BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015H04 482 bp,:Filtered

Length=459
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010088502.1|  Mismatch repair endonuclease PMS2                87.0    2e-16   Morus notabilis
ref|XP_003591551.1|  DNA mismatch repair protein                      86.7    2e-16   Medicago truncatula
gb|ABK92950.1|  unknown                                               78.6    8e-16   Populus trichocarpa [western balsam poplar]
gb|KHN46574.1|  Mismatch repair endonuclease PMS2                     84.7    8e-16   Glycine soja [wild soybean]
gb|KDP28142.1|  hypothetical protein JCGZ_13913                       84.7    9e-16   Jatropha curcas
ref|XP_006575115.1|  PREDICTED: DNA mismatch repair protein PMS1-...  84.7    1e-15   Glycine max [soybeans]
ref|XP_011079683.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  84.3    1e-15   Sesamum indicum [beniseed]
gb|KDO87272.1|  hypothetical protein CISIN_1g0414662mg                80.9    1e-15   Citrus sinensis [apfelsine]
ref|XP_010269535.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  84.3    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004136035.1|  PREDICTED: mismatch repair endonuclease PMS2...  84.3    1e-15   
ref|XP_008451591.1|  PREDICTED: DNA mismatch repair protein PMS1      84.0    2e-15   Cucumis melo [Oriental melon]
ref|XP_011079684.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  84.0    2e-15   Sesamum indicum [beniseed]
ref|XP_006444299.1|  hypothetical protein CICLE_v100188991mg          82.0    2e-15   Citrus clementina
ref|XP_007144293.1|  hypothetical protein PHAVU_007G144100g           83.6    2e-15   Phaseolus vulgaris [French bean]
ref|XP_010269534.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  83.2    3e-15   Nelumbo nucifera [Indian lotus]
gb|KHN03729.1|  Mismatch repair endonuclease PMS2                     82.8    4e-15   Glycine soja [wild soybean]
emb|CDP03504.1|  unnamed protein product                              82.8    4e-15   Coffea canephora [robusta coffee]
ref|XP_003536886.1|  PREDICTED: DNA mismatch repair protein PMS1-...  82.4    5e-15   Glycine max [soybeans]
ref|XP_004495972.1|  PREDICTED: DNA mismatch repair protein PMS1-...  82.4    5e-15   Cicer arietinum [garbanzo]
ref|XP_002523056.1|  DNA mismatch repair protein pms2, putative       82.4    6e-15   
ref|XP_008386660.1|  PREDICTED: DNA mismatch repair protein PMS1      82.0    8e-15   Malus domestica [apple tree]
ref|XP_006480112.1|  PREDICTED: DNA mismatch repair protein PMS1-...  81.6    1e-14   
gb|KJB49940.1|  hypothetical protein B456_008G146300                  81.3    1e-14   Gossypium raimondii
gb|KHG16579.1|  Mismatch repair endonuclease PMS2                     80.9    2e-14   Gossypium arboreum [tree cotton]
emb|CAN75888.1|  hypothetical protein VITISV_023640                   81.3    2e-14   Vitis vinifera
ref|XP_006359387.1|  PREDICTED: DNA mismatch repair protein PMS1-...  80.5    2e-14   Solanum tuberosum [potatoes]
ref|XP_011033555.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  80.5    2e-14   Populus euphratica
ref|XP_011033556.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  80.1    3e-14   Populus euphratica
ref|XP_009791019.1|  PREDICTED: DNA mismatch repair protein PMS1      80.5    3e-14   Nicotiana sylvestris
ref|XP_002321013.1|  DNA mismatch repair family protein               80.5    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009598044.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  80.1    3e-14   Nicotiana tomentosiformis
ref|XP_009598045.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  80.1    3e-14   Nicotiana tomentosiformis
ref|XP_010038198.1|  PREDICTED: DNA mismatch repair protein PMS1      80.1    3e-14   Eucalyptus grandis [rose gum]
ref|XP_010684604.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  80.1    3e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004247536.1|  PREDICTED: DNA mismatch repair protein PMS1      80.1    3e-14   Solanum lycopersicum
emb|CBI36837.3|  unnamed protein product                              80.1    4e-14   Vitis vinifera
ref|XP_010684598.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  79.7    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010652175.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  79.7    4e-14   Vitis vinifera
gb|KCW50018.1|  hypothetical protein EUGRSUZ_K03466                   79.7    5e-14   Eucalyptus grandis [rose gum]
ref|XP_010652177.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  79.7    5e-14   Vitis vinifera
ref|XP_010522786.1|  PREDICTED: DNA mismatch repair protein PMS1      79.3    7e-14   Tarenaya hassleriana [spider flower]
gb|EYU46682.1|  hypothetical protein MIMGU_mgv1a024383mg              78.6    9e-14   Erythranthe guttata [common monkey flower]
ref|XP_011458719.1|  PREDICTED: DNA mismatch repair protein PMS1      78.6    1e-13   Fragaria vesca subsp. vesca
ref|XP_008235055.1|  PREDICTED: DNA mismatch repair protein PMS1      78.2    1e-13   Prunus mume [ume]
ref|XP_006840542.1|  hypothetical protein AMTR_s00045p00213360        77.8    2e-13   Amborella trichopoda
ref|XP_007050885.1|  DNA mismatch repair protein pms2, putative i...  77.8    2e-13   Theobroma cacao [chocolate]
ref|XP_007199731.1|  hypothetical protein PRUPE_ppa002523mg           77.0    3e-13   Prunus persica
ref|XP_007050886.1|  DNA mismatch repair protein, putative isoform 2  77.0    3e-13   Theobroma cacao [chocolate]
gb|EPS64298.1|  hypothetical protein M569_10482                       77.0    4e-13   Genlisea aurea
ref|XP_010429737.1|  PREDICTED: DNA mismatch repair protein PMS1-...  74.7    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010456026.1|  PREDICTED: DNA mismatch repair protein PMS1-...  75.1    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006287017.1|  hypothetical protein CARUB_v10000165mg           75.1    2e-12   Capsella rubella
ref|XP_010422584.1|  PREDICTED: DNA mismatch repair protein PMS1-...  75.1    2e-12   Camelina sativa [gold-of-pleasure]
emb|CDX91318.1|  BnaC02g27290D                                        73.6    6e-12   Brassica napus [oilseed rape]
gb|ADE76812.1|  unknown                                               69.3    6e-12   Picea sitchensis
ref|XP_009144562.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  73.2    7e-12   Brassica rapa
ref|XP_009144561.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  73.2    7e-12   Brassica rapa
emb|CDX97265.1|  BnaA02g20560D                                        72.8    1e-11   Brassica napus [oilseed rape]
gb|KFK30838.1|  hypothetical protein AALP_AA6G032200                  72.4    1e-11   Arabis alpina [alpine rockcress]
ref|XP_010914441.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  70.5    5e-11   Elaeis guineensis
ref|XP_010914434.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  70.5    5e-11   Elaeis guineensis
