao]
 gb|EOY29855.1| Gamma vacuolar processing enzyme [Theobroma cacao]
Length=487

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 135/206 (66%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  199  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT N  +  GSHVM+YG + L KD + 
Sbjct  259  CLGDLYSVAWMEDSDIHNLQTETLHQQYELVKRRTINGNSAYGSHVMQYGDIGLSKDIVF  318

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W+KY++  D  S  K +  K+  
Sbjct  319  VYLGTNPANDNFTFVDENSLQPPTKAVNQRDADLVHFWDKYRKAPD-GSVRKLEAQKQFV  377

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID S+  IG  LFG EK 
Sbjct  378  EAMSHRMHIDNSMKLIGKLLFGIEKG  403



>gb|EYU29312.1| hypothetical protein MIMGU_mgv1a005315mg [Erythranthe guttata]
Length=489

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 139/207 (67%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG +P PPPEY T
Sbjct  201  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGDNPSPPPEYET  260

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QY+ VK+RT N  +  GSHVM++G + L  D L 
Sbjct  261  CLGDLYSVAWMEDSDVHNLRTETLRQQYQLVKQRTANQNSYYGSHVMQFGDLKLSVDNLF  320

Query  364  KYQGYVLPPIN------VATIPMPGT-TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G    P N      V+    P + TV+QRDA+L++ W+K+++   + S  K +  K+
Sbjct  321  MYMG--TNPANDNFTYAVSNSLRPSSKTVNQRDADLIHFWDKFRK-APQGSTRKYEAQKD  377

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++E M  R +ID S+  IG  LFG +K
Sbjct  378  LAEAMAHRTHIDNSIKLIGKLLFGFQK  404



>ref|XP_004291017.1| PREDICTED: vacuolar-processing enzyme [Fragaria vesca subsp. 
vesca]
Length=494

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 133/207 (64%), Gaps = 9/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTY+ +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  205  AGTYESLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYET  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK RT ++ +  GSHVM+YG + L K+ L 
Sbjct  265  CLGDLYSVAWMEDSDIHNLRSETLHQQYELVKSRTASDNSPYGSHVMQYGDIPLSKNNLF  324

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y   P N    P     V+QRDA+L++ W KY++   E S  K +  KE
Sbjct  325  MYMGTNPANDNYTFMPQNFLR-PSSSKAVNQRDADLVHFWHKYRK-APEGSARKAQAQKE  382

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  R +ID SV  IG  LFG +K
Sbjct  383  FLEAMSHRMHIDESVKLIGKLLFGIKK  409



>gb|EMS54452.1| Vacuolar-processing enzyme [Triticum urartu]
Length=422

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 137/205 (67%), Gaps = 11/205 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+YK +V Y+EACE+GS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  133  AGSYKSLVFYLEACEAGSVFEGLLPNDIGVYATTASDAEESSWGTYCPGEYPSPPPEYDT  192

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY+ VKKRT   +    GSHVM+YGS+DL   +L
Sbjct  193  CLGDLYSISWMEDSDVHNLRTESLKQQYDLVKKRTAAQDSYSYGSHVMQYGSLDLNAQQL  252

Query  361  SKYQGYVLPPINVAT-------IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N  T       +P     V+QRDA+L+Y W KY++L  E S  K+   K
Sbjct  253  FLYIGS--NPANNNTTFVEDNSLPSFSRAVNQRDADLVYFWHKYRKLA-ESSPEKNDARK  309

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFG  594
            ++ E    R++ID SV+ IG+ LFG
Sbjct  310  QLLEMTSHRSHIDNSVELIGNLLFG  334



>dbj|BAJ95226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 136/204 (67%), Gaps = 7/204 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACE+GS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  200  AGTYKSLVFYLEACEAGSVFEGLLPNDIGVYATTASNAEESSWGAYCPGEYPSPPPEYDT  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY  VKKRT   +    GSHVM+YGS+DL    L
Sbjct  260  CLGDLYSISWMEDSDVHNLRTESLKEQYNLVKKRTAAQDSYSYGSHVMQYGSLDLNAQHL  319

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W KY++L  E S  K+   K++
Sbjct  320  FLYIGSNPANDNATFVEENSLPSFSRAVNQRDADLVYFWHKYRKLA-ESSPEKNNARKQL  378

Query  526  SEKMQVRAYIDGSVDAIGDYLFGT  597
             E M  R+++D SV+ IG+ LFG+
Sbjct  379  LEMMGHRSHVDNSVELIGNLLFGS  402



>ref|XP_010429610.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X1 [Camelina sativa]
Length=484

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 135/206 (66%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A E+S G YCPG DP PP EY T
Sbjct  196  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYET  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD+HN + E++  QYE VKKRT   G+  GSHV+E+G + L K+KL 
Sbjct  256  CLGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGSSYGSHVLEFGDIGLSKEKLV  315

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       +     N+   P P    +QRDA+L++ W+KY++   E S  K +  K+
Sbjct  316  LYMGTNPANENFTFVDENLLLRP-PSRVTNQRDADLVHFWDKYRK-APEGSARKVEAQKQ  373

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTE  600
            + E M  R ++D SV  IG  LFG E
Sbjct  374  VIEAMSHRLHVDNSVLLIGKLLFGLE  399



>ref|XP_002880728.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56987.1| alpha-vacuolar processing enzyme [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 134/204 (66%), Gaps = 6/204 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A E+S G YCPG DP PP EY T
Sbjct  192  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYET  251

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VKKRT  +G   GSHVME+G + L K+KL 
Sbjct  252  CLGDLYSVAWMEDSDIHNLQTETLHQQYELVKKRTAGSGKSFGSHVMEFGDIGLSKEKLV  311

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          +N  ++  P    +QRDA+L++ W+KY++   E S  K +  K++ 
Sbjct  312  LYMGTNPANENFTFVNENSLRPPSRVTNQRDADLVHFWDKYRK-APEGSARKVEAQKQVL  370

Query  529  EKMQVRAYIDGSVDAIGDYLFGTE  600
            E M  R ++D S+  IG  LFG +
Sbjct  371  EAMSHRLHVDNSILLIGKLLFGLD  394



>ref|NP_001105119.1| legumain-like protease precursor [Zea mays]
 emb|CAB64544.1| legumain-like protease [Zea mays]
Length=486

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 138/207 (67%), Gaps = 11/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP+D N+YA TAS A+E+S G YCPG  P PPPEY T
Sbjct  197  AGTYKSLVFYLEACESGSIFEGLLPNDINVYATTASNAEESSWGTYCPGEFPSPPPEYDT  256

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGG-GSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + E++  QY+ VK RT  + T   GSHVM+YG+++L    L
Sbjct  257  CLGDLYSVAWMEDSDFHNLRTESLKQQYKLVKDRTAVHDTFSYGSHVMQYGALELNVQHL  316

Query  361  SKYQGYVLPPINVA-------TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N         ++P     V+QRDA+L+Y W+KY++  D     K +  K
Sbjct  317  FSYIG--TDPANDGNTFIEDNSLPSFSKAVNQRDADLVYFWQKYRKFADSP-PAKSEARK  373

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTE  600
            E+ E M  R+++D SV+ IG  LFG+E
Sbjct  374  ELLEVMAHRSHVDSSVELIGSLLFGSE  400



>gb|AGC94756.1| vacuolar processing enzyme [Malus sieversii]
Length=494

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 133/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEDSDVHNLRSETLHQQYELVKMRTANDNSGFGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+LL+ W KY++   E S  K +  K+  
Sbjct  326  VYMGTNPANDNYTFLGENSLRPSSKAVNQRDADLLHFWHKYRK-APEGSARKIQAQKDFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  385  EVMSHRMHIDQTMKLIGKLLFGIEK  409



>gb|EMT02419.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=543

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTY+ +V Y+EACE+GS+FEGLLP+D ++Y  TAS A+E+S G YCPG  P PPPEY T
Sbjct  254  AGTYRSLVFYLEACEAGSVFEGLLPNDISVYTTTASNAEESSWGTYCPGEYPSPPPEYDT  313

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY+ VKKRT   +    GSHVM+YGS+DL   +L
Sbjct  314  CLGDLYSISWMEDSDVHNLRTESLKQQYDLVKKRTAAQDSYNYGSHVMQYGSLDLNAQQL  373

Query  361  SKYQGYVLPPINVAT-------IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G    P N  T       +P     V+QRDA+L+Y W KY++L  E S  K+   K
Sbjct  374  FLYIGS--NPANNKTTFVEDNSLPSFSRVVNQRDADLVYFWHKYRKLA-ESSPEKNDARK  430

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGT  597
            ++ E M  R++ID SV+ IG+ LFG+
Sbjct  431  QLLEMMSHRSHIDNSVELIGNLLFGS  456



>gb|EMT06287.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=424

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 136/203 (67%), Gaps = 7/203 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACE+GS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PP EY T
Sbjct  135  AGTYKSLVFYLEACEAGSVFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPSEYDT  194

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY+ VKKRT   +    GSHVM+YGS+DL    L
Sbjct  195  CLGDLYSISWMEDSDVHNLRTESLKQQYDLVKKRTAAQDSYSYGSHVMQYGSLDLNDQHL  254

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W KY++L +  +E K+   K++
Sbjct  255  FLYIGSNPANDNTTFVEDNSLPSFSRAVNQRDADLVYFWRKYQKLAESSTE-KNDARKQL  313

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
             E M  R++ID SV+ IG+ LFG
Sbjct  314  LEMMGHRSHIDNSVELIGNLLFG  336



>ref|XP_009361606.1| PREDICTED: vacuolar-processing enzyme-like [Pyrus x bretschneideri]
Length=494

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 132/205 (64%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYET  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK RT N+  G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEDSDIHNLRSETLHQQYELVKTRTANDNYGFGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+LL+ W KY++   E S  K +  K+  
Sbjct  326  VYMGTNPANDNYTFLGENSLRPSSKAVNQRDADLLHFWHKYRK-APEGSARKVQAQKDFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  385  EAMSHRMHIDQTMKLIGKLLFGIEK  409



>gb|AGC94758.1| vacuolar processing enzyme [Malus hupehensis]
Length=494

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 132/205 (64%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTY+ +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYRSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK R  N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEDSDVHNLRSETLHQQYELVKTRAANDNSGSGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+LL+ W KY++   E S  K +  K+  
Sbjct  326  VYMGTNPANDNYTFLGENSLRPSSKAVNQRDADLLHFWHKYRK-APEGSARKIQAQKDFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  385  EAMSHRMHIDQTMKLIGKLLFGIEK  409



>dbj|BAA76745.1| asparaginyl endopeptidase (VmPE-1A) [Vigna mungo]
Length=482

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 140/206 (68%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACE+GS+FEGLLP D NIYA TAS A+E+S G YCPG  P PPPEY+T
Sbjct  195  SGTYKNLVFYLEACEAGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYST  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSDRHN + E++  QY+ VK RT + G   GSHVM+YG ++  KD L 
Sbjct  255  CLGDLYSVAWMEDSDRHNLRTESLHQQYKVVKDRTLSGGW-YGSHVMQYGDVEFSKDALF  313

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G       L  ++  ++    T V+QRDA+L++ W K+++   E S  K++  K++ 
Sbjct  314  LYLGTDPANDNLTFVDENSLWSSSTAVNQRDADLVHFWHKFRK-APEGSPKKNEARKQVL  372

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV  +G  LFG EKA
Sbjct  373  EVMSHRMHIDDSVKLVGKLLFGFEKA  398



>gb|AAK15049.1|AF238384_1 asparaginyl endopeptidase [Vigna radiata]
Length=483

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 140/206 (68%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACE+GS+FEGLLP D NIYA TAS A+E+S G YCPG  P PPPEY+T
Sbjct  196  SGTYKNLVFYLEACEAGSIFEGLLPEDINIYATTASNAEESSWGTYCPGEYPSPPPEYST  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSDRHN + E++  QY+ VK RT + G   GSHVM+YG ++  KD L 
Sbjct  256  CLGDLYSVAWMEDSDRHNLRTESLHQQYKVVKDRTLSGGW-YGSHVMQYGDVEFSKDTLF  314

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G       L  ++  ++    T V+QRDA+L++ W K+++   E S  K++  K++ 
Sbjct  315  LYLGTDPANDNLTFVDENSLWSSSTAVNQRDADLVHFWHKFRK-APEGSPKKNEARKQVL  373

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV  +G  LFG EKA
Sbjct  374  EVMSHRMHIDDSVKLVGKLLFGFEKA  399



>gb|KJB06487.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=487

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 135/206 (66%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A E+S G YCPG  P PPPEY T
Sbjct  199  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAVESSWGTYCPGEYPSPPPEYET  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN +KET+  QYE VK+RT N  +  GSHVM++G + +  D L 
Sbjct  259  CLGDLYSVAWMEDSDIHNLRKETLHQQYEFVKRRTINGNSAYGSHVMQFGDIGISMDNLF  318

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          I+  ++  P   V+QRDA+L++ W+KY++  D  S  K +  K++ 
Sbjct  319  TYLGTNPANDNFKFIDENSLLPPTKAVNQRDADLVHFWDKYRKAPD-GSVRKVEAQKQVM  377

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D S+  IG  LFG E+ 
Sbjct  378  EAMSHRMHVDNSIQLIGKLLFGVERG  403



>ref|XP_010472621.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like [Camelina 
sativa]
Length=485

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 134/206 (65%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +  Y+EACESGS+FEGLLP   NIYA TAS A E+S G YCPG DP PP EY T
Sbjct  197  SGTYKSLAFYLEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYET  256

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD+HN + E++  QYE VKKRT   G+  GSHV+E+G + L K+KL 
Sbjct  257  CLGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGSSYGSHVLEFGDIGLSKEKLV  316

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       +     N+   P P    +QRDA+L++ W+KY++   E S  K +  K+
Sbjct  317  LYMGTNPANENFTFVDENLLLRP-PSRVTNQRDADLVHFWDKYRK-APEGSARKVEAQKQ  374

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTE  600
            + E M  R ++D SV  IG  LFG E
Sbjct  375  VIEAMSHRLHVDNSVLLIGKLLFGLE  400



>ref|XP_002308580.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
 gb|EEE92103.1| asparaginyl endopeptidase family protein [Populus trichocarpa]
Length=493

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 135/208 (65%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  205  SGTYKSLVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT  + +  GSHVM+YG + L KD L 
Sbjct  265  CLGDLYSVAWMEDSDIHNLRTETLHQQYELVKRRTSYDNSPYGSHVMQYGDVGLSKDDLF  324

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            +Y G       Y     N  ++      V+QRDA+L++ W KY++   E S  K +  K+
Sbjct  325  QYMGTNPANDNYTFVEEN--SLRPHSKVVNQRDADLVHFWTKYRK-APEGSSRKVEAQKQ  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
              E M  R +ID S+  IG  LFG EKA
Sbjct  382  FVEAMSHRMHIDHSIKLIGKLLFGIEKA  409



>gb|KHG30636.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=488

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 135/206 (66%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A E+S G YCPG  P PPPEY T
Sbjct  200  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAVESSWGTYCPGEYPSPPPEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN +KET+  QYE VK+RT N  +  GSHVM++G + +  D L 
Sbjct  260  CLGDLYSVAWMEDSDIHNLRKETLHQQYELVKRRTINGNSAYGSHVMQFGDIGISMDNLF  319