ref|XP_010914440.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  70.1    7e-11   Elaeis guineensis
ref|XP_010914439.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  69.7    1e-10   Elaeis guineensis
ref|XP_008805742.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  68.2    3e-10   
gb|AAC19275.1|  T14P8.6                                               67.4    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872835.1|  hypothetical protein ARALYDRAFT_490319           67.0    8e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_567236.1|  DNA mismatch repair protein PMS1                    67.0    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396455.1|  hypothetical protein EUTSA_v10028404mg           67.0    8e-10   Eutrema salsugineum
ref|XP_002454101.1|  hypothetical protein SORBIDRAFT_04g024565        61.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_001785478.1|  predicted protein                                65.1    3e-09   Physcomitrella patens
ref|XP_008861480.1|  hypothetical protein H310_00455                  65.1    3e-09   Aphanomyces invadans
gb|AFW62793.1|  hypothetical protein ZEAMMB73_370746                  61.6    5e-09   Zea mays [maize]
gb|KHJ96730.1|  MutL dimerization domain protein                      60.5    9e-09   Oesophagostomum dentatum [nodule worm]
gb|EMT21505.1|  Mismatch repair endonuclease PMS2                     63.9    1e-08   Aegilops tauschii
ref|XP_002617364.1|  hypothetical protein CLUG_02808                  63.2    1e-08   Clavispora lusitaniae ATCC 42720
ref|XP_002985153.1|  hypothetical protein SELMODRAFT_121896           63.2    1e-08   Selaginella moellendorffii
ref|XP_008678747.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  63.2    2e-08   Zea mays [maize]
ref|XP_009405473.1|  PREDICTED: DNA mismatch repair protein PMS1      62.8    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002969817.1|  hypothetical protein SELMODRAFT_171139           62.4    2e-08   Selaginella moellendorffii
ref|XP_004955044.1|  PREDICTED: DNA mismatch repair protein PMS1-...  62.4    2e-08   
ref|XP_009822431.1|  hypothetical protein H257_01095                  62.4    3e-08   Aphanomyces astaci
ref|XP_006647441.1|  PREDICTED: DNA mismatch repair protein PMS1-...  61.6    5e-08   Oryza brachyantha
ref|XP_003575262.1|  PREDICTED: DNA mismatch repair protein PMS1 ...  61.6    5e-08   Brachypodium distachyon [annual false brome]
ref|XP_009822432.1|  hypothetical protein, variant                    60.8    6e-08   Aphanomyces astaci
ref|XP_008618743.1|  hypothetical protein SDRG_14397                  60.8    8e-08   Saprolegnia diclina VS20
ref|XP_003388127.1|  PREDICTED: mismatch repair endonuclease PMS2...  60.8    8e-08   Amphimedon queenslandica
ref|NP_001047292.1|  Os02g0592300                                     60.5    1e-07   
gb|EHJ64985.1|  putative DNA mismatch repair protein pms2             60.5    1e-07   Danaus plexippus [American monarch]
gb|EYC09890.1|  hypothetical protein Y032_0058g2875                   58.5    1e-07   Ancylostoma ceylanicum
gb|EYC09889.1|  hypothetical protein Y032_0058g2875                   58.5    1e-07   Ancylostoma ceylanicum
ref|XP_003702377.1|  PREDICTED: mismatch repair endonuclease PMS2...  59.7    2e-07   
ref|XP_003961536.1|  PREDICTED: mismatch repair endonuclease PMS2...  59.7    2e-07   Takifugu rubripes [tiger puffer]
ref|XP_002998214.1|  mismatch repair endonuclease pms1, putative      59.3    2e-07   Phytophthora infestans T30-4
gb|EKC38171.1|  Mismatch repair endonuclease PMS2                     59.3    2e-07   Crassostrea gigas
ref|XP_002595431.1|  hypothetical protein BRAFLDRAFT_69263            57.0    3e-07   Branchiostoma floridae
ref|XP_005838471.1|  Pms1 mismatch repair mutL                        58.9    3e-07   Guillardia theta CCMP2712
gb|ESA07485.1|  hypothetical protein GLOINDRAFT_98750                 58.9    3e-07   Rhizophagus irregularis DAOM 181602
gb|ETI30638.1|  hypothetical protein F443_22254                       58.9    3e-07   Phytophthora parasitica P1569
gb|EXX79123.1|  Pms1p                                                 58.9    3e-07   Rhizophagus irregularis DAOM 197198w
gb|ETP28587.1|  hypothetical protein F442_22125                       58.9    4e-07   Phytophthora parasitica P10297
gb|ETO59390.1|  hypothetical protein F444_22247                       58.9    4e-07   Phytophthora parasitica P1976
ref|XP_008915522.1|  hypothetical protein PPTG_18950                  58.9    4e-07   Phytophthora parasitica INRA-310
gb|ETK71041.1|  hypothetical protein L915_21644                       58.9    4e-07   Phytophthora parasitica
ref|XP_011417733.1|  PREDICTED: mismatch repair endonuclease PMS2...  58.9    4e-07   Crassostrea gigas
gb|ETM30970.1|  hypothetical protein L914_21370                       58.9    4e-07   Phytophthora parasitica
gb|ETL77706.1|  hypothetical protein L917_21365                       58.9    4e-07   Phytophthora parasitica
ref|XP_003374110.1|  mismatch repair endonuclease PMS2                58.5    4e-07   Trichinella spiralis
emb|CDK28467.1|  unnamed protein product                              58.5    4e-07   Kuraishia capsulata CBS 1993
gb|KDN40420.1|  hypothetical protein K437DRAFT_269978                 58.5    5e-07   Tilletiaria anomala UBC 951
ref|XP_003031353.1|  hypothetical protein SCHCODRAFT_16115            58.2    5e-07   Schizophyllum commune H4-8
ref|XP_003243755.1|  PREDICTED: mismatch repair endonuclease PMS2     58.2    5e-07   Acyrthosiphon pisum
gb|KFB50618.1|  AGAP007126-PA-like protein                            58.5    5e-07   Anopheles sinensis
dbj|GAN04390.1|  mismatch repair endonuclease PMS2-like               58.2    5e-07   Mucor ambiguus
emb|CAG04443.1|  unnamed protein product                              58.2    5e-07   Tetraodon nigroviridis
ref|XP_001660584.1|  AAEL010033-PA                                    58.2    5e-07   Aedes aegypti
ref|XP_001886812.1|  predicted protein                                57.0    5e-07   Laccaria bicolor S238N-H82
gb|KDR15822.1|  Mismatch repair endonuclease PMS2                     58.2    5e-07   Zootermopsis nevadensis
gb|ETL77708.1|  hypothetical protein, variant 2                       58.2    6e-07   Phytophthora parasitica
gb|ETI30640.1|  hypothetical protein, variant 2                       58.2    6e-07   Phytophthora parasitica P1569
gb|ETO59393.1|  hypothetical protein, variant 3                       57.8    6e-07   Phytophthora parasitica P1976
ref|XP_008915524.1|  hypothetical protein, variant 2                  57.8    6e-07   Phytophthora parasitica INRA-310
gb|ETK71043.1|  hypothetical protein, variant 2                       57.8    6e-07   Phytophthora parasitica
ref|XP_004347900.2|  hypothetical protein CAOG_04075                  58.2    7e-07   Capsaspora owczarzaki ATCC 30864
gb|EPZ35376.1|  DNA mismatch repair protein domain-containing pro...  57.8    7e-07   Rozella allomycis CSF55
gb|ETM30973.1|  hypothetical protein, variant 3                       57.8    7e-07   Phytophthora parasitica
gb|KDO31448.1|  hypothetical protein SPRG_04063                       57.8    7e-07   Saprolegnia parasitica CBS 223.65
ref|XP_004997038.1|  Pms2 protein                                     57.8    7e-07   Salpingoeca rosetta
ref|XP_001663861.1|  AAEL013690-PA                                    57.8    8e-07   Aedes aegypti
gb|KIW49369.1|  hypothetical protein PV05_11050                       57.8    8e-07   Exophiala xenobiotica
gb|EFA79872.1|  MutL DNA mismatch repair protein                      57.8    8e-07   Polysphondylium pallidum PN500
ref|XP_005998427.1|  PREDICTED: mismatch repair endonuclease PMS2     57.8    8e-07   Latimeria chalumnae
gb|ETN61231.1|  DNA mismatch repair protein pms2                      57.8    8e-07   Anopheles darlingi [American malaria mosquito]
ref|XP_011108494.1|  hypothetical protein H072_2507                   57.8    9e-07   Dactylellina haptotyla CBS 200.50
gb|EFN75866.1|  Mismatch repair endonuclease PMS2                     57.4    9e-07   Harpegnathos saltator
ref|XP_004342239.1|  DNA mismatch repair protein, C-terminal doma...  57.8    9e-07   Acanthamoeba castellanii str. Neff
gb|KIN98531.1|  hypothetical protein M404DRAFT_1005195                57.0    9e-07   Pisolithus tinctorius Marx 270
ref|XP_007879476.1|  hypothetical protein PFL1_03761                  57.8    9e-07   Anthracocystis flocculosa PF-1
ref|XP_011152383.1|  PREDICTED: mismatch repair endonuclease PMS2     57.4    1e-06   Harpegnathos saltator
ref|XP_001644784.1|  hypothetical protein Kpol_1020p35                57.4    1e-06   Vanderwaltozyma polyspora DSM 70294
ref|NP_594417.1|  MutL family mismatch-repair protein Pms1            57.4    1e-06   Schizosaccharomyces pombe 972h-
gb|ETP28589.1|  hypothetical protein, variant 2                       57.4    1e-06   Phytophthora parasitica P10297
gb|KJE93263.1|  hypothetical protein CAOG_004075                      57.4    1e-06   Capsaspora owczarzaki ATCC 30864
gb|KIJ97474.1|  hypothetical protein K443DRAFT_105649                 56.2    1e-06   Laccaria amethystina LaAM-08-1
dbj|GAM22137.1|  hypothetical protein SAMD00019534_053120             57.4    1e-06   Acytostelium subglobosum LB1
gb|KIK18874.1|  hypothetical protein PISMIDRAFT_108669                56.2    1e-06   Pisolithus microcarpus 441
gb|ETL24487.1|  hypothetical protein, variant 2                       57.4    1e-06   Phytophthora parasitica
ref|XP_004562400.1|  PREDICTED: mismatch repair endonuclease PMS2...  57.4    1e-06   Maylandia zebra
emb|CCK68952.1|  hypothetical protein KNAG_0B05200                    57.4    1e-06   Kazachstania naganishii CBS 8797
ref|XP_007498329.1|  PREDICTED: mismatch repair endonuclease PMS2     57.4    1e-06   Monodelphis domestica
emb|CEG70059.1|  Putative DNA mismatch repair protein pms1            57.0    1e-06   Rhizopus microsporus
gb|EFA00116.1|  hypothetical protein TcasGA2_TC002932                 57.0    1e-06   
gb|ENN73117.1|  hypothetical protein YQE_10258                        57.0    1e-06   Dendroctonus ponderosae
ref|XP_003740613.1|  PREDICTED: mismatch repair endonuclease PMS2     57.0    1e-06   Metaseiulus occidentalis
ref|XP_010727980.1|  PREDICTED: mismatch repair endonuclease PMS2     57.0    1e-06   Larimichthys crocea [croceine croaker]
ref|XP_001486293.1|  hypothetical protein PGUG_01964                  57.0    1e-06   Meyerozyma guilliermondii ATCC 6260
ref|XP_008190970.1|  PREDICTED: mismatch repair endonuclease PMS2     57.0    1e-06   Tribolium castaneum [rust-red flour beetle]
ref|XP_308635.4|  AGAP007126-PA                                       57.0    1e-06   Anopheles gambiae str. PEST
gb|EDK37866.2|  hypothetical protein PGUG_01964                       57.0    1e-06   Meyerozyma guilliermondii ATCC 6260
gb|EPQ65457.1|  ATP-binding protein                                   57.0    1e-06   Blumeria graminis f. sp. tritici 96224
ref|XP_003393628.1|  PREDICTED: mismatch repair endonuclease PMS2...  57.0    1e-06   Bombus terrestris [large earth bumblebee]
gb|KEQ58208.1|  DNA mismatch repair protein MutL                      57.0    2e-06   Aureobasidium melanogenum CBS 110374
ref|XP_001747286.1|  hypothetical protein                             57.0    2e-06   Monosiga brevicollis MX1
ref|XP_010051928.1|  PREDICTED: DNA mismatch repair protein PMS1-...  53.9    2e-06   Eucalyptus grandis [rose gum]
ref|XP_005721744.1|  PREDICTED: mismatch repair endonuclease PMS2...  56.6    2e-06   
ref|XP_004182718.1|  hypothetical protein TBLA_0J02050                56.6    2e-06   Tetrapisispora blattae CBS 6284
ref|XP_003490132.1|  PREDICTED: mismatch repair endonuclease PMS2...  56.6    2e-06   Bombus impatiens
gb|KII84937.1|  hypothetical protein PLICRDRAFT_117097                55.8    2e-06   Plicaturopsis crispa FD-325 SS-3
emb|CEP11351.1|  hypothetical protein                                 56.6    2e-06   Parasitella parasitica
ref|XP_009029561.1|  hypothetical protein HELRODRAFT_157945           56.2    2e-06   Helobdella robusta
gb|KIL56445.1|  hypothetical protein M378DRAFT_89291                  55.5    2e-06   Amanita muscaria Koide BX008
ref|XP_005932908.1|  PREDICTED: mismatch repair endonuclease PMS2...  56.6    2e-06   Haplochromis burtoni
ref|XP_006690118.1|  DNA mismatch repair protein MutL                 56.2    2e-06   Candida tenuis ATCC 10573
ref|XP_008162801.1|  PREDICTED: mismatch repair endonuclease PMS2     56.2    2e-06   Chrysemys picta bellii
ref|XP_006801008.1|  PREDICTED: mismatch repair endonuclease PMS2...  56.6    2e-06   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002110081.1|  hypothetical protein TRIADDRAFT_21244            56.2    2e-06   Trichoplax adhaerens
ref|XP_005448203.1|  PREDICTED: mismatch repair endonuclease PMS2     56.2    2e-06   Oreochromis niloticus
ref|XP_008543169.1|  PREDICTED: mismatch repair endonuclease PMS2     56.2    2e-06   Microplitis demolitor
gb|KIW78871.1|  hypothetical protein Z517_08710                       56.6    2e-06   Fonsecaea pedrosoi CBS 271.37
emb|CCA17251.1|  mismatch repair endonuclease pms1 putative           56.2    2e-06   Albugo laibachii Nc14
ref|XP_007060701.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  56.2    2e-06   Chelonia mydas [green seaturtle]
gb|KFH67634.1|  hypothetical protein MVEG_06366                       56.2    2e-06   Mortierella verticillata NRRL 6337
gb|KEQ95134.1|  hypothetical protein AUEXF2481DRAFT_5375              56.2    2e-06   Aureobasidium subglaciale EXF-2481
ref|XP_011124903.1|  hypothetical protein AOL_s00109g120              56.2    2e-06   Arthrobotrys oligospora ATCC 24927
emb|CEG70060.1|  hypothetical protein RMATCC62417_06025               55.8    2e-06   Rhizopus microsporus
ref|XP_002736491.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.8    2e-06   Saccoglossus kowalevskii