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W+KY++  D  S  K +  K++ 
Sbjct  320  TYLGTNPANDNFKSVDENSLLPPTKAVNQRDADLVHFWDKYRKAPD-GSVRKVEAQKQVM  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D S+  IG  LFG E+ 
Sbjct  379  EAMSHRMHVDNSIQLIGKLLFGVERG  404



>ref|XP_011019532.1| PREDICTED: vacuolar-processing enzyme isoform X1 [Populus euphratica]
Length=493

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 133/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  205  SGTYKSLVFYLEACESGSIFEGLLPQGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT  + +  GSHVM+YG + L KD L 
Sbjct  265  CLGDLYSVAWMEDSDMHNLRTETLHQQYELVKRRTSEDNSPYGSHVMQYGDVGLSKDDLF  324

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  325  LYMGTNPANDNFTFVEDNSLRPHSKAVNQRDADLVHFWAKYRK-APEGSTRKIEAQKQFV  383

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID S+  IG  LFG EKA
Sbjct  384  EAMSHRMHIDHSIKLIGKLLFGIEKA  409



>gb|ACR24644.1| vacuolar processing enzyme [Malus hupehensis var. mengshanensis]
Length=494

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 131/205 (64%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYXT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S+ WMEDSD HN + ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVVWMEDSDVHNLRSETLHQQYELVKMRTANDNSGFGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+LL  W KY++   E S  K +  K+  
Sbjct  326  VYMGTNPANDNYTFLGENSLRPSSKAVNQRDADLLRFWHKYRK-APEGSARKIQAQKDFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  385  EAMSHRMHIDQTMKLIGKLLFGIEK  409



>gb|AFK40405.1| unknown [Lotus japonicus]
Length=369

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 144/208 (69%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG YK+MVIYVEACESGS+FEG++P D N+Y  TAS A E+S G YCPG DP PPPEY T
Sbjct  81   AGGYKEMVIYVEACESGSVFEGIMPKDLNVYVTTASNAQESSWGTYCPGMDPPPPPEYIT  140

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ET+  QY+ VKKRT N N    GSHVMEYG  ++  +KL
Sbjct  141  CLGDLYSVAWMEDSETHNLKRETVEQQYQWVKKRTSNFNNYAIGSHVMEYGDTNITAEKL  200

Query  361  SKYQGYVLPPINVATIPMPGT------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              +QG+   P  V  +P  G        ++QRDAEL  +WE YKR    + E K ++L++
Sbjct  201  YVFQGF--DPATVNFLPHNGRLEAKMGIINQRDAELYSMWELYKR-SYYQPEKKREILEQ  257

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + E ++ R ++DGS++ IG++L+G  K 
Sbjct  258  IEETVKHRNHLDGSMELIGNFLYGPGKG  285



>emb|CBX26639.1| vacuolar processing enzyme 2c [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 136/201 (68%), Gaps = 5/201 (2%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGLLP D NIY  TAS A ENS G YCPG    PP EY TC+
Sbjct  213  SYSKMIIYVEACESGSIFEGLLPEDLNIYVTTASNAVENSWGAYCPGMKSSPPTEYDTCI  272

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKLSK  366
            GD++S+SWMEDS+ HN KKET+  QYE VK RT  +     GSHVMEYG    + +KL  
Sbjct  273  GDIYSVSWMEDSETHNLKKETLKQQYEVVKSRTSKSKEFDKGSHVMEYGDKTFKDEKLFH  332

Query  367  YQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKM  537
            YQG+     NVA    +P     ++QRDA++L++W++Y++L +  SE K  VL+E+ E +
Sbjct  333  YQGFNPANSNVANRLLLPDLEGAINQRDADILFMWKRYEKL-NGGSEEKLGVLREIKETV  391

Query  538  QVRAYIDGSVDAIGDYLFGTE  600
              R ++D S+D IG  +FG E
Sbjct  392  AHRKHLDSSIDFIGKLVFGFE  412



>dbj|BAC54829.1| vacuolar processing enzyme-2 [Nicotiana tabacum]
Length=484

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 136/207 (66%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  196  SGTYKSLVFYIEACESGSIFEGLLPEGLNIYATTASNAEEDSWGTYCPGDYPGPPPEYQT  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+++SWMEDS++HN ++ET+  QYE VK+RT N+     SHVM+YG + L  D LS
Sbjct  256  CLGDLYAVSWMEDSEKHNLRRETLGMQYELVKRRTANSFPYASSHVMQYGDLKLMDDPLS  315

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y     N +   +    V+QRDA+LL+ W+K+ +   + S  K +  K+
Sbjct  316  LYMGTNPANDNYTFLDENSSL--LSAKPVNQRDADLLHFWDKFLK-APQGSVRKVEAQKQ  372

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +SE M  R +ID S+  +G  LFG EK
Sbjct  373  LSEAMSHRMHIDDSIALVGRLLFGIEK  399



>ref|XP_007136809.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
 gb|ESW08803.1| hypothetical protein PHAVU_009G076100g [Phaseolus vulgaris]
Length=483

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 134/203 (66%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            TYK +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG  P PPPEY TCL
Sbjct  197  TYKSLVFYLEACESGSIFEGLLPEGMNIYATTAANAEESSWGTYCPGEYPSPPPEYETCL  256

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSKY  369
            GDL+S++WMEDSD HN + ET+  Q+E VK+RT N  +  GSHVM+YG + L K+ LS Y
Sbjct  257  GDLYSVAWMEDSDIHNLQTETLHQQFELVKQRTINGNSAYGSHVMQYGDIGLSKNNLSLY  316

Query  370  QGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
             G      N A     ++  P   V+QRDA+L++LW+KY++     S  K    K++ E 
Sbjct  317  LGTNPANDNFAFREKNSLVPPSKAVNQRDADLVHLWDKYRK-APVGSSRKSVAQKQILEA  375

Query  535  MQVRAYIDGSVDAIGDYLFGTEK  603
            M  R +ID S+  IG  LFG E+
Sbjct  376  MSHRMHIDDSMKLIGKLLFGIEE  398



>ref|XP_008797891.1| PREDICTED: vacuolar-processing enzyme [Phoenix dactylifera]
Length=486

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 134/206 (65%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK MV Y+EACESGS+FEGLLP D NIYA TAS A E+S G YCPG  P PPPEY T
Sbjct  197  AGTYKSMVFYLEACESGSIFEGLLPADINIYATTASNAVESSWGTYCPGEYPSPPPEYYT  256

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN + ET+  QY+ VK RT  +N    GSHVM+YG +DL   +L
Sbjct  257  CLGDLYSVAWMEDSEVHNLRTETLKQQYQLVKARTAVHNTYSFGSHVMQYGDLDLNAHQL  316

Query  361  SKYQGYVLPPINVATI-----PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N   I     P     V+QRDA+LLY W KY++   E S  K +  K++
Sbjct  317  FLYMGSNPANENATFIDDNALPSFSRAVNQRDADLLYFWHKYRK-SPEGSSKKLEAQKQL  375

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
             E M  R ++D S++ IG  LFG+E+
Sbjct  376  LEVMSHRLHVDSSMELIGKLLFGSEE  401



>ref|XP_010053430.1| PREDICTED: vacuolar-processing enzyme isoform X2 [Eucalyptus 
grandis]
Length=418

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A  YK+M+IYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG +P PPPEY T
Sbjct  132  AKGYKEMIIYVEACESGSVFEGIMPKDLDIYVTTASNAQESSFGTYCPGMEPPPPPEYIT  191

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SI+WMEDS+ HN KKETI  QY++VK+RT N N    GSHVMEYG+  ++ ++L
Sbjct  192  CLGDLYSIAWMEDSESHNLKKETIKQQYQSVKQRTSNFNNYNAGSHVMEYGNQSIKDERL  251

Query  361  SKYQGYVLPPINVATIPMPGT---TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+    +N     +P      V+QRDA+L +LW+ YK+  +  SE K ++  ++S 
Sbjct  252  YLYQGFDPATVNFPPNRVPPEYMGIVNQRDADLHFLWQMYKKT-ENNSEKKKEITGQISS  310

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             M+ R ++DGS++ IG  LFG EK+
Sbjct  311  TMRHRIHLDGSIEMIGALLFGPEKS  335



>ref|XP_004501477.1| PREDICTED: vacuolar-processing enzyme-like [Cicer arietinum]
Length=488

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ ADE+S G YCPG  P PPPEY T
Sbjct  200  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANADESSWGTYCPGEFPSPPPEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT N  T  GSHVM+YG + L ++ L 
Sbjct  260  CLGDLYSVAWMEDSDMHNLQSETLHQQYELVKERTKNGNTLYGSHVMQYGDIGLSENSLF  319

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++  P   V+QRDA+L++ W+K+++   + S  K    K++ 
Sbjct  320  LYLGTNPANENFTFVGRNSLVPPSKAVNQRDADLVHFWDKFRK-APQGSPRKAAAEKQVL  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID S+  +G  LFG EK
Sbjct  379  EAMSHRMHIDDSIKLVGKLLFGMEK  403



>gb|KDP34125.1| hypothetical protein JCGZ_07696 [Jatropha curcas]
Length=493

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 135/207 (65%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG  P PPPEY T
Sbjct  205  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEYPSPPPEYET  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QY+ VK+RT N  +  GSHVM+YG + L KD L 
Sbjct  265  CLGDLYSVAWMEDSDVHNLQTETLRQQYQLVKRRTANGNSAYGSHVMQYGDVGLSKDNLF  324

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y    ++  ++  P   V+QRDA+L++ W+KY++  D  S  K +  K+
Sbjct  325  LYMGTNPANENYTF--VDENSLRPPSKAVNQRDADLVHFWDKYRKAPD-GSTRKIQAQKQ  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  R ++D S+  IG  LFG  K
Sbjct  382  FVEAMSHRMHLDHSMKLIGKLLFGIGK  408



>gb|AGC94759.1| vacuolar processing enzyme [Malus micromalus]
Length=494

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 132/205 (64%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYDT  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WME SD HN + ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEGSDVHNLRSETLHQQYELVKMRTANDNSGFGSHVMQYGDVGLSKNNLF  325

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++      V+QRDA+LL+ W KY++   E S  K +  K+  
Sbjct  326  VYMGTNPANDNYTFLGENSLRPSSKAVNQRDADLLHFWHKYRK-APEGSARKIQAQKDFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  385  EAMSHRMHIDQTMKLIGKLLFGIEK  409



>ref|XP_010097094.1| Vacuolar-processing enzyme [Morus notabilis]
 gb|EXB66895.1| Vacuolar-processing enzyme [Morus notabilis]
Length=484

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 132/206 (64%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  196  AGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S+SWMEDSD HN + E++  QY+ VK RT N  +  GSHVM+YG + L K+ L 
Sbjct  256  CLGDLYSVSWMEDSDVHNLRTESLHQQYQLVKTRTANENSIYGSHVMQYGDVQLSKNNLF  315

Query  364  KYQGYVLPPINVATIP----MPGT-TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N   +      P T  V+QRDA+L++ W K+++   E S  K K  KE  
Sbjct  316  LYLGTNPANDNFTFVDENSLRPRTKAVNQRDADLVHFWVKFRK-APEGSPRKIKAQKEFV  374

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV  IG  L G EKA
Sbjct  375  EAMSHRMHIDDSVKLIGKLLVGIEKA  400



>ref|XP_010526069.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Tarenaya 
hassleriana]
Length=498

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 134/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG DP  P EY T
Sbjct  210  SGTYKSLVFYLEACESGSIFEGLLPEGMNIYATTASNAEESSWGTYCPGEDPSTPAEYET  269

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + E +  QYE VK+RT N  +  GSHVM+YG + L KD+L 
Sbjct  270  CLGDLYSVAWMEDSDIHNLRTENLHQQYELVKRRTANVDSAYGSHVMQYGDIGLSKDQLF  329

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++ +P    +QRDA+L++ W+KY++   E S  K +  K++ 
Sbjct  330  LYMGTNPANDNFTFMDENSLTLPSRVTNQRDADLVHFWDKYRK-APEGSVRKVQSQKQVI  388

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D S+  IG  LFG EK 
Sbjct  389  EVMSHRMHVDNSIKLIGKLLFGIEKG  414



>ref|XP_009607675.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
Length=484

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 136/207 (66%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  196  SGTYKSLVFYIEACESGSIFEGLLPEGLNIYATTASNAEEDSWGTYCPGDYPGPPPEYQT  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+++SWMEDS++HN ++ET+  QYE VK+RT N+     SHVM+YG + L  D LS
Sbjct  256  CLGDLYAVSWMEDSEKHNLRRETLGMQYELVKRRTANSFPYASSHVMQYGDLKLMDDPLS  315

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y     N +   +    V+QRDA+LL+ W+K+ +   + S  K +  K+
Sbjct  316  LYMGTNPANDNYTFLDENSSL--LSAKPVNQRDADLLHFWDKFLK-APQGSVRKVEAQKQ  372

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +SE M  R +ID S+  +G  LFG EK
Sbjct  373  LSEAMSHRMHIDDSIVLVGRLLFGIEK  399



>ref|XP_011096125.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=491

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 136/209 (65%), Gaps = 11/209 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  202  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGDYPSPPPEYET  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + E++  QY+ VK RT N  +  GSHVM+YG + L  D L 
Sbjct  262  CLGDLYSVAWMEDSDIHNLRTESLRQQYQLVKTRTANENSYYGSHVMQYGDLKLSVDHLF  321

Query  364  KYQGYVLPPINVATIPMPGTT--------VHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
             Y G    P N     + G +        V+QRDA+L++ W+K+++   E S  K +  K
Sbjct  322  SYMG--TNPANDNFTFVDGNSLRLSSSRAVNQRDADLVHFWDKFRK-APEGSARKVEAQK  378

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            +++E M  R++ID S+  IG  LFG EK 
Sbjct  379  QLAEAMAHRSHIDNSIQLIGKLLFGIEKG  407



>ref|XP_010911246.1| PREDICTED: vacuolar-processing enzyme [Elaeis guineensis]
Length=491

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 133/206 (65%), Gaps = 7/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK MV Y+EACESGS+FEGLLP D NIYA TAS A E+S G YCPG  P PPPEY T
Sbjct  202  AGTYKSMVFYLEACESGSIFEGLLPADINIYATTASNAVESSWGTYCPGEYPSPPPEYYT  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD HN + ET+  QY+ VK R   +N    GSHVM+YG +DL  ++L
Sbjct  262  CLGDLYSVAWMEDSDIHNLRTETLKQQYQLVKARAAVHNTYSFGSHVMQYGDLDLNAEQL  321

Query  361  SKYQGYVLPPINVATI-----PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N   I     P     V+QRDA+LLY W KY R   E S  K +  K++
Sbjct  322  FLYIGSNPANDNATFIDDNALPSFSRAVNQRDADLLYFWHKY-RESPEGSSKKLEAQKQL  380

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
             E M  R ++D S++ IG  LFG+E+
Sbjct  381  LEVMSHRLHVDNSMELIGKLLFGSEE  406



>emb|CDM87100.1| unnamed protein product [Triticum aestivum]
Length=478

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 135/203 (67%), Gaps = 7/203 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACE+GS+FEGLLP+D  +YA TAS A+E+S G YCPG  P PP EY T
Sbjct  189  AGTYKSLVFYLEACEAGSVFEGLLPNDIGVYATTASNAEESSWGTYCPGEYPSPPSEYDT  248

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SISWMEDSD HN + E++  QY+ VKKRT   +    GSHVM+YGS+DL    L
Sbjct  249  CLGDLYSISWMEDSDVHNLRTESLKQQYDLVKKRTAAQDSYSYGSHVMQYGSLDLNDQHL  308

Query  361  SKYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G      N       ++P     V+QRDA+L+Y W KY++L  E S  K+   K++
Sbjct  309  FLYIGSNPANDNTTFVEDNSLPSFSRAVNQRDADLVYFWHKYQKLA-ESSPEKNDARKQL  367

Query  526  SEKMQVRAYIDGSVDAIGDYLFG  594
             E M  R++ID SV+ IG+ LFG
Sbjct  368  LEMMGHRSHIDNSVELIGNLLFG  390



>emb|CDP08231.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 135/207 (65%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP D NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  200  SGTYKSLVFYLEACESGSIFEGLLPEDLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDS+ HN   ET+  QY  VKKRT ++ +  GSHVM+YG + L  + L 
Sbjct  260  CLGDLYSVAWMEDSEIHNLHTETLKQQYHLVKKRTSSSNSAYGSHVMQYGDLKLSLEDLF  319

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y    ++  ++      V+QRDA+LL+ W+K+++   E S  K +  K+
Sbjct  320  LYMGTNPANDNYTF--VDENSLRPSSKAVNQRDADLLHFWDKFRK-APEGSARKVEAQKQ  376

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            + E M  R +ID SV  IG  LFG EK
Sbjct  377  VVEAMSHRMHIDNSVKLIGKLLFGIEK  403



>ref|XP_009420869.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 132/207 (64%), Gaps = 8/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTY+ MV Y+EACESGS+FEGLLP D NIYA TAS A E+S G YCPG  P PPPE+ T
Sbjct  189  SGTYRSMVFYLEACESGSIFEGLLPEDINIYATTASNAYESSWGTYCPGQHPSPPPEFYT  248

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDSD+HN + ET+  QY+ VK RT  N T   GSHVMEYG ++L    L
Sbjct  249  CLGDLYSVAWMEDSDKHNLRTETLKQQYQLVKTRTAVNDTYLFGSHVMEYGELELNMQNL  308

Query  361  SKYQGYVLPPINVATI------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              Y G      N   I            V+QRDA+L+Y W KY++   E S  K    KE
Sbjct  309  FLYVGSNPANENATFIDDNSLSSFSNAAVNQRDADLIYFWHKYQK-AREGSSHKRNAQKE  367

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            + E +  R +ID S++ IG  LFG+++
Sbjct  368  LLEVISHRLHIDNSIEFIGKLLFGSKQ  394



>gb|KCW81643.1| hypothetical protein EUGRSUZ_C03004 [Eucalyptus grandis]
Length=433

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 134/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PP EY T
Sbjct  200  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPVEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDS+ HN + ET+  QY+ VKKRT N+ T  GSHVM++G + L K+ L 
Sbjct  260  CLGDLYSVAWMEDSEVHNLRTETLHQQYQLVKKRTANDNTAYGSHVMQFGDIGLSKEDLF  319

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N +     ++  P   V+QRDA+LL+ W K+++   E S  K +  K+  
Sbjct  320  LYMGTNPANDNSSFVDDNSLRPPQKAVNQRDADLLHFWHKFRK-APEGSSRKLEAQKQFF  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R +ID SV  IG  LFG +K 
Sbjct  379  EAMSHRMHIDHSVKLIGKLLFGIKKG  404



>ref|XP_007222246.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
 gb|EMJ23445.1| hypothetical protein PRUPE_ppa004713mg [Prunus persica]
Length=494

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 134/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  206  AGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSWGTYCPGEYPSPPPEYET  265

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  266  CLGDLYSVAWMEDSDIHNLRSETLHQQYELVKTRTANDNSGFGSHVMQYGDVGLSKENLF  325

Query  364  KYQGYVLPPINVATIP----MPGT-TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N   +      P T  V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  326  VYMGTNPANDNYTFLGENSLRPSTKAVNQRDADLVHFWHKYRK-APEGSPRKIQAQKDFV  384

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D ++  IG  LFG +K 
Sbjct  385  EAMSHRMHMDQTMKLIGKLLFGIKKG  410



>ref|XP_010432633.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=492

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 129/202 (64%), Gaps = 7/202 (3%)
 Frame = +1

Query  7    GTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTC  186
            GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG +P PPPEY TC
Sbjct  204  GTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGDEPSPPPEYDTC  263

Query  187  LGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSK  366
            LGDL+S++WMEDS  HN + ET+  QYE VKKRT       GSHVM+YG + L KD L  
Sbjct  264  LGDLYSVAWMEDSGVHNLQTETLQQQYELVKKRTAPTEYSYGSHVMQYGDVGLSKDLLDL  323

Query  367  YQGYVLPPINVATI------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
            Y G      N   +      P P    +QRDA+L++ WEKY++   E S  K +  K++ 
Sbjct  324  YMGTNPANENFTFVDANSLKPPPSRVTNQRDADLVHFWEKYRK-APEGSARKTEAHKQLL  382

Query  529  EKMQVRAYIDGSVDAIGDYLFG  594
            E M  R ++D SV  +G  LFG
Sbjct  383  EVMSHRLHVDNSVMLVGKILFG  404



>emb|CAA07639.1| cysteine proteinase precursor [Vicia sativa]
Length=503

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 142/205 (69%), Gaps = 9/205 (4%)
 Frame = +1

Query  13   YKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWY-CPGSDPLPPPEYTTCL  189
            Y++MVIYVEACESGS+F+G++P D ++Y  TAS A+E+S G Y  PG  P  PPEY TCL
Sbjct  217  YQQMVIYVEACESGSVFQGIMPKDIDVYVTTASNAEESSWGTYLVPGVYPASPPEYITCL  276

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKLSK  366
            GDL+S++WMEDS+ HN K+ET+  Q+ +VK+RT NN   G GSHV EYG  ++  +KL  
Sbjct  277  GDLYSVAWMEDSETHNLKRETLKQQFASVKERTLNNNNYGLGSHVTEYGDTNITDEKLYL  336

Query  367  YQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            Y G+      LPP N   +      V+QRDAE+L++W+ Y+RL D +SE K  +LK++SE
Sbjct  337  YHGFDPASVNLPP-NNGRLESKMEVVNQRDAEILFMWQMYQRL-DHQSEKKRDILKKISE  394

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             ++ R ++DGSV+ IG  LFG  + 
Sbjct  395  TVKHRNHLDGSVELIGVLLFGPTRG  419



>ref|XP_010264202.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=498

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A  YK+MVIYVEACESGS+FEGL+  D +IY  TAS A E S G YCPG  P PPPE+ T
Sbjct  212  ARGYKEMVIYVEACESGSIFEGLMTEDLDIYVTTASNAQELSWGTYCPGMVPSPPPEFLT  271

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ H+ K+ETI  QY+NVK R  N N    GSHVMEYG+  ++ +KL
Sbjct  272  CLGDLYSVAWMEDSEIHSLKEETIQQQYQNVKYRASNYNTYDVGSHVMEYGNKSIKFEKL  331

Query  361  SKYQGYV--LPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
              YQG+      IN  ++      V+QRDA+LL+LW++YK+  +E S+ K ++ K+++E 
Sbjct  332  YLYQGFSQDTEKINQNSLQFHMDVVNQRDADLLFLWQRYKKS-EEGSKKKKEIFKQIAET  390

Query  535  MQVRAYIDGSVDAIGDYLFGTEKA  606
            ++ R ++DGSV+ IG+ LFG E+A
Sbjct  391  IKHRIHLDGSVELIGNLLFGPERA  414



>ref|XP_003525979.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
 gb|KHN32223.1| Vacuolar-processing enzyme [Glycine soja]
Length=484

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  196  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QY+ VK+RT N  +  GSHVM+YG + L K+ L 
Sbjct  256  CLGDLYSVAWMEDSDIHNLRTETLHQQYDLVKERTMNGNSIYGSHVMQYGDIGLSKNNLV  315

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W+K+++     S  K    KE+ 
Sbjct  316  LYLGTNPANDNFTFVHKNSLVPPSKAVNQRDADLIHFWDKFRK-APVGSSRKAAAEKEIL  374

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID ++  IG  LFG EK
Sbjct  375  EAMSHRMHIDDNMKLIGKLLFGIEK  399



>ref|XP_008220440.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-processing enzyme-like 
[Prunus mume]
Length=520

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 134/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V Y+EACESGS+FEGLLP   NI+A TAS A+E+S G YCPG  P PPPEY T
Sbjct  232  AGTYKSLVFYLEACESGSIFEGLLPKGLNIFATTASNAEESSWGTYCPGEYPSPPPEYET  291

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK RT N+ +G GSHVM+YG + L K+ L 
Sbjct  292  CLGDLYSVAWMEDSDVHNLRSETLHQQYELVKTRTANDNSGFGSHVMQYGDVGLSKENLF  351

Query  364  KYQGYVLPPINVATIP----MPGT-TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N   +      P T  V+QRDA+L++ W KY++   E S  K +  K+  
Sbjct  352  VYMGTNPANDNYTFLGENSLRPSTKAVNQRDADLVHFWHKYRK-APEGSPRKIQAQKDFV  410

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D ++  IG  LFG +K 
Sbjct  411  EAMSHRMHMDQTMKLIGKLLFGIKKG  436



>gb|KHG24041.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=496

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 146/208 (70%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK+MV+YVEACESGS+FEG++P D ++Y  TAS A E+S G YCPG +P PPPE+ T
Sbjct  208  AGTYKEMVLYVEACESGSIFEGIMPKDLDVYVTTASNAQESSWGTYCPGMEPPPPPEFIT  267

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT--WNNGTGGGSHVMEYGSMDLRKDK  357
            CLGDL+S++WMEDS+ HN K+ET+  QYE+VK+RT  +N    GGSHVMEYG+  ++ +K
Sbjct  268  CLGDLYSVAWMEDSETHNLKRETVEQQYESVKERTSNFNAYAFGGSHVMEYGNTSIKLEK  327

Query  358  LSKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            L  YQG+      LPP N  +   P   V+QRDA++L+LW  YK    E    K ++L++
Sbjct  328  LYLYQGFDPATVNLPP-NELSPNTPMEAVNQRDADILFLWHMYKN--SEDGSKKTEILRQ  384

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            ++E  + R ++DGS+D IG  L+G  K 
Sbjct  385  ITETKRHRIHLDGSIDLIGTLLYGPAKG  412



>ref|XP_010669169.1| PREDICTED: vacuolar-processing enzyme-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 130/205 (63%), Gaps = 7/205 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            TYK +V YVEACESGS+FEGLLP   NIYA TAS A E+S G YCPG  P PPPEY TCL
Sbjct  201  TYKSLVFYVEACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGDYPGPPPEYETCL  260

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSKY  369
            GDL+S +WMEDS+ HN + ET+  QYE VK RT N G+  GSHV+++G  DL KDKL  Y
Sbjct  261  GDLYSAAWMEDSEIHNLRTETLKHQYELVKMRTSNGGSRYGSHVLQFGDKDLSKDKLYMY  320

Query  370  QGYVLPPINVATI------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
             G      N   +      P     V+QRDA+L++ WEK+++   E S+ K +  K   E
Sbjct  321  MGSNPANENFTYVDNNSLHPPSSKAVNQRDADLVHFWEKFRK-APEGSQRKMEAQKLFME  379

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             M  R ++D S+  +G  LFG EK 
Sbjct  380  AMSHRIHLDHSIKLVGKLLFGIEKG  404



>gb|KFK32531.1| hypothetical protein AALP_AA6G255400 [Arabis alpina]
Length=484

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK MV Y+EACESGS+F+GLLP   NIYA TAS  +E+S G YCPG DP PP EY T
Sbjct  196  SGTYKSMVFYLEACESGSIFDGLLPKGLNIYATTASNPEESSWGTYCPGEDPSPPSEYET  255

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD+HN + E++  QYE VKKRT  + +  GSHVMEYG + L  DKL 
Sbjct  256  CLGDLYSVAWMEDSDKHNLQTESLHQQYEVVKKRTAGSSSSYGSHVMEYGDVGLSIDKLV  315

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++   +  P    +QRDA+L++ W+KY++   E S  K +  K++ 
Sbjct  316  LYMGTNPDNENFTFVDENLLRPPSRVTNQRDADLVHFWDKYRK-APEGSARKVEAQKQVL  374

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D S+  IG  LFG  + 
Sbjct  375  EVMSHRLHVDNSIQLIGKLLFGISEG  400



>ref|XP_010049168.1| PREDICTED: vacuolar-processing enzyme-like [Eucalyptus grandis]
 gb|KCW81642.1| hypothetical protein EUGRSUZ_C03004 [Eucalyptus grandis]
Length=488

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PP EY T
Sbjct  200  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPVEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDS+ HN + ET+  QY+ VKKRT N+ T  GSHVM++G + L K+ L 
Sbjct  260  CLGDLYSVAWMEDSEVHNLRTETLHQQYQLVKKRTANDNTAYGSHVMQFGDIGLSKEDLF  319

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N +     ++  P   V+QRDA+LL+ W K+++   E S  K +  K+  
Sbjct  320  LYMGTNPANDNSSFVDDNSLRPPQKAVNQRDADLLHFWHKFRK-APEGSSRKLEAQKQFF  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID SV  IG  LFG +K
Sbjct  379  EAMSHRMHIDHSVKLIGKLLFGIKK  403



>ref|XP_004253098.1| PREDICTED: vacuolar-processing enzyme [Solanum lycopersicum]
Length=480

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 133/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V+Y+EACESGS+FEGLLP+  NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  192  AGTYKSLVLYIEACESGSIFEGLLPNGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  251

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+++SWMEDS+ HN + E +  QY  VKKRT N  T  GSHVM++G + L  + L 
Sbjct  252  CLGDLYAVSWMEDSEMHNLRTENLRQQYHLVKKRTANGNTAYGSHVMQFGDLQLSMESLF  311

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
            ++ G      N       ++      V+QRDA+LL+ W+K+++   E S  K +  K+ +
Sbjct  312  RFMGTNPANDNYTYVDDNSLLASSKAVNQRDADLLHFWDKFRK-APEGSARKVEAQKQFT  370

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R ++D  +  +G  LFG +K
Sbjct  371  EAMSHRMHLDERIALVGKLLFGIQK  395



>ref|XP_010053427.1| PREDICTED: vacuolar-processing enzyme isoform X1 [Eucalyptus 
grandis]
 gb|KCW77726.1| hypothetical protein EUGRSUZ_D02025 [Eucalyptus grandis]
Length=496

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A  YK+M+IYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG +P PPPEY T
Sbjct  210  AKGYKEMIIYVEACESGSVFEGIMPKDLDIYVTTASNAQESSFGTYCPGMEPPPPPEYIT  269

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+SI+WMEDS+ HN KKETI  QY++VK+RT N N    GSHVMEYG+  ++ ++L
Sbjct  270  CLGDLYSIAWMEDSESHNLKKETIKQQYQSVKQRTSNFNNYNAGSHVMEYGNQSIKDERL  329