ref|XP_001526024.1|  hypothetical protein LELG_02582                  56.2    3e-06   Lodderomyces elongisporus NRRL YB-4239
ref|XP_002493530.1|  ATP-binding protein required for mismatch re...  56.2    3e-06   Komagataella phaffii GS115
ref|XP_002508138.1|  DNA mismatch repair protein-MLH2/PMS1/Pms2 f...  56.2    3e-06   Micromonas commoda
ref|XP_007868321.1|  Pms2 protein                                     54.3    3e-06   Gloeophyllum trabeum ATCC 11539
ref|XP_007771758.1|  hypothetical protein CONPUDRAFT_61519            55.5    3e-06   Coniophora puteana RWD-64-598 SS2
ref|XP_006150251.1|  PREDICTED: mismatch repair endonuclease PMS2...  56.2    3e-06   Tupaia chinensis
ref|XP_009219093.1|  hypothetical protein GGTG_03051                  56.2    3e-06   Gaeumannomyces graminis var. tritici R3-111a-1
ref|XP_003680528.1|  hypothetical protein TDEL_0C04280                55.8    3e-06   Torulaspora delbrueckii
ref|XP_008822235.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.8    3e-06   Nannospalax galili
ref|XP_005794329.1|  hypothetical protein EMIHUDRAFT_447507           55.8    3e-06   Emiliania huxleyi CCMP1516
emb|CCU74286.1|  DNA mismatch repair protein pms1                     55.8    3e-06   Blumeria graminis f. sp. hordei DH14
emb|CDJ87024.1|  MutL domain containing protein                       55.1    3e-06   Haemonchus contortus [red stomach worm]
ref|XP_638844.1|  MutL DNA mismatch repair protein                    55.8    3e-06   Dictyostelium discoideum AX4
gb|KGU28996.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P34048
gb|KHC80721.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P78042
ref|XP_002418831.1|  DNA mismatch repair protein, putative; postm...  55.8    3e-06   Candida dubliniensis CD36
gb|KGQ89466.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P94015
gb|KHC54010.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P60002
gb|KGR13916.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P78048
gb|KGQ95932.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P37005
gb|KHC44649.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans Ca6
gb|KGU35515.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P57055
gb|KGU33017.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P75063
gb|KGT70318.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans 12C
gb|KGR20754.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P37037
gb|EEQ47445.1|  conserved hypothetical protein                        55.8    3e-06   Candida albicans WO-1
gb|KGU12934.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans 19F
gb|ELT88556.1|  hypothetical protein CAPTEDRAFT_218769                55.5    3e-06   Capitella teleta
ref|XP_010788658.1|  PREDICTED: mismatch repair endonuclease PMS2     55.8    3e-06   Notothenia coriiceps [yellowbelly rockcod]
gb|KHC39978.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P76067
gb|KGR11783.1|  DNA mismatch repair protein MutL                      55.8    3e-06   Candida albicans P57072
ref|XP_004933000.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.8    3e-06   
gb|EPE08337.1|  dna mismatch repair protein                           55.8    3e-06   Ophiostoma piceae UAMH 11346
ref|XP_006150250.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.8    4e-06   Tupaia chinensis
gb|KHC38533.1|  DNA mismatch repair protein MutL                      55.8    4e-06   Candida albicans P76055
ref|XP_008822236.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.8    4e-06   Nannospalax galili
emb|CEG81516.1|  hypothetical protein RMATCC62417_15710               55.5    4e-06   Rhizopus microsporus
ref|XP_710686.1|  hypothetical protein CaO19.1605                     55.5    4e-06   Candida albicans SC5314
ref|XP_002951883.1|  hypothetical protein VOLCADRAFT_61856            53.5    4e-06   Volvox carteri f. nagariensis
gb|ETE59428.1|  Mismatch repair endonuclease PMS2                     55.5    4e-06   Ophiophagus hannah
ref|XP_006150253.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.5    4e-06   Tupaia chinensis
ref|XP_002836027.1|  hypothetical protein                             55.5    4e-06   Tuber melanosporum Mel28
ref|XP_001384508.2|  hypothetical protein PICST_58454                 55.5    4e-06   Scheffersomyces stipitis CBS 6054
gb|KIY71044.1|  hypothetical protein CYLTODRAFT_441541                55.5    4e-06   Cylindrobasidium torrendii FP15055 ss-10
emb|CAP39693.2|  Protein CBR-PMS-2                                    55.5    4e-06   Caenorhabditis briggsae
emb|CCD55285.1|  hypothetical protein BofuT4_P156810.1                54.7    4e-06   Botrytis cinerea T4
ref|XP_011209746.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.5    4e-06   Bactrocera dorsalis
ref|XP_006265348.1|  PREDICTED: mismatch repair endonuclease PMS2     55.5    4e-06   Alligator mississippiensis
gb|KIK39084.1|  hypothetical protein CY34DRAFT_808670                 55.5    5e-06   Suillus luteus UH-Slu-Lm8-n1
ref|XP_004534945.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.5    5e-06   Ceratitis capitata
ref|XP_005537463.1|  similar to postmeiotic segregation increased 2   55.5    5e-06   Cyanidioschyzon merolae strain 10D
ref|XP_002636616.1|  C. briggsae CBR-PMS-2 protein                    55.5    5e-06   Caenorhabditis briggsae
ref|XP_006150252.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.5    5e-06   Tupaia chinensis
gb|KFV95334.1|  Mismatch repair endonuclease PMS2                     55.5    5e-06   Eurypyga helias
gb|EMR91049.1|  putative dna mismatch repair protein                  55.5    5e-06   Botrytis cinerea BcDW1
gb|EJU03169.1|  DNA mismatch repair protein MutL                      55.5    5e-06   Dacryopinax primogenitus
ref|XP_005339809.1|  PREDICTED: mismatch repair endonuclease PMS2     55.1    5e-06   
ref|XP_005145373.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  55.1    5e-06   Melopsittacus undulatus
ref|XP_007513353.1|  predicted protein                                55.1    5e-06   Bathycoccus prasinos
ref|XP_006623631.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.1    5e-06   Apis dorsata [rock honeybee]
ref|XP_003761534.1|  PREDICTED: mismatch repair endonuclease PMS2     55.5    5e-06   
ref|XP_006456424.1|  hypothetical protein AGABI2DRAFT_122323          55.5    5e-06   Agaricus bisporus var. bisporus H97
ref|XP_003114045.1|  CRE-PMS-2 protein                                55.1    5e-06   Caenorhabditis remanei
gb|KFO97904.1|  Mismatch repair endonuclease PMS2                     55.1    5e-06   Calypte anna
gb|EFN70759.1|  Mismatch repair endonuclease PMS2                     55.1    5e-06   Camponotus floridanus
ref|XP_007374418.1|  hypothetical protein SPAPADRAFT_150269           55.1    5e-06   Spathaspora passalidarum NRRL Y-27907
ref|XP_011252685.1|  PREDICTED: mismatch repair endonuclease PMS2     55.1    5e-06   Camponotus floridanus