Query  361  SKYQGYVLPPINVATIPMPGT---TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+    +N     +P      V+QRDA+L +LW+ YK+  +  SE K ++  ++S 
Sbjct  330  YLYQGFDPATVNFPPNRVPPEYMGIVNQRDADLHFLWQMYKKT-ENNSEKKKEITGQISS  388

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             M+ R ++DGS++ IG  LFG EK+
Sbjct  389  TMRHRIHLDGSIEMIGALLFGPEKS  413



>ref|XP_007155624.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
 gb|ESW27618.1| hypothetical protein PHAVU_003G217500g [Phaseolus vulgaris]
Length=493

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 142/208 (68%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YK+MVIYVEACESGS+FEG++P D NIY  TAS A ENS G YCPG  P PPPEY T
Sbjct  205  SGGYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQENSWGTYCPGMYPPPPPEYIT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKE++  QY++VK+RT N      GSHVM+YG  ++  +KL
Sbjct  265  CLGDLYSVAWMEDSESHNLKKESVEQQYQSVKQRTSNFEAYAMGSHVMQYGDANMTAEKL  324

Query  361  SKYQGYVLPPINVATIPMPGT------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              Y G+   P  V   P  G        V+QRDAELL++W+ Y+R  +   E K  +LK+
Sbjct  325  YLYHGF--DPATVNFPPHNGRLKSKMEVVNQRDAELLFMWQMYQR-SNHLPEKKTDILKQ  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + E ++ R ++DGSV+ IG  L+G EKA
Sbjct  382  IEEIVKHRKHLDGSVELIGVLLYGPEKA  409



>gb|EMT14075.1| Vacuolar-processing enzyme beta-isozyme [Aegilops tauschii]
Length=415

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 133/203 (66%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KMVIYVEACESGS+FEGL+P D NIY   AS A E+S   YCP     PPPEY TCL
Sbjct  129  SYSKMVIYVEACESGSIFEGLMPQDQNIYVTAASNAVESSWAAYCPDDGTPPPPEYFTCL  188

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKLSK  366
            GDL+S+SWMEDS+  N K ETI  QYE VK RT   N +  GSHVMEYG    ++D L  
Sbjct  189  GDLYSVSWMEDSETQNLKNETIKQQYEVVKARTAPRNESIRGSHVMEYGDKTFKEDMLFL  248

Query  367  YQGY--VLPPINVATIPMPGT--TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            YQG+      I    +PMP     + QRDA++L++W+KY++L +  SE K + L+E+ E 
Sbjct  249  YQGFDPAKSSIRNRPLPMPSLKGAIKQRDADILFMWKKYEKL-NGGSEEKQRALREVKET  307

Query  535  MQVRAYIDGSVDAIGDYLFGTEK  603
            +  R ++D S+D IG  +FG +K
Sbjct  308  VLHRKHLDSSIDFIGKLVFGFDK  330



>ref|XP_003603121.1| Vacuolar processing enzyme [Medicago truncatula]
 gb|AES73372.1| vacuolar processing enzyme [Medicago truncatula]
Length=484

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 134/203 (66%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            TYK +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG +P PPPEY TCL
Sbjct  198  TYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGENPSPPPEYETCL  257

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSKY  369
            GDL+S++WMEDSD HN + ET+  QYE VK+RT N  +  GSHVM++G + L +D L  Y
Sbjct  258  GDLYSVAWMEDSDIHNLQTETLHQQYELVKERTSNGNSIYGSHVMQFGDIGLSRDSLFLY  317

Query  370  QGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
             G      N       ++  P  TV+QRDA+L++ W+K+++   + S  K    K++ E 
Sbjct  318  LGSNPANENFTFMGRNSLVPPSKTVNQRDADLIHFWDKFRK-APQGSPRKVAAQKQVLEA  376

Query  535  MQVRAYIDGSVDAIGDYLFGTEK  603
            M  R +ID S+  +G  LFG +K
Sbjct  377  MSHRMHIDESIKLVGKLLFGMKK  399



>ref|XP_002960690.1| hypothetical protein SELMODRAFT_75074 [Selaginella moellendorffii]
 gb|EFJ38229.1| hypothetical protein SELMODRAFT_75074 [Selaginella moellendorffii]
Length=478

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 133/199 (67%), Gaps = 2/199 (1%)
 Frame = +1

Query  13   YKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCLG  192
            YK+MV+Y+EACESGS+FEGLLP + NI+  TAS A E+S G YCPG +P PPPEY TC+G
Sbjct  197  YKEMVLYIEACESGSIFEGLLPKNLNIFVTTASNAVESSWGTYCPGMEPSPPPEYDTCIG  256

Query  193  DLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKLSKY  369
            DL+S++WMEDS+ HN   E +  QY  VK RT +  T   GSHVM+YG  ++ K++LS Y
Sbjct  257  DLYSVAWMEDSEVHNLDHERLKDQYNTVKARTSDANTYRMGSHVMKYGDTNMDKERLSLY  316

Query  370  QGYVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKMQVRA  549
             G+     N+ +   P +++ QRDA+LL+ W+KYK    E S  K K L+E  + +  R 
Sbjct  317  LGFDPANANLTSYNKPASSIGQRDADLLHFWQKYKN-SKENSLEKSKALQEFLDVIGRRT  375

Query  550  YIDGSVDAIGDYLFGTEKA  606
             ID SV+ +G  L G+E A
Sbjct  376  QIDRSVELVGSVLLGSESA  394



>sp|O24326.1|VPE2_PHAVU RecName: Full=Vacuolar-processing enzyme; AltName: Full=Pv-VPE; 
Flags: Precursor [Phaseolus vulgaris]
 emb|CAB17079.1| legumain-like proteinase precursor [Phaseolus vulgaris]
Length=493

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 142/208 (68%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G YK+MVIYVEACESGS+FEG++P D NIY  TAS A ENS G YCPG  P PPPEY T
Sbjct  205  SGGYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQENSWGTYCPGMYPPPPPEYIT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN KKE++  QY++VK+RT N      GSHVM+YG  ++  +KL
Sbjct  265  CLGDLYSVAWMEDSESHNLKKESVEQQYQSVKQRTSNFEAYAMGSHVMQYGDANMTAEKL  324

Query  361  SKYQGYVLPPINVATIPMPGT------TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
              Y G+   P  V   P  G        V+QRDAELL++W+ Y+R  +   E K  +LK+
Sbjct  325  YLYHGF--DPATVNFPPHNGRLKSKMEVVNQRDAELLFMWQVYQR-SNHLPEKKTDILKQ  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + E ++ R ++DGSV+ IG  L+G EKA
Sbjct  382  IEEIVKHRKHLDGSVELIGVLLYGPEKA  409



>dbj|BAJ33795.1| unnamed protein product [Thellungiella halophila]
Length=478

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 131/206 (64%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLL    NIYA TAS A E+S G YCPG DP  PPEY T
Sbjct  200  SGTYKSLVFYLEACESGSIFEGLLEEGLNIYATTASNAVESSWGTYCPGEDPSLPPEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S+SWMEDS  HN + ET+  QYE VK+RT   G+  GSHVM+YG + L KDKL 
Sbjct  260  CLGDLYSVSWMEDSGMHNLQTETLRQQYELVKRRTAGVGSAYGSHVMQYGDVGLSKDKLD  319

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++  P    +QRDA+L++ W+KY++   E S  K +  K++ 
Sbjct  320  LYMGTNPANDNFTFVDENSLTPPSRVTNQRDADLVHFWDKYRK-APEGSTRKTEAQKQVL  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D SV  +G  LFG  + 
Sbjct  379  EAMSHRLHVDNSVKLVGKLLFGISEG  404



>ref|XP_006838617.1| hypothetical protein AMTR_s00002p00230280 [Amborella trichopoda]
 gb|ERN01186.1| hypothetical protein AMTR_s00002p00230280 [Amborella trichopoda]
Length=452

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 7/202 (3%)
 Frame = +1

Query  19   KMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCLGDL  198
            +MVIYVEACESGS+FEGL+  D NIY  TAS A E+S G YCPG DP PPPE+ TCLGDL
Sbjct  166  EMVIYVEACESGSIFEGLMTEDLNIYVTTASNAQESSWGTYCPGMDPPPPPEFMTCLGDL  225

Query  199  FSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKLSKYQG  375
            +S++WMEDS+ HN K+ETI  QY  VK RT N N    GSHVMEYG   ++ ++L  YQG
Sbjct  226  YSVAWMEDSETHNLKEETIQKQYVRVKSRTSNYNTYTAGSHVMEYGDKSIKSERLYLYQG  285

Query  376  YVLPPINVATIPMPGT-----TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKMQ  540
            +     N++   +P        V+QRDA+LL+LW++Y+R   E SE K  +  EM+EKM 
Sbjct  286  FDPANANLSDNSLPLQPNRMDVVNQRDADLLFLWQRYER-STEGSEEKVAIRNEMTEKMA  344

Query  541  VRAYIDGSVDAIGDYLFGTEKA  606
             R ++D SVD IG  LFG +K 
Sbjct  345  HREHLDKSVDLIGRLLFGWDKG  366



>ref|XP_010447316.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme [Camelina 
sativa]
Length=491

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 130/201 (65%), Gaps = 6/201 (3%)
 Frame = +1

Query  7    GTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTC  186
            GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG +P PPPEY TC
Sbjct  204  GTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGDEPSPPPEYDTC  263

Query  187  LGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSK  366
            LGDL+S++WMEDS  HN + ET+  QYE VK+RT       GSHVM+YG + L KD L  
Sbjct  264  LGDLYSVAWMEDSGVHNLQTETLQQQYELVKRRTAPTEYSYGSHVMQYGDVGLNKDLLDL  323

Query  367  YQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            Y G          ++  ++  P    +QRDA+L++ WEKY++   E S  K +  K++ E
Sbjct  324  YMGTNPANENFTFVDTNSLKPPSRVTNQRDADLVHFWEKYRK-APEGSARKTEAQKQLLE  382

Query  532  KMQVRAYIDGSVDAIGDYLFG  594
             M  R ++D SV  +G  LFG
Sbjct  383  VMSHRLHVDNSVMLVGKILFG  403



>ref|XP_003580236.1| PREDICTED: vacuolar-processing enzyme beta-isozyme [Brachypodium 
distachyon]
Length=494

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 140/201 (70%), Gaps = 5/201 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P D NIY  TA+ A ENS G YCP  +P PPPEY T
Sbjct  207  SNSYSKMVIYVEACESGSIFEGLMPEDLNIYVTTAANAVENSWGAYCPEMEPPPPPEYIT  266

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S+SWMEDSD H+ KKETI  QYE VK RT N N +  GSHVMEYG    +++KL
Sbjct  267  CLGDLYSVSWMEDSDAHDLKKETIKDQYEVVKNRTSNSNKSDRGSHVMEYGDKTFKEEKL  326

Query  361  SKYQGYVLPPINVATI---PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     NVA     P P   V+QRDA++L++W++Y++L +  SE K + L E+ E
Sbjct  327  FLYQGFNPANANVANRLIWPGPSAAVNQRDADILFMWKRYEQL-NVGSEEKLRALMEIKE  385

Query  532  KMQVRAYIDGSVDAIGDYLFG  594
             M  R ++D S+D IG  +FG
Sbjct  386  TMAHRKHLDSSIDFIGKLVFG  406



>ref|XP_006412409.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
 gb|ESQ53862.1| hypothetical protein EUTSA_v10025034mg [Eutrema salsugineum]
Length=488

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 132/206 (64%), Gaps = 6/206 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLL    NIYA TAS A E+S G YCPG DP  PPEY T
Sbjct  200  SGTYKSLVFYLEACESGSIFEGLLEEGLNIYATTASNAVESSWGTYCPGEDPSLPPEYET  259

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S+SWMEDS  HN + ET+  QYE VK+RT   G+  GSHVM+YG + L KDKL 
Sbjct  260  CLGDLYSVSWMEDSGMHNLQTETLRQQYELVKRRTAGVGSAYGSHVMQYGDVGLSKDKLD  319

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P    +QRDA+L++ W+KY++   E S  K +  K++ 
Sbjct  320  LYMGTNPANDNFTFVDENSLTPPSRVTNQRDADLVHFWDKYRK-APEGSTRKTEAQKQVL  378

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEKA  606
            E M  R ++D SV  +G  LFG  + 
Sbjct  379  EAMSHRLHVDNSVKLVGKLLFGISEG  404



>gb|KJB06489.1| hypothetical protein B456_001G023700 [Gossypium raimondii]
Length=488

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 135/207 (65%), Gaps = 7/207 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A E+S G YCPG  P PPPEY T
Sbjct  199  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAVESSWGTYCPGEYPSPPPEYET  258

Query  184  CLGDLFSISWMED-SDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMED SD HN +KET+  QYE VK+RT N  +  GSHVM++G + +  D L
Sbjct  259  CLGDLYSVAWMEDSSDIHNLRKETLHQQYEFVKRRTINGNSAYGSHVMQFGDIGISMDNL  318

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
              Y G          I+  ++  P   V+QRDA+L++ W+KY++  D  S  K +  K++
Sbjct  319  FTYLGTNPANDNFKFIDENSLLPPTKAVNQRDADLVHFWDKYRKAPD-GSVRKVEAQKQV  377

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
             E M  R ++D S+  IG  LFG E+ 
Sbjct  378  MEAMSHRMHVDNSIQLIGKLLFGVERG  404



>gb|ABS57371.1| VPE1 [Triticum aestivum]
Length=494

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 133/203 (66%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KMVIYVEACESGS+FEGL+P D+NIY   AS A E+S   YCP     PPPEY TCL
Sbjct  208  SYSKMVIYVEACESGSIFEGLMPQDYNIYVTAASNAVESSWAAYCPDDGTPPPPEYFTCL  267

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKLSK  366
            GDL+S+SWMEDS+  N K ETI  QYE VK RT   N +  GSHVMEYG    ++D L  
Sbjct  268  GDLYSVSWMEDSETQNLKNETIKQQYEVVKARTAPRNESIRGSHVMEYGDKTFKEDMLFL  327

Query  367  YQGY--VLPPINVATIPMPGT--TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            YQG+      I    +PMP     + QRDA++L++W+KY +L +  SE K + L+E+ E 
Sbjct  328  YQGFDPAKSSIRNRPLPMPSLKGAIKQRDADILFMWKKYGKL-NGGSEEKQRALREVKET  386

Query  535  MQVRAYIDGSVDAIGDYLFGTEK  603
            +  R ++D S+D IG  +FG +K
Sbjct  387  VLHRKHLDSSIDFIGKLVFGFDK  409



>ref|XP_006342509.1| PREDICTED: vacuolar-processing enzyme-like [Solanum tuberosum]
Length=480

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (64%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK +V+Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PPPEY T
Sbjct  192  AGTYKSLVLYIEACESGSIFEGLLPKGLNIYATTASNAEESSWGTYCPGEYPSPPPEYET  251

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+++SWMEDS+ HN + E +  QY  VKKRT N  T  GSHVM++G + L  + L 
Sbjct  252  CLGDLYAVSWMEDSEMHNLRTENLRQQYHLVKKRTANGNTAYGSHVMQFGDLQLSMESLF  311

Query  364  KYQGYVLPPINVATIP-----MPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
            ++ G      N   +           V+QRDA+LL+ W+K+++   E S  K +  K+ +
Sbjct  312  RFMGTNPANDNYTYVDDNSLWASSKAVNQRDADLLHFWDKFRK-APEGSARKVEAQKQFT  370