ref|XP_006572416.1|  PREDICTED: mismatch repair endonuclease PMS2...  55.1    5e-06   
gb|KFO59077.1|  Mismatch repair endonuclease PMS2                     55.1    5e-06   Corvus brachyrhynchos
ref|XP_786592.3|  PREDICTED: mismatch repair endonuclease PMS2-like   55.1    6e-06   Strongylocentrotus purpuratus [purple urchin]
dbj|BAD89426.1|  postmeiotic segregation increased 2 nirs variant 2   54.7    6e-06   Homo sapiens [man]
emb|CDJ83098.1|  ATP-binding region and DNA mismatch repair prote...  55.1    6e-06   Haemonchus contortus [red stomach worm]
gb|KIW16343.1|  hypothetical protein PV08_06394                       55.1    6e-06   Exophiala spinifera
ref|XP_011068367.1|  PREDICTED: mismatch repair endonuclease PMS2     55.1    6e-06   Acromyrmex echinatior
ref|XP_009090103.1|  PREDICTED: mismatch repair endonuclease PMS2     55.1    6e-06   Serinus canaria [canary]
gb|KIH86858.1|  hypothetical protein SPBR_08766                       51.6    6e-06   Sporothrix brasiliensis 5110
ref|XP_503794.1|  YALI0E10769p                                        55.1    6e-06   Yarrowia lipolytica CLIB122
ref|XP_002808391.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    6e-06   
gb|KIY99177.1|  hypothetical protein MNEG_8784                        51.6    6e-06   Monoraphidium neglectum
emb|CCI43564.1|  unnamed protein product                              55.1    6e-06   Albugo candida
emb|CCI43566.1|  unnamed protein product                              55.1    6e-06   Albugo candida
gb|KFQ43091.1|  Mismatch repair endonuclease PMS2                     55.1    6e-06   Nestor notabilis
emb|CCI43565.1|  unnamed protein product                              54.7    6e-06   Albugo candida
ref|XP_005487414.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  55.1    6e-06   
gb|KFP70277.1|  Mismatch repair endonuclease PMS2                     55.1    6e-06   Acanthisitta chloris
ref|XP_693648.5|  PREDICTED: mismatch repair endonuclease PMS2        55.1    6e-06   Danio rerio [leopard danio]
gb|EFX87911.1|  putative PMS1, postmeiotic segregation increased ...  55.1    6e-06   Daphnia pulex
ref|XP_006112999.1|  PREDICTED: mismatch repair endonuclease PMS2     55.1    6e-06   
emb|CCI43563.1|  unnamed protein product                              54.7    6e-06   Albugo candida
ref|XP_010904189.1|  PREDICTED: mismatch repair endonuclease PMS2     55.1    6e-06   Esox lucius
ref|XP_003697126.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    6e-06   
gb|EME47019.1|  hypothetical protein DOTSEDRAFT_69112                 55.1    6e-06   Dothistroma septosporum NZE10
gb|KFP79673.1|  Mismatch repair endonuclease PMS2                     55.1    6e-06   Apaloderma vittatum
ref|XP_007425217.1|  PREDICTED: mismatch repair endonuclease PMS2     55.1    6e-06   Python bivittatus
ref|XP_011387852.1|  hypothetical protein UMAG_01932                  55.1    7e-06   
gb|KIX02162.1|  hypothetical protein Z518_08101                       55.1    7e-06   
gb|AGH55784.1|  PMS2                                                  54.7    7e-06   
ref|XP_002770025.1|  DEHA2A10868p                                     55.1    7e-06   
ref|XP_009158455.1|  DNA mismatch repair protein PMS2                 55.1    7e-06   
gb|KHC66026.1|  DNA mismatch repair protein MutL                      54.7    7e-06   
ref|XP_007853135.1|  dna mismatch repair protein pms1                 55.1    7e-06   
emb|CDQ72557.1|  unnamed protein product                              54.7    7e-06   
gb|KDD73673.1|  hypothetical protein H632_c1940p0                     54.7    7e-06   
gb|KHC72820.1|  DNA mismatch repair protein MutL                      54.7    7e-06   
gb|KFQ67704.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
gb|KFV44088.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
ref|XP_008631891.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    7e-06   
ref|XP_010016408.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    7e-06   
ref|XP_003653055.1|  hypothetical protein THITE_2115054               54.7    7e-06   
gb|KFW84396.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
gb|EMC89990.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
ref|XP_010390988.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    7e-06   
gb|KGR00531.1|  DNA mismatch repair protein MutL                      54.7    7e-06   
gb|EGT48682.1|  CBN-PMS-2 protein                                     54.7    7e-06   
gb|KFQ88947.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
ref|XP_009072456.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    7e-06   
ref|XP_005420529.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    7e-06   
gb|KFP59441.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
gb|KFP11708.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
gb|KFO93754.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
gb|KHN80409.1|  Mismatch repair endonuclease PMS2                     54.7    7e-06   
ref|NP_505933.1|  Protein PMS-2, isoform a                            54.7    7e-06   
emb|CBY24580.1|  unnamed protein product                              54.7    7e-06   
ref|XP_004080263.1|  PREDICTED: mismatch repair endonuclease PMS2     54.7    8e-06   
ref|XP_001692227.1|  hypothetical protein CHLREDRAFT_101121           52.8    8e-06   
gb|KFQ53529.1|  Mismatch repair endonuclease PMS2                     54.7    8e-06   
ref|XP_006248924.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.7    8e-06   
gb|KFU93880.1|  Mismatch repair endonuclease PMS2                     54.7    8e-06   
gb|KFQ38873.1|  Mismatch repair endonuclease PMS2                     54.7    8e-06   
gb|KIW45468.1|  hypothetical protein PV06_03859                       54.7    8e-06   
ref|XP_005650783.1|  hypothetical protein COCSUDRAFT_83614            52.4    8e-06   
ref|XP_007385990.1|  hypothetical protein PUNSTDRAFT_72337            53.9    8e-06   
ref|XP_007320377.1|  hypothetical protein SERLADRAFT_471892           53.9    8e-06   
gb|KFP50069.1|  Mismatch repair endonuclease PMS2                     54.7    8e-06   
ref|XP_005442615.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    8e-06   
ref|XP_007251227.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.7    8e-06   
ref|XP_011362154.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.7    8e-06   
ref|XP_006906606.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.7    8e-06   
gb|KFZ53439.1|  Mismatch repair endonuclease PMS2                     54.7    8e-06   
gb|KGL83152.1|  Mismatch repair endonuclease PMS2                     54.7    8e-06   
gb|EDL19031.1|  postmeiotic segregation increased 2 (S. cerevisia...  54.7    9e-06   
gb|KFV61600.1|  Mismatch repair endonuclease PMS2                     54.7    9e-06   
ref|NP_032912.2|  mismatch repair endonuclease PMS2                   54.7    9e-06   
ref|XP_011176016.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    9e-06   
ref|XP_008504482.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.7    9e-06   
gb|KFW73933.1|  Mismatch repair endonuclease PMS2                     54.7    9e-06   
dbj|BAE27115.1|  unnamed protein product                              54.3    9e-06   
gb|KFV08218.1|  Mismatch repair endonuclease PMS2                     54.3    9e-06   
ref|XP_005523023.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    9e-06   
ref|XP_009065197.1|  hypothetical protein LOTGIDRAFT_108533           54.3    9e-06   
ref|XP_002806632.2|  PREDICTED: mismatch repair endonuclease PMS2     54.3    9e-06   
ref|XP_009849745.1|  hypothetical protein NEUTE1DRAFT_128886          54.7    9e-06   
ref|XP_009284815.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    9e-06   
ref|XP_011362155.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.3    9e-06   
ref|XP_002173399.2|  MutL family mismatch-repair protein Pms1         54.3    9e-06   
ref|XP_007525140.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    9e-06   
gb|KFW64318.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
ref|XP_011196565.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    1e-05   
gb|KFQ01553.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
ref|XP_006504875.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.3    1e-05   
gb|EDL19030.1|  postmeiotic segregation increased 2 (S. cerevisia...  54.3    1e-05   
gb|KFP92882.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
ref|XP_010201153.1|  PREDICTED: mismatch repair endonuclease PMS2...  52.4    1e-05   
ref|XP_009701527.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
emb|CBY36677.1|  unnamed protein product                              54.3    1e-05   
ref|XP_008956655.1|  PREDICTED: mismatch repair endonuclease PMS2...  50.1    1e-05   
ref|XP_009875674.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
ref|XP_003934288.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    1e-05   
gb|EJW73020.1|  hypothetical protein WUBG_16077                       50.4    1e-05   
gb|KFO06164.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
ref|XP_006906607.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.3    1e-05   
ref|XP_009813316.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
emb|CDF89591.1|  ZYBA0S04-07954g1_1                                   54.3    1e-05   
ref|XP_010287547.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
ref|XP_962690.3|  DNA mismatch repair protein                         54.3    1e-05   
gb|KFQ99804.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
ref|XP_011349393.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    1e-05   
ref|XP_004351750.1|  MutL DNA mismatch repair protein                 54.3    1e-05   
emb|CDH08560.1|  related to DNA mismatch repair protein PMS1          54.3    1e-05   
gb|KFV18589.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
gb|KFM12333.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
gb|EHB07895.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
ref|XP_008580517.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    1e-05   
ref|XP_007654350.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    1e-05   
ref|XP_007730463.1|  DNA mismatch repair protein PMS2                 54.3    1e-05   
ref|XP_006637418.1|  PREDICTED: mismatch repair endonuclease PMS2...  54.3    1e-05   
gb|KFP35113.1|  Mismatch repair endonuclease PMS2                     54.3    1e-05   
ref|XP_010001630.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
ref|XP_001626114.1|  predicted protein                                54.3    1e-05   
ref|XP_010140889.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
ref|XP_004892400.1|  PREDICTED: mismatch repair endonuclease PMS2     54.3    1e-05   
ref|XP_010221538.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
gb|EPB85682.1|  hypothetical protein HMPREF1544_07508                 54.3    1e-05   
sp|P54279.1|PMS2_MOUSE  RecName: Full=Mismatch repair endonucleas...  54.3    1e-05   
ref|XP_003686067.1|  hypothetical protein TPHA_0F01490                54.3    1e-05   
ref|XP_005514974.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
gb|KIJ49649.1|  hypothetical protein M422DRAFT_161270                 53.1    1e-05   
ref|XP_009485282.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  54.3    1e-05   
ref|XP_002165510.2|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_008436368.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_009958041.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
ref|XP_008436367.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_005811756.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
gb|EJD74284.1|  CBR-PMS-2 protein                                     53.9    1e-05   
ref|XP_010187337.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
ref|XP_010307693.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
gb|KGL86612.1|  Mismatch repair endonuclease PMS2                     53.9    1e-05   
gb|ERT02934.1|  hypothetical protein HMPREF1624_01238                 54.3    1e-05   
ref|XP_009915467.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
emb|CDO93226.1|  unnamed protein product                              53.9    1e-05   
ref|XP_004380874.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
ref|XP_007558945.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_009985428.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
ref|XP_008071097.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
ref|XP_008313318.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
gb|EPY51471.1|  MutL family mismatch-repair protein Pms1              53.9    1e-05   
ref|XP_007081164.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_010073325.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
ref|XP_003145652.1|  hypothetical protein LOAG_10077                  53.9    1e-05   
ref|XP_003998500.2|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_001141671.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_010366040.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
ref|XP_007305917.1|  hypothetical protein STEHIDRAFT_99554            53.9    1e-05   
ref|XP_008119094.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
gb|EFX04708.1|  DNA mismatch repair protein                           53.9    1e-05   
ref|XP_005054715.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.9    1e-05   
emb|CCG82066.1|  DNA mismatch repair protein pms1                     53.9    1e-05   
gb|KIW73773.1|  hypothetical protein PV04_01866                       53.9    1e-05   
ref|XP_003288390.1|  hypothetical protein DICPUDRAFT_152626           53.9    1e-05   
ref|XP_004622885.1|  PREDICTED: LOW QUALITY PROTEIN: PMS2 postmei...  53.9    1e-05   
ref|XP_009450861.1|  PREDICTED: mismatch repair endonuclease PMS2...  52.0    1e-05   
dbj|BAC81643.1|  PMS2-C terminal -like                                52.0    1e-05   