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R ++D  +  +G  LFG +K
Sbjct  371  EAMSHRMHLDERIALVGKLLFGIQK  395



>ref|XP_006408834.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
 gb|ESQ50287.1| hypothetical protein EUTSA_v10001970mg [Eutrema salsugineum]
Length=490

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 134/207 (65%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG D  PP EY T
Sbjct  202  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGDDSSPPKEYET  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S+SWMEDSD+HN + E++  QYE VKKRT  + T  GSHVME+G + L K+ L 
Sbjct  262  CLGDLYSVSWMEDSDQHNLQTESLHQQYELVKKRTAGSNTSYGSHVMEFGDIGLSKEMLV  321

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y    ++  ++  P    +QRDA+L++ W+KY++   E S  K +  K+
Sbjct  322  LYMGTNPDNENYTF--VDKNSLRPPSRVTNQRDADLVHFWDKYQK-APEGSARKAEAQKQ  378

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            + E M  R +ID S   IG  LFG  +
Sbjct  379  VLEAMSHRLHIDNSFLMIGKLLFGISE  405



>emb|CAH56498.1| cysteine protease [Solanum lycopersicum]
Length=480

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 132/204 (65%), Gaps = 6/204 (3%)
 Frame = +1

Query  7    GTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTC  186
            GTYK +V+Y+EACESGS+FEGLLP+  NIYA TAS A+E+S G YCPG  P PPPEY TC
Sbjct  193  GTYKSLVLYIEACESGSIFEGLLPNGLNIYATTASNAEESSWGTYCPGEYPSPPPEYETC  252

Query  187  LGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSK  366
            LGDL+++SWMEDS+ HN + E +  QY  VKKRT N  T  GSHVM++G + L  + L +
Sbjct  253  LGDLYAVSWMEDSEMHNLRTENLRQQYHLVKKRTANGNTAYGSHVMQFGDLQLSMESLFR  312

Query  367  YQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            + G      N       ++      V+QRDA+LL+ W+K+++   E S  K +  K+ +E
Sbjct  313  FMGTNPANDNYTYVDDNSLLASSKAVNQRDADLLHFWDKFRK-APEGSARKVEAQKQFTE  371

Query  532  KMQVRAYIDGSVDAIGDYLFGTEK  603
             M  R ++D  +  +G  LFG +K
Sbjct  372  AMSHRMHLDERIALVGKLLFGIQK  395



>ref|XP_006355320.1| PREDICTED: vacuolar-processing enzyme [Solanum tuberosum]
Length=482

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 133/206 (65%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGSMFEGLLP   NIYA TAS ADE+S G YCPG  P PP EY T
Sbjct  195  SGTYKSLVFYLEACESGSMFEGLLPEGLNIYATTASNADESSWGTYCPGEFPSPPIEYGT  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SISWMEDS+RHN + ET+  QY  VK+RT +     GSHVM+YG + L KD L 
Sbjct  255  CLGDLYSISWMEDSERHNLRTETLKQQYHLVKERTASGNPAYGSHVMQYGDVHLSKDVLF  314

Query  364  KYQGYVLPPINVATIPMPGTT------VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
             Y G    P N  +  M   +      V+QRDA+L++ W K+ +   E S  K +  K++
Sbjct  315  LYMG--TDPANDNSTFMDDNSMRVSKAVNQRDADLVHFWYKFHK-APEGSVRKTEAQKQL  371

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E +  R ++D S+  +G  LFG +K
Sbjct  372  NEAISHRMHLDNSIALVGKLLFGIKK  397



>gb|EMT00724.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=477

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 137/215 (64%), Gaps = 19/215 (9%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGLLP D NIY  TAS A ENS G YCPG    PP EY TCL
Sbjct  178  SYSKMIIYVEACESGSIFEGLLPEDLNIYVTTASNAVENSWGAYCPGMKSSPPAEYDTCL  237

Query  190  GDLFSISWMED--------------SDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVM  324
            GD++S+SWMED              S+ HN KKET+  QYE VK RT  +     GSHVM
Sbjct  238  GDIYSVSWMEDRICQKVLNRSILLCSETHNLKKETLKQQYEVVKTRTSKSKEFDKGSHVM  297

Query  325  EYGSMDLRKDKLSKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKS  495
            EYG    + +KL  YQG+     NVA    +P     ++QRDA++L++W++Y++L +  S
Sbjct  298  EYGDKTFKDEKLFLYQGFGPANSNVANRLLLPELEGAINQRDADILFMWKRYEKL-NGGS  356

Query  496  EMKDKVLKEMSEKMQVRAYIDGSVDAIGDYLFGTE  600
            E K +VL+E+ E +  R ++D S+D IG  +FG E
Sbjct  357  EEKQRVLREIKETVVHRKHLDSSIDFIGKLVFGFE  391



>ref|XP_009407316.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=488

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 133/210 (63%), Gaps = 12/210 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK MV Y+EACESGS+FEGLLP D NIYA TAS A E+S G YCPG DP PP EY T
Sbjct  198  SGSYKSMVFYLEACESGSIFEGLLPEDINIYATTASNAYESSWGTYCPGEDPSPPQEYYT  257

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+SI+WMEDSD HN + ET+  QY  VK RT  + T   GSHVM+YG ++L    L
Sbjct  258  CLGDLYSIAWMEDSDIHNLRTETLKQQYHLVKTRTAVSETYRFGSHVMQYGDLELNMKDL  317

Query  361  SKYQGYVLPPIN--------VATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
              Y G    P+N         + +      V+QRDA+L+Y W KY+R   E S  K    
Sbjct  318  FLYLGS--NPLNENATFVDDNSLLSFSKAAVNQRDADLVYFWHKYRR-APEGSSHKLNAQ  374

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            K++ E M  R +ID S++ IG  LFG+ KA
Sbjct  375  KDLLEVMSHRLHIDNSIELIGKLLFGSGKA  404



>ref|XP_010437829.1| PREDICTED: vacuolar-processing enzyme gamma-isozyme-like [Camelina 
sativa]
Length=491

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 6/201 (3%)
 Frame = +1

Query  7    GTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTC  186
            GTYK +V Y+EACESGS+FEG+LP   NIYA TAS A+E+S G YCPG +P PPPEY TC
Sbjct  204  GTYKSLVFYLEACESGSIFEGVLPEGLNIYATTASNAEESSWGTYCPGDEPSPPPEYDTC  263

Query  187  LGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSK  366
            LGDL+S++WMEDS  HN + ET+  QYE VK+RT       GSHVM+YG + L KD L  
Sbjct  264  LGDLYSVAWMEDSGVHNLQTETLQQQYELVKRRTAPTEYSYGSHVMQYGDVGLSKDLLDL  323

Query  367  YQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            Y G          ++  ++  P    +QRDA+L++ WEKY++   E S  K +  K++ E
Sbjct  324  YMGTNPANENFTFVDANSLKPPSRVTNQRDADLVHFWEKYRK-APEGSARKTEAHKQLLE  382

Query  532  KMQVRAYIDGSVDAIGDYLFG  594
             M  R ++D SV  +G  LFG
Sbjct  383  VMSHRLHVDNSVMLVGKILFG  403



>emb|CAQ00097.1| legumain [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 135/203 (67%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGLLP D NIY  TA+ A E+S   YCP  +  PPPEY TCL
Sbjct  202  SYSKMIIYVEACESGSIFEGLLPQDHNIYVTTAANAVEDSWAAYCPKMEIPPPPEYCTCL  261

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKLSK  366
            GD +S+SWMEDS+  + KKE+I  QYE VK RT   N +  GSHVMEYG    ++D L  
Sbjct  262  GDAYSVSWMEDSETQDLKKESIKQQYEVVKARTAPRNESSIGSHVMEYGDKTFKEDMLFL  321

Query  367  YQGY--VLPPINVATIPMPGT--TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            YQG+      I    +PMP     ++QRDA++L++W KY++L +  SE K + L+E+ E 
Sbjct  322  YQGFDPAKSSIRNRPLPMPSLKGAINQRDADILFMWRKYEKL-NAGSEEKQRALREVKET  380

Query  535  MQVRAYIDGSVDAIGDYLFGTEK  603
            +  R ++D S+D IG  +FG +K
Sbjct  381  VLHRKHLDSSIDFIGKLVFGFDK  403



>emb|CBM41515.1| legumain/vacuolar processing enzyme [Papaver rhoeas]
Length=490

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 133/205 (65%), Gaps = 8/205 (4%)
 Frame = +1

Query  7    GTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTC  186
            G YK +V Y+EACESGS+FEG+LP   NIYA TAS A+E+S G YCPG  P PP EY TC
Sbjct  203  GAYKSLVFYLEACESGSIFEGILPKGLNIYATTASNAEESSWGTYCPGEFPSPPSEYETC  262

Query  187  LGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSK  366
            LGDL+S++WMEDSD HN + ET+  QY  VK+RT N  +  GSHVM+YG +++ K+ L  
Sbjct  263  LGDLYSVAWMEDSDVHNLRSETLKQQYHLVKERTQNANSAYGSHVMQYGDLEVSKEDLFL  322

Query  367  YQGYVLPP------INVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
            Y G   P       I   ++P    +V+QR+A+L++ W+KY++   E S+ K    K+  
Sbjct  323  YMG-TNPANDNNKFIEQNSLPSLSGSVNQREADLIHFWQKYRK-APEGSQRKADAQKQFV  380

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R ++D S+  IG  LFG EK
Sbjct  381  EVMAHRMHVDHSIKLIGKLLFGFEK  405



>gb|KJB25635.1| hypothetical protein B456_004G201300 [Gossypium raimondii]
Length=496

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 144/208 (69%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AGTYK+MV+YVEACESGS+FEG++P   +IY  TAS A E+S G YCPG +P PPPE+ T
Sbjct  208  AGTYKEMVLYVEACESGSIFEGIMPKYLDIYVTTASNAQESSWGTYCPGMEPPPPPEFIT  267

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRT--WNNGTGGGSHVMEYGSMDLRKDK  357
            CLGDL+S++WMEDS+ HN K+ET+  QYE+VK+RT  +N    GGSHVMEYG+  ++ +K
Sbjct  268  CLGDLYSVAWMEDSETHNLKRETVEQQYESVKERTSNFNADAFGGSHVMEYGNTSIKPEK  327

Query  358  LSKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            L  YQG+      LPP N      P   V+QRDA++L+LW  YK    E    K ++LK+
Sbjct  328  LYLYQGFDPATVNLPP-NELGPNTPTEAVNQRDADILFLWHMYKN--SEDGLKKTEILKQ  384

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            ++E  + R ++DGS+D IG  L+G  K 
Sbjct  385  ITETKRHRIHLDGSIDLIGTLLYGPAKG  412



>ref|XP_011081710.1| PREDICTED: vacuolar-processing enzyme [Sesamum indicum]
Length=485

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 132/206 (64%), Gaps = 8/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V YVEACESGSMFEGLLP   NIYA TAS ++E+S   YCPG DP PPP Y T
Sbjct  199  SGTYKSLVFYVEACESGSMFEGLLPEGLNIYATTASNSEESSYAIYCPGYDPSPPPAYDT  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGD +S+SWMEDSD HN + ET+  QY+ VK RT +      SHVM+YG + L  + LS
Sbjct  259  CLGDTYSVSWMEDSDSHNLQTETLKQQYQLVKNRTASQDPDLSSHVMQYGDLKLSAETLS  318

Query  364  KYQGYVLPPINVATI-----PMPGT-TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
             Y G   P  +  TI     P P +  ++QRDA++L+ W K+ R   + S  K +  K++
Sbjct  319  VYMG-THPNKDNHTIVYDNSPRPSSGVINQRDADVLHFWHKF-RGAPQGSAKKFEAQKQL  376

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +  M  R ++D S+  IG  +FGT+K
Sbjct  377  AVAMAQRTHVDSSIQLIGKLIFGTDK  402



>dbj|BAA76744.1| asparaginyl endopeptidase (VmPE-1) [Vigna mungo]
Length=483

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 133/207 (64%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +  Y+E CESGS+F GLLP   NIYA TA+ A+E+S G YCPG +P PPPEY T
Sbjct  195  SGTYKSLAFYLEGCESGSIFGGLLPEGLNIYATTAANAEESSWGTYCPGDNPSPPPEYET  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  Q+E VK+RT N  +  GSHVM+YG + L K+ +S
Sbjct  255  CLGDLYSVAWMEDSDIHNLRTETLHQQFELVKQRTMNGNSAYGSHVMQYGDVGLSKNNVS  314

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKR--LGDEKSEMKDKVLKE  522
             Y G        P     ++  P   V+QRDA+L++ W+K+ +  LG   S  K    K+
Sbjct  315  LYLGTNPANDNFPFREKNSLVPPSKAVNQRDADLVHFWDKFPKAPLG---SSRKSVAQKQ  371

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            + E M  R +ID SV  IG  LFG E+
Sbjct  372  ILEAMSHRMHIDDSVTLIGKLLFGIEE  398



>gb|ACC68680.1| vacoular processing enzyme 1 [Solanum tuberosum]
Length=482

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 132/206 (64%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGSMFEGLLP   NIYA TAS ADE+S G YCPG  P PP EY T
Sbjct  195  SGTYKSLVFYLEACESGSMFEGLLPEGLNIYATTASNADESSWGTYCPGEFPSPPIEYGT  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SISWMEDS RHN + ET+  QY  VK+RT +     GSHVM+YG + L KD L 
Sbjct  255  CLGDLYSISWMEDSGRHNLRTETLKQQYHLVKERTASGNPAYGSHVMQYGDVHLSKDVLF  314

Query  364  KYQGYVLPPINVATIPMPGTT------VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
             Y G    P N  +  M   +      V+QRDA+L++ W K+ +   E S  K +  K++
Sbjct  315  LYMG--TDPANDNSTFMDDNSMRVSKAVNQRDADLVHFWYKFHK-APEGSVRKTEAQKQL  371

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E +  R ++D S+  +G  LFG +K
Sbjct  372  NEAISHRMHLDNSIALVGKLLFGIKK  397



>ref|XP_009117035.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme [Brassica 
rapa]
Length=489

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 136/208 (65%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG D   P E+ T
Sbjct  199  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDTSVPSEFET  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLR-KDKL  360
            CLGDL+S++W+EDSD+HN + E++  QYE VKKRT   G+  GSHVME+G + L  K+KL
Sbjct  259  CLGDLYSVAWLEDSDKHNLQTESLHQQYELVKKRTAATGSTYGSHVMEFGDIGLLGKEKL  318

Query  361  SKYQGYVLPPINVATI-------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G  +P    AT        P+ G   +QRDA+L++ WEKYK+   E S  K +  K
Sbjct  319  VLYLG-TIPDNENATFADEISLRPLSGGVTNQRDADLVHFWEKYKK-APEGSARKAEAQK  376

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++ E M  R ++D SV  IG  LFG  +
Sbjct  377  QVLEAMSHRLHVDNSVLLIGKLLFGISE  404



>ref|XP_002993765.1| hypothetical protein SELMODRAFT_137569 [Selaginella moellendorffii]
 gb|EFJ05184.1| hypothetical protein SELMODRAFT_137569 [Selaginella moellendorffii]
Length=438