gb|AAI39775.1|  Pms2 protein                                          52.0    1e-05   
ref|XP_002932025.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
gb|ELK17415.1|  Mismatch repair endonuclease PMS2                     53.9    1e-05   
ref|XP_007081165.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_003677517.1|  hypothetical protein NCAS_0G02780                53.9    1e-05   
ref|XP_008016900.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
gb|EMF15515.1|  DNA mismatch repair protein MutL                      53.9    1e-05   
ref|XP_004394227.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
ref|XP_006715805.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
gb|AAA50390.1|  similar to S. cerevisiae PMS1 Swiss-Prot Accessio...  53.9    1e-05   
gb|AAH93921.1|  PMS2 postmeiotic segregation increased 2 (S. cere...  53.9    1e-05   
ref|XP_005549553.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_006941972.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    1e-05   
ref|XP_001589153.1|  hypothetical protein SS1G_09786                  50.4    1e-05   
ref|XP_008696559.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    1e-05   
ref|NP_000526.1|  mismatch repair endonuclease PMS2 isoform a         53.9    2e-05   
ref|XP_003496322.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    2e-05   
gb|ELQ40472.1|  DNA mismatch repair protein pms1                      53.9    2e-05   
ref|XP_009450891.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.9    2e-05   
sp|P54278.2|PMS2_HUMAN  RecName: Full=Mismatch repair endonucleas...  53.9    2e-05   
ref|XP_004440915.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    2e-05   
ref|XP_005368091.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    2e-05   
ref|XP_007940862.1|  PREDICTED: mismatch repair endonuclease PMS2     53.9    2e-05   
ref|XP_003714713.1|  hypothetical protein MGG_15760                   53.9    2e-05   
gb|KFV85651.1|  Mismatch repair endonuclease PMS2                     53.5    2e-05   
gb|EGT48703.1|  hypothetical protein CAEBREN_10667                    52.4    2e-05   
ref|XP_008016903.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_006941973.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_009450892.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_006031530.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.5    2e-05   
gb|EHH17126.1|  PMS2 like protein                                     53.5    2e-05   
dbj|BAG57831.1|  unnamed protein product                              53.5    2e-05   
ref|XP_010154917.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.5    2e-05   
ref|XP_005079993.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.5    2e-05   
ref|XP_008016901.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_006941974.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_009197158.1|  PREDICTED: mismatch repair endonuclease PMS2     53.5    2e-05   
ref|XP_005697949.1|  PREDICTED: mismatch repair endonuclease PMS2     53.5    2e-05   
ref|XP_008301961.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_006859821.1|  PREDICTED: mismatch repair endonuclease PMS2     53.5    2e-05   
gb|KGY15026.1|  hypothetical protein PABG_12140                       53.5    2e-05   
ref|XP_009450859.1|  PREDICTED: mismatch repair endonuclease PMS2...  52.0    2e-05   
ref|XP_008301963.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_008301962.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
gb|EMS11020.1|  DNA mismatch repair protein PMS1, putative            50.8    2e-05   
ref|XP_003804142.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.5    2e-05   
gb|EPX73820.1|  MutL family mismatch-repair protein Pms1              53.5    2e-05   
ref|XP_002927619.1|  PREDICTED: mismatch repair endonuclease PMS2     53.5    2e-05   
gb|KFZ46917.1|  Mismatch repair endonuclease PMS2                     53.5    2e-05   
ref|NP_001099378.1|  mismatch repair endonuclease PMS2                53.1    2e-05   
ref|XP_002140826.1|  DNA mismatch repair protein                      53.5    2e-05   
ref|XP_002496298.1|  ZYRO0C15180p                                     53.5    2e-05   
ref|XP_006715806.1|  PREDICTED: mismatch repair endonuclease PMS2...  53.5    2e-05   
ref|XP_010641062.1|  PREDICTED: mismatch repair endonuclease PMS2     53.5    2e-05   
ref|NP_001192867.1|  mismatch repair endonuclease PMS2                53.5    2e-05   
ref|XP_007292040.1|  DNA mismatch repair protein MutL                 53.5    2e-05   
gb|KIM76295.1|  hypothetical protein PILCRDRAFT_12894                 53.5    2e-05   
ref|XP_003470079.1|  PREDICTED: mismatch repair endonuclease PMS2     53.5    2e-05   
ref|XP_005397952.1|  PREDICTED: mismatch repair endonuclease PMS2     53.5    2e-05   
gb|KDQ22880.1|  hypothetical protein PLEOSDRAFT_1050272               52.4    2e-05   
gb|KEQ74888.1|  DNA mismatch repair protein MutL                      53.5    2e-05   
ref|XP_008926381.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.5    2e-05   
ref|XP_003959280.1|  hypothetical protein KAFR_0J00770                53.1    2e-05   
ref|XP_001494013.2|  PREDICTED: mismatch repair endonuclease PMS2     53.1    2e-05   
ref|XP_004045140.1|  PREDICTED: mismatch repair endonuclease PMS2...  51.6    2e-05   
ref|XP_002547773.1|  predicted protein                                53.1    2e-05   
emb|CAK96402.1|  unnamed protein product                              53.1    2e-05   
ref|XP_007785105.1|  hypothetical protein W97_09051                   53.5    2e-05   
ref|XP_004629762.1|  PREDICTED: mismatch repair endonuclease PMS2     53.1    2e-05   
ref|XP_003660391.1|  hypothetical protein MYCTH_2298657               53.5    2e-05   
gb|KFO79942.1|  Mismatch repair endonuclease PMS2                     53.1    2e-05   
ref|XP_006982718.1|  PREDICTED: mismatch repair endonuclease PMS2     53.1    2e-05   
ref|XP_007398846.1|  hypothetical protein PHACADRAFT_260955           52.8    2e-05   
gb|KFR10344.1|  Mismatch repair endonuclease PMS2                     53.1    2e-05   
ref|XP_003670812.1|  hypothetical protein NDAI_0F02510                53.1    2e-05   
gb|KFV60132.1|  Mismatch repair endonuclease PMS2                     53.1    2e-05   
gb|KIY00361.1|  hypothetical protein Z520_04046                       53.1    2e-05   
gb|KIW96256.1|  hypothetical protein Z519_03324                       53.1    2e-05   
ref|XP_007597510.1|  DNA mismatch repair protein MutL                 53.1    2e-05   
ref|XP_002074706.1|  GK23208                                          53.1    2e-05   
ref|XP_004666302.1|  PREDICTED: mismatch repair endonuclease PMS2     53.1    2e-05   
emb|CDS31812.1|  mismatch repair endonuclease PMS2                    53.1    2e-05   
ref|XP_005229013.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...  53.1    2e-05   