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 138/208 (66%), Gaps = 12/208 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G Y++MVIY+EACESGSM EGLLP   ++Y  TAS A E+S G YCPG  P  PPEY T
Sbjct  159  SGGYREMVIYIEACESGSMVEGLLPLGLDLYVTTASNAIESSWGTYCPGMLPSAPPEYDT  218

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ET+  QY +VK RT N+ T   GSHVM+YG ++L  + L
Sbjct  219  CLGDLYSVAWMEDSEVHNLKRETLLQQYLDVKDRTSNHNTYEAGSHVMQYGDVELNSNPL  278

Query  361  SKYQGYVLPPINVAT----IPMPGTTVHQRDAELLYLWEKYKRL--GDEKSEMKDKVLKE  522
            S + G+  P I        IP     V QRDA+LL+LW KY+R   G  K E +++++  
Sbjct  279  SMFLGFD-PAIADGNGDLIIPSSANGVSQRDADLLHLWSKYRRAKDGSAKREARERMMNA  337

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            ++     R ++D SVD +G+ LFG++ A
Sbjct  338  LAH----RQHVDESVDQVGERLFGSKAA  361



>gb|EMS56147.1| Vacuolar-processing enzyme [Triticum urartu]
Length=459

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 137/204 (67%), Gaps = 8/204 (4%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGL+P D NIY  TA+ A+E+S   YCPG +  PP EY TCL
Sbjct  173  SYSKMIIYVEACESGSIFEGLMPQDHNIYVTTAANAEESSWAAYCPGMEVPPPSEYKTCL  232

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKLSK  366
            GD +S+SWMEDS+ HN KKE+I  QYE VK RT   N +  GSHVMEYG    + D L  
Sbjct  233  GDAYSVSWMEDSETHNLKKESIKQQYEVVKARTAPPNESSIGSHVMEYGDKTFKGDMLFL  292

Query  367  YQGYVLPPINVAT-----IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
            YQG+  P  + ++     +P     ++QRDA++L++W+KY++L +  SE K + L E+ E
Sbjct  293  YQGFD-PAKSYSSYFRQRLPSLKGAINQRDADILFMWKKYEQL-NGGSEEKQRALTEIKE  350

Query  532  KMQVRAYIDGSVDAIGDYLFGTEK  603
             +  R ++D S+D IG  +FG EK
Sbjct  351  TVLHRKHLDSSIDFIGKLVFGFEK  374



>emb|CAQ00098.1| legumain [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 137/202 (68%), Gaps = 5/202 (2%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KMV+YVEACESGS+FEGL+P D NIY  TA+ A+E+S   YCPG +  PP EY TCL
Sbjct  202  SYSKMVVYVEACESGSIFEGLMPRDHNIYVTTAANAEESSWAAYCPGMEIPPPSEYYTCL  261

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKLSK  366
            GD +S+SWMEDS+ HN KKETI  QYE VK RT   N +  GSHVMEYG    + + L  
Sbjct  262  GDAYSVSWMEDSETHNLKKETIKQQYEVVKARTAPRNKSSIGSHVMEYGDKTFKDEMLFL  321

Query  367  YQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKM  537
            YQG+     ++     +P+    ++QRDA++L++W+KY++L +  SE K + L+++ E +
Sbjct  322  YQGFDPAKSSITNRLPLPILKGAINQRDADVLFMWKKYEQL-NGGSEEKHRALRDIKETV  380

Query  538  QVRAYIDGSVDAIGDYLFGTEK  603
              R ++D S+D IG  +FG +K
Sbjct  381  LHRKHLDSSIDFIGKLVFGFDK  402



>emb|CBX26638.1| vacuolar processing enzyme 2b [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 134/203 (66%), Gaps = 6/203 (3%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGLLP D NIY  TA+ A E+S   YCP  +  PPPEY TCL
Sbjct  202  SYSKMIIYVEACESGSIFEGLLPQDHNIYVTTAANAVEDSWAAYCPKMEIPPPPEYCTCL  261

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKLSK  366
            GD +S+SWMEDS+  + KKE+I  QYE VK RT   N +  GSHVMEYG    ++D L  
Sbjct  262  GDAYSVSWMEDSETQDLKKESIKQQYEVVKARTAPRNESSIGSHVMEYGDQTFKEDMLFL  321

Query  367  YQGY--VLPPINVATIPMPGT--TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEK  534
            YQG+      I    +PMP     ++QRDA++L++W KY++L +  SE K + L+E+ E 
Sbjct  322  YQGFDPAKSSIRNRPLPMPSLKGAINQRDADILFMWRKYEKL-NAGSEEKQRALREVKET  380

Query  535  MQVRAYIDGSVDAIGDYLFGTEK  603
            +  R ++D  +D IG  +FG +K
Sbjct  381  VLHRKHLDSRIDFIGKLVFGFDK  403



>emb|CBX26640.1| vacuolar processing enzyme 2d [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 137/202 (68%), Gaps = 5/202 (2%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KMV+YVEACESGS+FEGL+P D NIY  TA+ A+E+S   YCPG +  PP EY TCL
Sbjct  208  SYSKMVVYVEACESGSIFEGLMPQDHNIYVTTAANAEESSWAAYCPGMEIPPPSEYYTCL  267

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKLSK  366
            GD +S+SWMEDS+ HN KKETI  QYE VK RT   N +  GSHVMEYG    + + L  
Sbjct  268  GDAYSVSWMEDSETHNLKKETIKQQYEVVKARTAPGNKSSIGSHVMEYGDKTFKDEMLFL  327

Query  367  YQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKM  537
            YQG+     ++     +P+    ++QRDA++L++W+KY++L +  SE K + L+++ E +
Sbjct  328  YQGFDPAKSSITNRLPLPILKGAINQRDADVLFMWKKYEQL-NGGSEEKHRALRDIKETV  386

Query  538  QVRAYIDGSVDAIGDYLFGTEK  603
              R ++D S+D IG  +FG +K
Sbjct  387  LHRKHLDSSIDFIGKLVFGFDK  408



>sp|B8ASK4.1|VPE1_ORYSI RecName: Full=Vacuolar-processing enzyme beta-isozyme 1; Short=Beta-VPE 
1; Short=OsVPE1; AltName: Full=Asparaginyl endopeptidase 
VPE1; Flags: Precursor [Oryza sativa Indica Group]
 gb|EEC77714.1| hypothetical protein OsI_16797 [Oryza sativa Indica Group]
Length=497

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P + NIY  TAS A ENS G YCPG +P PPPEY T
Sbjct  209  SNSYSKMVIYVEACESGSIFEGLMPENLNIYVTTASNAVENSWGTYCPGEEPSPPPEYIT  268

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGD++S++WMEDS+ HN KKETI  QYE VKKRT N N    GSHVMEYG    + +KL
Sbjct  269  CLGDMYSVAWMEDSETHNLKKETIEDQYELVKKRTSNANKLNEGSHVMEYGDKTFKDEKL  328

Query  361  SKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+      P+P  TV+QRDA+LL++W++Y++L +  SE K + L+E+ +
Sbjct  329  FLYQGFNPANGNITNELIWPVPKATVNQRDADLLFMWKRYEQL-NGVSEDKLRALREIED  387

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +  R ++D S+D IG  +FG E  
Sbjct  388  TIAHRKHLDSSIDFIGKLVFGFENG  412



>ref|XP_006652582.1| PREDICTED: vacuolar-processing enzyme-like [Oryza brachyantha]
Length=500

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P + NIY  TAS A ENS G YCPG +P PPPEY T
Sbjct  212  SNSYSKMVIYVEACESGSIFEGLMPDNLNIYVTTASNAVENSWGTYCPGEEPSPPPEYIT  271

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGD++S++WMEDS+ HN K+ETI  QYE VKKRT N N    GSHVMEYG    + +KL
Sbjct  272  CLGDMYSVAWMEDSETHNLKRETIEDQYEVVKKRTSNANKLNEGSHVMEYGDKTFKDEKL  331

Query  361  SKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+      P+P   V+QRDA+LL++W++Y++L +  SE K KVL+E+ +
Sbjct  332  FLYQGFNPANGNITNELIWPVPKAAVNQRDADLLFMWKRYEQL-NGGSEDKLKVLREIED  390

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +  R ++D S+D IG  +FG E  
Sbjct  391  TIAHRKHLDSSIDFIGKLVFGFENG  415



>ref|NP_001053428.1| Os04g0537900 [Oryza sativa Japonica Group]
 sp|Q84LM2.1|VPE1_ORYSJ RecName: Full=Vacuolar-processing enzyme beta-isozyme 1; Short=Beta-VPE 
1; Short=OsVPE1; AltName: Full=Asparaginyl endopeptidase 
VPE1; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAC76418.1| vacuolar processing enzyme [Oryza sativa Japonica Group]
 dbj|BAF15342.1| Os04g0537900 [Oryza sativa Japonica Group]
 gb|EEE61412.1| hypothetical protein OsJ_15605 [Oryza sativa Japonica Group]
Length=497

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 143/205 (70%), Gaps = 5/205 (2%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            + +Y KMVIYVEACESGS+FEGL+P + NIY  TAS A ENS G YCPG +P PPPEY T
Sbjct  209  SNSYSKMVIYVEACESGSIFEGLMPENLNIYVTTASNAVENSWGTYCPGEEPSPPPEYIT  268

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGD++S++WMEDS+ HN KKETI  QYE VKKRT N N    GSHVMEYG    + +KL
Sbjct  269  CLGDMYSVAWMEDSETHNLKKETIEDQYELVKKRTSNANKLNEGSHVMEYGDKTFKDEKL  328

Query  361  SKYQGYVLPPINVAT---IPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSE  531
              YQG+     N+      P+P  TV+QRDA+LL++W++Y++L +  SE K + L+E+ +
Sbjct  329  FLYQGFNPANGNITNELIWPVPKATVNQRDADLLFMWKRYEQL-NGVSEDKLRALREIED  387

Query  532  KMQVRAYIDGSVDAIGDYLFGTEKA  606
             +  R ++D S+D IG  +FG E  
Sbjct  388  TIAHRKHLDSSIDFIGKLVFGFENG  412



>emb|CDX76736.1| BnaC08g33220D [Brassica napus]
Length=486

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 135/207 (65%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG D   P E+ T
Sbjct  198  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDTSVPSEFET  257

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++W+EDSD+HN + E++  QYE VKKRT   G+  GSHVME+G + L K+KL 
Sbjct  258  CLGDLYSVAWLEDSDKHNLQTESLHQQYELVKKRTAATGSSYGSHVMEFGDIGLSKEKLV  317

Query  364  KYQGYVLPPINVATI-------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G   P    AT        P  G T +QRDA+L++ WEKYK+   E S  K +  K+
Sbjct  318  LYLG-TNPDNENATFADENSLRPFSGVT-NQRDADLVHFWEKYKK-APEGSARKAEAQKQ  374

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            + E M  R ++D S+  IG  LFG  +
Sbjct  375  VLEAMSHRLHVDNSLLLIGKLLFGISE  401



>emb|CBX26637.1| vacuolar processing enzyme 2a [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 133/202 (66%), Gaps = 10/202 (5%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGL+P D NIY  TA+ A ENS   YCP  +  PPPEY TCL
Sbjct  131  SYSKMIIYVEACESGSIFEGLMPQDHNIYVTTAANAQENSWAAYCPTMEIPPPPEYDTCL  190

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSKY  369
            GD +S+SWMEDS+  + KKE+I  QYE VK+R     T   SHVMEYG    ++D L  +
Sbjct  191  GDAYSVSWMEDSETQDLKKESIKQQYEVVKER-----TAPLSHVMEYGDKTFKEDMLFLF  245

Query  370  QGY--VLPPINVATIPMPGT--TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKM  537
            QG+      I    +PMP     ++QRDA++L++W KY++L +  SE K + L+E+ E +
Sbjct  246  QGFDPAKSSIRNRPLPMPSLKGAINQRDADILFMWRKYEKL-NAGSEEKQRALREVKETV  304

Query  538  QVRAYIDGSVDAIGDYLFGTEK  603
              R ++D S+D IG  +FG +K
Sbjct  305  LHRKHLDSSIDFIGKLVFGFDK  326



>gb|KHN29737.1| Vacuolar-processing enzyme [Glycine soja]
Length=483

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 133/205 (65%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PP EY T
Sbjct  195  SGSYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPSEYET  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT N  +  GSHVM+YG + L ++ L 
Sbjct  255  CLGDLYSVAWMEDSDIHNLQTETLHQQYELVKQRTMNGNSIYGSHVMQYGDIGLSENNLV  314

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G          ++  ++  P   V+QRDA+L++ W+K+++     S  K    K++ 
Sbjct  315  LYLGTNPANDNFTFVHKNSLVPPSKAVNQRDADLIHFWDKFRK-APVGSSRKAAAEKQIL  373

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID S+  IG  LFG EK
Sbjct  374  EAMSHRMHIDDSMKRIGKLLFGIEK  398



>gb|EPS59704.1| hypothetical protein M569_15100, partial [Genlisea aurea]
Length=431

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 138/211 (65%), Gaps = 12/211 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V YVEACESGS+FEGLLP   NI+A TAS A+ENS G YCPG D  PPPEY T
Sbjct  155  SGTYKSLVFYVEACESGSIFEGLLPEGLNIFATTASNAEENSWGTYCPGDDIGPPPEYET  214

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTW-NNGTGGGSHVMEYGSMDLRKDKL  360
            CLGD++S+SWMEDSD+HN + ET+  QY  V++RT  +N    GSHVM+YG + L  DKL
Sbjct  215  CLGDMYSVSWMEDSDQHNLRTETLRQQYHVVRERTARDNSHRYGSHVMQYGDLKLSVDKL  274

Query  361  SKYQGYVLPPINV---ATIPMPGTT-------VHQRDAELLYLWEKYKRLGDEKSEMKDK  510
              Y G      N     ++ + G +       V QRDA++L+ W+K+++   E S  K +
Sbjct  275  FLYMGSNPSNDNSTFGGSVHLSGNSSWPSSMAVSQRDADVLHFWDKFRK-APEGSSRKAE  333

Query  511  VLKEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              K+++E M  R+ +D SV +IG  LFG+ +
Sbjct  334  AQKQLAEVMVRRSRVDISVVSIGKLLFGSSE  364



>emb|CDY71653.1| BnaCnng73810D, partial [Brassica napus]
Length=255

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
             GTYK+MVIYVEACESGS+FEG++P D NIY  TAS A E+S G YCPG +P PP EY T
Sbjct  80   TGTYKEMVIYVEACESGSIFEGIMPKDLNIYVTTASNAQESSYGTYCPGMNPSPPSEYIT  139

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMED + HN KKET+  QY+ VK RT N N    GSHVMEYG+  ++ +KL
Sbjct  140  CLGDLYSVAWMEDCETHNLKKETVKQQYQTVKMRTSNYNTYSEGSHVMEYGNNSIKSEKL  199

Query  361  SKYQGY----VLPPINVATIPMPGTTVHQRDAELLYLWE  465
              YQG+    V  P N   +  P   V+QRDA+LL+LW 
Sbjct  200  YLYQGFDPATVNLPRNELPVKSPVGVVNQRDADLLFLWH  238



>sp|P49044.1|VPE_VICSA RecName: Full=Vacuolar-processing enzyme; Short=VPE; AltName: 
Full=Proteinase B; Flags: Precursor [Vicia sativa]
 emb|CAA84383.1| cysteine proteinase [Vicia sativa]
Length=493

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 139/210 (66%), Gaps = 12/210 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP D NIYA TAS A+E+S G+YCPG  P PPPEY+T
Sbjct  203  SGTYKSLVFYLEACESGSIFEGLLPDDLNIYATTASNAEESSWGYYCPGDKPPPPPEYST  262

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SI+WMEDS+ HN + E++  QY+ VK RT +     GSHVMEYG + L K+ L 
Sbjct  263  CLGDLYSIAWMEDSEVHNLQTESLQQQYKLVKNRTISEPY--GSHVMEYGDIGLSKNDLY  320

Query  364  KYQG---------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
            +Y G         +V    N   +  P   V+QRDA+L++ WEK+++   E S  K++  
Sbjct  321  QYLGTNPANDNNSFVDETENSLKLRTPSAAVNQRDADLIHFWEKFRK-APEGSSQKNEAE  379

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            K++ E M  R +ID SV  IG  LFG EK 
Sbjct  380  KQVLEAMSHRKHIDNSVKLIGQLLFGIEKG  409



>ref|XP_004245113.1| PREDICTED: vacuolar-processing enzyme-like [Solanum lycopersicum]
Length=482

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 132/206 (64%), Gaps = 9/206 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGSMFEGLLP   NIYA TAS ADE+S G YCPG  P PP EY T
Sbjct  195  SGTYKSLVFYLEACESGSMFEGLLPEGLNIYATTASNADESSWGTYCPGEYPSPPIEYDT  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SISWMEDS+RHN + E++  QY  VK+RT +     GSHVM+YG + L KD + 
Sbjct  255  CLGDLYSISWMEDSERHNLRTESLKQQYHLVKERTASGNPAYGSHVMQYGDVHLSKDAVF  314

Query  364  KYQGYVLPPINVATIPMPGTT------VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
             Y G    P N  +  M   +      V+QRDA+L++ W K+ +   E S  K +  K +
Sbjct  315  LYMG--TDPANDNSTFMDDNSLRVSKAVNQRDADLVHFWYKFHK-APEGSVSKTEAQKRL  371

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEK  603
            +E +  R ++D S+  +G  LFG +K
Sbjct  372  NEAISHRMHLDNSIALVGKLLFGIKK  397



>ref|XP_007023637.1| Delta vacuolar processing enzyme, putative [Theobroma cacao]
 gb|EOY26259.1| Delta vacuolar processing enzyme, putative [Theobroma cacao]
Length=527

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 134/212 (63%), Gaps = 13/212 (6%)
 Frame = +1

Query  1    EAGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYT  180
            EA +YK MV+YVEACESGSMFEG+LP++ NIYA+TA+ A ENS G YCP   P  P E+ 
Sbjct  245  EAKSYKSMVLYVEACESGSMFEGILPNNLNIYAITAANAVENSWGTYCPEGYPSSPSEFD  304

Query  181  TCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKL  360
            TCLGDLFSISWMEDSD H+ + ET+  QY+ V++RT  +     SHVM+YG+M L KD L
Sbjct  305  TCLGDLFSISWMEDSDIHDLRNETLEQQYQVVRRRTAVDNLVVSSHVMQYGNMTLEKDVL  364

Query  361  SKYQGYVLPPIN-----VATI-----PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDK  510
              Y G    P N      AT      PM    V QRDA LL+LW K+ R  +E +E K +
Sbjct  365  FSYMG--TNPANDNYKPTATAHPMNSPMSSKVVSQRDASLLHLWHKFHRAPEESAE-KAE  421

Query  511  VLKEMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
              K + +++  R +ID S++ I   LFG +  
Sbjct  422  AHKRLLDELSHRKHIDRSINQIIAILFGHQNV  453



>emb|CDY11506.1| BnaA09g40720D [Brassica napus]
Length=489

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 135/208 (65%), Gaps = 10/208 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A+E+S G YCPG D   P E+ T
Sbjct  199  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAEESSWGTYCPGEDTSVPSEFET  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLR-KDKL  360
            CLGDL+S++W+EDSD+HN + E++  QYE VKKRT   G+  GSHVME+G + L  K+KL
Sbjct  259  CLGDLYSVAWLEDSDKHNLQTESLHQQYELVKKRTAATGSTYGSHVMEFGDIGLLGKEKL  318

Query  361  SKYQGYVLPPINVATI-------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLK  519
              Y G   P    AT        P+ G   +QRDA+L++ WEKYK+   E S  K +  K
Sbjct  319  VLYLG-TNPDNENATFADENSLRPLSGGVTNQRDADLVHFWEKYKK-APEGSSRKAEAQK  376

Query  520  EMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++ E M  R ++D SV  IG  LFG  +
Sbjct  377  QVLEAMSHRLHVDNSVLLIGKLLFGISE  404



>ref|NP_001275272.1| vacoular processing enzyme 2 precursor [Solanum tuberosum]
 gb|ACC68681.1| vacoular processing enzyme 2 [Solanum tuberosum]
Length=461

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 130/207 (63%), Gaps = 11/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGSM EGLLP   N+YA TAS ADE+S G YCPG  P PP EY T
Sbjct  195  SGTYKSLVFYLEACESGSMSEGLLPEGLNVYATTASNADESSWGTYCPGEYPSPPIEYGT  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SISWMEDSDRHN + ET+  QY  VK+RT +     GSHVM+YG + L KD L 
Sbjct  255  CLGDLYSISWMEDSDRHNLRTETLKQQYHLVKERTASGNPAYGSHVMQYGDVHLSKDALF  314

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y     N   +      V+QRDA+L++ W K+ +   E S  K +  K+
Sbjct  315  LYMGTDPANDNYTFVDDNSLRV---SKAVNQRDADLVHFWYKFHK-APEGSVRKTEAQKQ  370

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++E +  R ++D S+  +G  LFG +K
Sbjct  371  LNEAISHRMHLDNSIALVGKLLFGIKK  397



>gb|EPS65165.1| vacuolar processing enzyme-1b, partial [Genlisea aurea]
Length=478

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 135/205 (66%), Gaps = 9/205 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEG+LP + NIYA TAS A+E+S G YCPG    PP EY T
Sbjct  188  SGTYKSLVFYLEACESGSIFEGILPDNLNIYATTASNAEESSWGTYCPGDIIAPPLEYDT  247

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SI+WMEDSD HN + E++  QY+ VKKRT N  +  GSHVM+YG + L  + L 
Sbjct  248  CLGDLYSIAWMEDSDIHNLRTESLEQQYQVVKKRTANGDSYYGSHVMQYGELKLDLENLF  307

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       Y     N  +   P   V+QRDA+LL+ W K+ +   E+S  KD+  + 
Sbjct  308  LYLGTDPANDNYTFVEGNSLSTS-PSGRVNQRDADLLHFWHKFWK-APERSSEKDEAQRR  365

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGT  597
            ++E +  R++ID S++ IGD LFG+
Sbjct  366  LAEVVSHRSHIDDSIELIGDLLFGS  390



>gb|AAD04882.1| C13 endopeptidase NP1 precursor [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 132/202 (65%), Gaps = 10/202 (5%)
 Frame = +1

Query  10   TYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTCL  189
            +Y KM+IYVEACESGS+FEGL+P D NIY  TA+ A ENS   YCP  +  PPPEY TCL
Sbjct  131  SYSKMIIYVEACESGSIFEGLMPQDHNIYVTTAANAQENSWAAYCPTMEIPPPPEYDTCL  190

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLSKY  369
            GD +S+SWMEDS+  + K E+I  QYE VK+R     T   SHVMEYG    ++D L  +
Sbjct  191  GDAYSVSWMEDSETQDLKNESIKQQYEVVKER-----TAPLSHVMEYGDKTFKEDMLFLF  245

Query  370  QGY--VLPPINVATIPMPGT--TVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKM  537
            QG+      I    +PMP     ++QRDA++L++W KY++L +  SE K + L+E+ E +
Sbjct  246  QGFDPAKSSIRNRPLPMPSLKGAINQRDADILFMWRKYEKL-NAGSEEKQRALREVKETV  304

Query  538  QVRAYIDGSVDAIGDYLFGTEK  603
              R ++D S+D IG  +FG +K
Sbjct  305  LHRKHLDSSIDFIGKLVFGFDK  326



>ref|XP_006578073.1| PREDICTED: vacuolar-processing enzyme-like [Glycine max]
Length=483

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 131/205 (64%), Gaps = 6/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PP EY T
Sbjct  195  SGSYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPSEYET  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT N  +  GSHVM+YG + L ++ L 
Sbjct  255  CLGDLYSVAWMEDSDIHNLQTETLHQQYELVKQRTMNGNSIYGSHVMQYGDIGLSENNLV  314

Query  364  KYQGYVLPPINVA-----TIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             Y G      N       ++  P   V+QRDA+L++ W+K+++     S  K    K++ 
Sbjct  315  LYLGTNPANDNFTFVLKNSLVPPSKAVNQRDADLIHFWDKFRK-APVGSSRKAAAEKQIL  373

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R +ID S+  IG   FG EK
Sbjct  374  EAMSHRMHIDDSMKRIGKLFFGIEK  398



>dbj|BAC86022.1| unnamed protein product [Homo sapiens]
Length=483

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 134/209 (64%), Gaps = 14/209 (7%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +G+YK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PP EY T
Sbjct  195  SGSYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPSEYET  254

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN + ET+  QYE VK+RT N  +  GSHVM+YG + L ++ L 
Sbjct  255  CLGDLYSVAWMEDSDIHNLQTETLHQQYELVKQRTMNGNSIYGSHVMQYGDIGLSENNLV  314

Query  364  KYQG---------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
             Y G         +VL     + +P P   V+QRDA+L++ W+K+++     S  K    
Sbjct  315  LYLGTNPANDNFTFVL---KNSLVP-PSKAVNQRDADLIHFWDKFRK-APVGSSRKAAAE  369

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            K++ E M  R +ID S+  IG   FG EK
Sbjct  370  KQILEAMSHRMHIDDSMKRIGKLFFGIEK  398



>ref|XP_008444493.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis melo]
Length=493

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 133/207 (64%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+YK +V Y+EACESGS+FEGLLP   NIY  TAS A E+S G YCPG  P PPPEY T
Sbjct  205  AGSYKSLVFYLEACESGSIFEGLLPEGLNIYTTTASNAYESSWGTYCPGDYPGPPPEYDT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++W+EDSD HN K E++  QYE VKKRT ++    GSHVM+YG + L K+ L 
Sbjct  265  CLGDLYSVAWLEDSDNHNLKTESLRQQYELVKKRTLSDQYAYGSHVMQYGDLKLNKNALF  324

Query  364  KYQGYVLPPINVATIPM------PGTT-VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G    P N     +      P T   +QRDA+L++ WEK+++   E S  K +  K+
Sbjct  325  SYLG--TDPANENNTFVEENSLRPATKFTNQRDADLVHFWEKFRK-APEGSLTKVEAQKK  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  RA+ID SV  +G  LFG ++
Sbjct  382  FVEAMSHRAHIDNSVMLVGKLLFGIKE  408



>ref|XP_004142919.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
 gb|KGN62401.1| Vacuolar processing enzyme [Cucumis sativus]
Length=493

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 132/207 (64%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+YK +V Y+EACESGS+FEGLLP   NIY  TAS A E+S G YCPG  P PPPEY T
Sbjct  205  AGSYKSLVFYLEACESGSIFEGLLPEGLNIYTTTASNAYESSWGTYCPGDYPSPPPEYDT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++W+EDSD HN K E++  QYE VKKRT +     GSHVM+YG + L K+ L 
Sbjct  265  CLGDLYSVAWLEDSDNHNLKTESLRQQYELVKKRTLSGQYAYGSHVMQYGDLMLNKNALF  324

Query  364  KYQGYVLPPINVATIPM------PGTT-VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G    P N     +      P T   +QRDA+L++ WEK+++   E S  K +  K+
Sbjct  325  SYLG--TDPANENNTFVEENSLRPATKFTNQRDADLVHFWEKFRK-APEGSLTKVEAQKK  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  RA+ID SV  +G  LFG ++
Sbjct  382  FVEAMSHRAHIDNSVKLVGKLLFGIKE  408



>ref|XP_009616670.1| PREDICTED: vacuolar-processing enzyme-like [Nicotiana tomentosiformis]
 dbj|BAC54828.1| vacuolar processing enzyme-1b [Nicotiana tabacum]
Length=489

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 130/207 (63%), Gaps = 9/207 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG  P PP EY T
Sbjct  202  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEYPSPPIEYMT  261

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+SISWMEDS+ HN + E++  QY  VK+RT       GSHVM+YG + L KD L 
Sbjct  262  CLGDLYSISWMEDSELHNLRTESLKQQYHLVKERTATGNPVYGSHVMQYGDLHLSKDALY  321

Query  364  KYQGYVLPPINVATIPMPGTT------VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEM  525
             Y G    P N     M   +      V+QRDA+LL+ W K+ R   E S  K +  K++
Sbjct  322  LYMG--TNPANDNYTFMDDNSLRVSKAVNQRDADLLHFWHKF-RTAPEGSVRKIEAQKQL  378

Query  526  SEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            +E +  R ++D SV  +G  LFG EK 
Sbjct  379  NEAISHRVHLDNSVALVGKLLFGIEKG  405



>ref|NP_180165.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
 sp|P49047.2|VPEA_ARATH RecName: Full=Vacuolar-processing enzyme alpha-isozyme; AltName: 
Full=Alpha-VPE; AltName: Full=Asparaginyl endopeptidase 
alpha-VPE; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC31241.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 dbj|BAA09614.2| alpha-VPE [Arabidopsis thaliana]
 gb|AAL24163.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAL90957.1| At2g25940/F17H15.3 [Arabidopsis thaliana]
 gb|AAM15043.1| putative vacuolar processing enzyme [Arabidopsis thaliana]
 gb|AEC07775.1| alpha-vacuolar processing enzyme [Arabidopsis thaliana]
Length=478

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 128/192 (67%), Gaps = 6/192 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TAS A+E+S G YCPG DP PP EY T
Sbjct  191  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCPGEDPSPPSEYET  250

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++W+EDS++HN + ET+  QYE VKKRT  +G   GSHVME+G + L K+KL 
Sbjct  251  CLGDLYSVAWIEDSEKHNLQTETLHEQYELVKKRTAGSGKSYGSHVMEFGDIGLSKEKLV  310

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             + G          +N  +I  P    +QRDA+L++ W KY++   E S  K +  K++ 
Sbjct  311  LFMGTNPADENFTFVNENSIRPPSRVTNQRDADLVHFWHKYQK-APEGSARKVEAQKQVL  369

Query  529  EKMQVRAYIDGS  564
            E M  R ++D S
Sbjct  370  EAMSHRLHVDNS  381



>ref|XP_010244352.1| PREDICTED: vacuolar-processing enzyme-like [Nelumbo nucifera]
Length=485

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 136/210 (65%), Gaps = 13/210 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPG--SDPLPPPEY  177
            +GTY+ +V Y+EACESGS+FEGLLP   NIYA TAS ADE+S G YCPG  +DP PPPEY
Sbjct  196  SGTYRSLVFYLEACESGSIFEGLLPEGLNIYATTASNADESSWGTYCPGEFTDP-PPPEY  254

Query  178  TTCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDK  357
             TCLGDL+S++WMEDS+ HN + E++  QY+ VK+RT +  +  GSHVM+YG + L   +
Sbjct  255  ETCLGDLYSVAWMEDSEVHNLRTESLRQQYQLVKRRTSSGNSAFGSHVMQYGDLRLSSAE  314

Query  358  LSKYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVL  516
            L  Y G       Y    I+   +P    TV+QRDA+LL+ W K+++   E S  K K  
Sbjct  315  LFLYMGTNPANDNYTF--IDENKLPSSIQTVNQRDADLLHFWHKFRK-APEGSPKKFKAQ  371

Query  517  KEMSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            K+  + M  R +ID S+  IG  LFG EK 
Sbjct  372  KQFLDMMSHRMHIDHSMMLIGKLLFGYEKG  401



>ref|XP_004159537.1| PREDICTED: vacuolar-processing enzyme-like [Cucumis sativus]
Length=493

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 132/207 (64%), Gaps = 10/207 (5%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG+YK +V Y+EACESGS+FEGLLP   NIY  TAS A E+S G YCPG  P PPPEY T
Sbjct  205  AGSYKSLVFYLEACESGSIFEGLLPEGLNIYTTTASNAYESSWGTYCPGDYPSPPPEYDT  264

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++W+EDSD HN K E++  QYE VKKRT +     GSHVM+YG + L K+ L 
Sbjct  265  CLGDLYSVAWLEDSDNHNLKTESLRQQYELVKKRTISGQYAYGSHVMQYGDLMLNKNALF  324

Query  364  KYQGYVLPPINVATIPM------PGTT-VHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G    P N     +      P T   +QRDA+L++ WEK+++   E S  K +  K+
Sbjct  325  SYLG--TDPANENNTFVEENSLRPATKFTNQRDADLVHFWEKFRK-APEGSLTKVEAQKK  381

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              E M  RA+ID SV  +G  LFG ++
Sbjct  382  FVEAMSHRAHIDNSVKLVGKLLFGIKE  408



>gb|KJB54730.1| hypothetical protein B456_009G046800 [Gossypium raimondii]
Length=465

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 130/200 (65%), Gaps = 11/200 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLL-PHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYT  180
            +GTYK +V Y+EACESGS+F+GLL P   NIYA TAS A E+S   YCPG  P  PPEY 
Sbjct  200  SGTYKSLVFYIEACESGSIFDGLLDPKGLNIYATTASNATESSWATYCPGGQPSAPPEYD  259

Query  181  TCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKL  360
            TCLGDL+S++W+EDS+ H+ + ET+  QY+NVKKR         SHVM+YG + L  D L
Sbjct  260  TCLGDLYSVAWIEDSEAHDPRTETLQQQYQNVKKRATT------SHVMQYGDIVLSLDHL  313

Query  361  SKYQGYVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMSEKMQ  540
            S Y G      N+     P T ++QRDA+L++ WEKY++   E S  K +  K++ E M 
Sbjct  314  SVYFGENTAKYNLQP---PTTAINQRDADLVHFWEKYRK-APEGSAKKAEAQKQLVEIMS  369

Query  541  VRAYIDGSVDAIGDYLFGTE  600
             R +ID SV  IG+ LFGTE
Sbjct  370  HRMHIDTSVKLIGNLLFGTE  389



>emb|CAQ00100.1| legumain [Hordeum vulgare subsp. vulgare]
 emb|CBX26642.1| vacuolar processing enzyme 4 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99424.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 135/207 (65%), Gaps = 12/207 (6%)
 Frame = +1

Query  13   YKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDP-LPPPEYTTCL  189
            YK +V Y+EACESGS+FEGLLP + ++YA TA+ A+E+S G YCPG D   PPPEY TCL
Sbjct  193  YKSLVFYLEACESGSIFEGLLPGNISVYATTAANAEESSWGTYCPGDDEGAPPPEYDTCL  252

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKLSK  366
            GDL+S++WMEDSD HN   E++  QYE V+ RT  +GT   GSHVM+YG + L    L +
Sbjct  253  GDLYSVAWMEDSDAHNLNAESLKQQYERVRNRTSADGTYSLGSHVMQYGDLGLNDQSLFQ  312

Query  367  YQGYVLPPINVATI--------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            Y G   P  + AT          +PG  V+QRDA+L++ W KY+R  +  +E K +  + 
Sbjct  313  YIG-TNPANDNATFVQSSSSSRQLPGARVNQRDADLVHFWHKYRRSAEGSAE-KVEARRR  370

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            + E M  R+ +D SV+ IG  LFG+E+
Sbjct  371  LVETMARRSRVDSSVELIGGLLFGSEE  397



>ref|XP_009396761.1| PREDICTED: vacuolar-processing enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 137/210 (65%), Gaps = 16/210 (8%)
 Frame = +1

Query  7    GTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTTC  186
            G+YK MV Y+EACESGS+FEGLLP++ NIYA TA+ A E+S   YCPG  P PPP++TTC
Sbjct  154  GSYKSMVFYLEACESGSIFEGLLPNNINIYATTAANAMESSYATYCPGMFPSPPPQFTTC  213

Query  187  LGDLFSISWMEDSDRHNRKKETISGQYENVKKRT-WNNGTGGGSHVMEYGSMDLRKDKLS  363
            LGDL+S+SWMEDS  H+ + ET++ QY+ VK RT  +N    GSHVM+Y  + L   KLS
Sbjct  214  LGDLYSVSWMEDSYVHDWRTETLAQQYQLVKNRTAVHNTYYFGSHVMQYADLRLNTQKLS  273

Query  364  KYQGY------VLPPINVATIPMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKV  513
             Y G+      V P  N    P+P +T    V+QRDAEL++ W K  +   E S  K   
Sbjct  274  LYVGFDPSGDGVTPVAN----PLPSSTQTVVVNQRDAELIHFWLKLHK-ASEGSPQKLDA  328

Query  514  LKEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
             K++ + ++ R+++D SV  IG+ LFG+E 
Sbjct  329  QKQLLQVLEHRSHVDKSVRLIGNLLFGSEN  358



>gb|KDO48393.1| hypothetical protein CISIN_1g016176mg [Citrus sinensis]
Length=282

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 119/173 (69%), Gaps = 11/173 (6%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            A +YK MVIYVEACESGS+FEG++P D +IY  TAS A E+S G YCPG DP PPPEY T
Sbjct  107  AKSYKGMVIYVEACESGSIFEGVMPKDLDIYVTTASNAQESSFGTYCPGMDPSPPPEYIT  166

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWN-NGTGGGSHVMEYGSMDLRKDKL  360
            CLGDL+S++WMEDS+ HN K+ETIS QY+ VK+RT N N    GSHVMEYG+  ++ +KL
Sbjct  167  CLGDLYSVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKL  226

Query  361  SKYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMK  504
              YQG+       PP  +    M    V+QRDA+LL++W   +   D+K   K
Sbjct  227  YLYQGFDPASTNFPPNKLQPDQM--GVVNQRDADLLFMWHMQR---DQKRNQK  274



>ref|XP_004960991.1| PREDICTED: vacuolar-processing enzyme-like [Setaria italica]
Length=473

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 140/212 (66%), Gaps = 16/212 (8%)
 Frame = +1

Query  1    EAGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYT  180
            +AG Y+ +V Y+EACESGS+FEGLLP   N+YA TA+ A+E+S G YCPG D  PPPE+ 
Sbjct  195  DAGGYRSLVFYLEACESGSIFEGLLPEGINVYATTAANAEESSWGTYCPGDDQGPPPEFD  254

Query  181  TCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDK  357
            TCLGDL+S++WMEDSD HN + E++  QYE VK RT  +GT   GSHVM+YG   L    
Sbjct  255  TCLGDLYSVAWMEDSDVHNLRTESLKQQYEVVKDRTSAHGTYSLGSHVMQYGDQSLNGQS  314

Query  358  LSKYQGYVLPPINVATIPMPGT-------TVHQRDAELLYLWEKYKRLGD---EKSEMKD  507
            L ++ G   P  + AT     +       TV+QRDA+L+Y W+KYK+  +   EK+E + 
Sbjct  315  LYQFIG-TDPANDNATFGRDNSLRRRSSGTVNQRDADLVYFWQKYKKSAEGTPEKAEARK  373

Query  508  KVLKEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
            ++L+ MS     R+ +D S++ IG  LFG+++
Sbjct  374  RLLQVMSR----RSRVDSSMELIGSLLFGSDE  401



>gb|ABR18199.1| unknown [Picea sitchensis]
Length=493

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 145/210 (69%), Gaps = 10/210 (5%)
 Frame = +1

Query  1    EAGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYT  180
            +AG+Y++MVIYVEACESGS+FEGLLP D NIY  TAS A+ENS G YCPG DP PPPEY 
Sbjct  200  DAGSYREMVIYVEACESGSIFEGLLPTDLNIYVTTASNAEENSWGTYCPGMDPPPPPEYD  259

Query  181  TCLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDK  357
            TCLGDL+S++WMEDS+ +N K+ET+  QY+ VK RT N+ T   GSHVM+YG++ + +++
Sbjct  260  TCLGDLYSVAWMEDSEINNLKEETLLQQYDLVKLRTSNHNTYMSGSHVMQYGNITISQEE  319

Query  358  LSKYQGYVLPPINVATI----PMPGTT----VHQRDAELLYLWEKYKRLGDEKSEMKDKV  513
            L  Y G+     N + +    P+   T    ++QRDA+LLY+W+KYK+   E S  +   
Sbjct  320  LYLYMGFDSANSNASLVLENSPLLEKTEAKAINQRDADLLYMWQKYKK-SKEDSPERLTA  378

Query  514  LKEMSEKMQVRAYIDGSVDAIGDYLFGTEK  603
              ++ E M  R ++D SV  +G+ LFG EK
Sbjct  379  QTQLLEFMAHRMHVDKSVKLVGNLLFGPEK  408



>gb|KHG17266.1| Vacuolar-processing enzyme [Gossypium arboreum]
Length=463

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 126/188 (67%), Gaps = 8/188 (4%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +V Y+EACESGS+FEGLLP   NIYA TA+ A E+S G YCPG  P PPPEY T
Sbjct  199  SGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTAANAVESSWGTYCPGEYPSPPPEYET  258

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD HN +KET+  QYE VK+RT N  +  GSHVM++G + +  D L 
Sbjct  259  CLGDLYSVAWMEDSDIHNLRKETLHQQYELVKRRTINGNSAYGSHVMQFGDIGISMDNLF  318

Query  364  KYQGY-----VLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGD---EKSEMKDKVLK  519
             Y G          ++  ++  P   V+QRDA+L++ W+KY++  D    K E + +V++
Sbjct  319  TYLGTNPANDNFKSVDENSLLPPTKAVNQRDADLVHFWDKYRKAPDGSVRKVEAQKQVME  378

Query  520  EMSEKMQV  543
             MS +M V
Sbjct  379  AMSHRMHV  386



>ref|XP_010429611.1| PREDICTED: vacuolar-processing enzyme alpha-isozyme-like isoform 
X2 [Camelina sativa]
Length=479

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 131/206 (64%), Gaps = 14/206 (7%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            +GTYK +     ACESGS+FEGLLP   NIYA TAS A E+S G YCPG DP PP EY T
Sbjct  196  SGTYKSL-----ACESGSIFEGLLPEGLNIYATTASNAVESSWGTYCPGEDPSPPSEYET  250

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+S++WMEDSD+HN + E++  QYE VKKRT   G+  GSHV+E+G + L K+KL 
Sbjct  251  CLGDLYSVAWMEDSDKHNLQTESLHQQYELVKKRTAGTGSSYGSHVLEFGDIGLSKEKLV  310

Query  364  KYQG-------YVLPPINVATIPMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
             Y G       +     N+   P P    +QRDA+L++ W+KY++   E S  K +  K+
Sbjct  311  LYMGTNPANENFTFVDENLLLRP-PSRVTNQRDADLVHFWDKYRK-APEGSARKVEAQKQ  368

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTE  600
            + E M  R ++D SV  IG  LFG E
Sbjct  369  VIEAMSHRLHVDNSVLLIGKLLFGLE  394



>gb|ACB30368.1| vascular processing enzyme-3 [Capsicum annuum]
Length=484

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 129/205 (63%), Gaps = 7/205 (3%)
 Frame = +1

Query  4    AGTYKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDPLPPPEYTT  183
            AG YK +V+Y+EACESGS+FEGLLP   NIYA TAS A E+S G YCPG  P PPPEY T
Sbjct  197  AGAYKSLVLYIEACESGSIFEGLLPTGLNIYATTASNAVESSWGTYCPGEYPSPPPEYET  256

Query  184  CLGDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGTGGGSHVMEYGSMDLRKDKLS  363
            CLGDL+++SWMEDS+ HN + E +  QY  VK+RT  NG   GSHVM++G + L  + L 
Sbjct  257  CLGDLYAVSWMEDSEMHNLRTENLRQQYHLVKRRT-ANGNTCGSHVMQFGDLQLSMESLF  315

Query  364  KYQGYVLPPINVATIP-----MPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKEMS  528
             + G      N   +           V+QRDA+LL+ W+K+++   E S  K +  K+ +
Sbjct  316  SFMGTNPANDNYTYVDDNSLWASSRAVNQRDADLLHFWDKFRK-APEGSARKVEAQKQFT  374

Query  529  EKMQVRAYIDGSVDAIGDYLFGTEK  603
            E M  R ++D S+  +G  LFG +K
Sbjct  375  EAMSHRMHLDNSIALVGKLLFGIQK  399



>gb|EMT06055.1| Vacuolar-processing enzyme [Aegilops tauschii]
Length=492

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 131/208 (63%), Gaps = 11/208 (5%)
 Frame = +1

Query  13   YKKMVIYVEACESGSMFEGLLPHDWNIYAMTASAADENSSGWYCPGSDP-LPPPEYTTCL  189
            YK +V Y+EACESGS+FEGLLP +  +YA TA+ A+E+S G YCPG D   PPPEY TCL
Sbjct  211  YKSLVFYLEACESGSIFEGLLPGNIGVYATTAANAEESSWGTYCPGDDEGAPPPEYDTCL  270

Query  190  GDLFSISWMEDSDRHNRKKETISGQYENVKKRTWNNGT-GGGSHVMEYGSMDLRKDKLSK  366
            GDL+S++WMEDSD HN   E++  QYE V+ RT   GT   GSHVM+YG +DL    L  
Sbjct  271  GDLYSVAWMEDSDAHNLNAESLKQQYERVRDRTSAAGTYSLGSHVMQYGDLDLNDQSLFL  330

Query  367  YQGYVLPPINVATI--------PMPGTTVHQRDAELLYLWEKYKRLGDEKSEMKDKVLKE  522
            Y G      N + +         +PG  V+QRDA+L++ W KY+R   E S  K +  + 
Sbjct  331  YIGTNPANDNASFVQGSSSTSRQLPGGRVNQRDADLVHFWHKYRRSA-EGSAKKGEARRR  389

Query  523  MSEKMQVRAYIDGSVDAIGDYLFGTEKA  606
            + E M  R+ +D SV+ IG  LFG+E+ 
Sbjct  390  LVETMARRSRVDSSVELIGGLLFGSEQG  417



Lambda      K        H        a         alpha
   0.313    0.132    0.406    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230