>ref|XP_010088502.1| Mismatch repair endonuclease PMS2 [Morus notabilis]
 gb|EXB36415.1| Mismatch repair endonuclease PMS2 [Morus notabilis]
Length=938

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DLTT++KR
Sbjct  891  GRNEMQKILEHLARLKSPWNCPHGRPTMRHLVDLTTIYKR  930



>ref|XP_003591551.1| DNA mismatch repair protein [Medicago truncatula]
 gb|AES61802.1| DNA mismatch repair protein PMS2, putative [Medicago truncatula]
Length=933

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DLT +HKR
Sbjct  887  GRNEMQKILEHLAELKSPWNCPHGRPTMRHLVDLTKIHKR  926



>gb|ABK92950.1| unknown [Populus trichocarpa]
Length=79

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHL  LKSPWNCPHGRPTMRHLID++++++R
Sbjct  32   GRNEMQKILEHLVDLKSPWNCPHGRPTMRHLIDMSSIYER  71



>gb|KHN46574.1| Mismatch repair endonuclease PMS2 [Glycine soja]
Length=970

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEH+A LKSPWNCPHGRPTMRHL+DLT +HK
Sbjct  924  GRNEMQKILEHMAELKSPWNCPHGRPTMRHLVDLTKIHK  962



>gb|KDP28142.1| hypothetical protein JCGZ_13913 [Jatropha curcas]
Length=954

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DLT+++KR
Sbjct  907  GRNEMQKILEHLADLKSPWNCPHGRPTMRHLLDLTSIYKR  946



>ref|XP_006575115.1| PREDICTED: DNA mismatch repair protein PMS1-like [Glycine max]
Length=946

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEH+A LKSPWNCPHGRPTMRHL+DLT +HK
Sbjct  900  GRNEMQKILEHMAELKSPWNCPHGRPTMRHLVDLTKIHK  938



>ref|XP_011079683.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Sesamum 
indicum]
Length=923

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DL TVH+
Sbjct  876  GRNEMQKILEHLAVLKSPWNCPHGRPTMRHLVDLRTVHR  914



>gb|KDO87272.1| hypothetical protein CISIN_1g0414662mg, partial [Citrus sinensis]
Length=206

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEHLA L SPWNCPHGRPTMRHL+DLTT+ K
Sbjct  159  GRNEMQKILEHLADLNSPWNCPHGRPTMRHLVDLTTIRK  197



>ref|XP_010269535.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Nelumbo 
nucifera]
Length=913

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            G+NEMQKILEHLA LKSPWNCPHGRPTMRHLIDL T++KR
Sbjct  861  GKNEMQKILEHLADLKSPWNCPHGRPTMRHLIDLATIYKR  900



>ref|XP_004136035.1| PREDICTED: mismatch repair endonuclease PMS2-like [Cucumis sativus]
 ref|XP_004160549.1| PREDICTED: mismatch repair endonuclease PMS2-like [Cucumis sativus]
 gb|KGN44927.1| hypothetical protein Csa_7G396420 [Cucumis sativus]
Length=921

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DLTTV +
Sbjct  875  GRNEMQKILEHLAELKSPWNCPHGRPTMRHLVDLTTVKR  913



>ref|XP_008451591.1| PREDICTED: DNA mismatch repair protein PMS1 [Cucumis melo]
Length=921

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DLTTV +
Sbjct  875  GRNEMQKILEHLAELKSPWNCPHGRPTMRHLVDLTTVKR  913



>ref|XP_011079684.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Sesamum 
indicum]
Length=899

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DL TVH+
Sbjct  852  GRNEMQKILEHLAVLKSPWNCPHGRPTMRHLVDLRTVHR  890



>ref|XP_006444299.1| hypothetical protein CICLE_v100188991mg, partial [Citrus clementina]
 gb|ESR57539.1| hypothetical protein CICLE_v100188991mg, partial [Citrus clementina]
Length=400

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEHLA L SPWNCPHGRPTMRHL+DLTT+ K
Sbjct  353  GRNEMQKILEHLADLNSPWNCPHGRPTMRHLVDLTTIRK  391



>ref|XP_007144293.1| hypothetical protein PHAVU_007G144100g [Phaseolus vulgaris]
 gb|ESW16287.1| hypothetical protein PHAVU_007G144100g [Phaseolus vulgaris]
Length=929

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEH+A LKSPWNCPHGRPTMRHL+DL  +H+R
Sbjct  883  GRNEMQKILEHMAELKSPWNCPHGRPTMRHLVDLAKIHRR  922



>ref|XP_010269534.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Nelumbo 
nucifera]
Length=944

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            G+NEMQKILEHLA LKSPWNCPHGRPTMRHLIDL T++KR
Sbjct  892  GKNEMQKILEHLADLKSPWNCPHGRPTMRHLIDLATIYKR  931



>gb|KHN03729.1| Mismatch repair endonuclease PMS2 [Glycine soja]
Length=847

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKILEH+A LKSPWNCPHGRPTMRHL++LT +HK
Sbjct  801  GRNEMQKILEHMAELKSPWNCPHGRPTMRHLVELTKIHK  839



>emb|CDP03504.1| unnamed protein product [Coffea canephora]
Length=927

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DLTTV  R
Sbjct  880  GRNEMQKILEHLAGLKSPWNCPHGRPTMRHLVDLTTVRGR  919



>ref|XP_003536886.1| PREDICTED: DNA mismatch repair protein PMS1-like isoform X1 [Glycine 
max]
Length=944

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            GRNEMQKILEH+A LKSPWNCPHGRPTMRHL+DLT +H
Sbjct  898  GRNEMQKILEHMAELKSPWNCPHGRPTMRHLVDLTKIH  935



>ref|XP_004495972.1| PREDICTED: DNA mismatch repair protein PMS1-like [Cicer arietinum]
Length=939

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEM KILEHLA LKSPWNCPHGRPTMRHL DLT +HKR
Sbjct  893  GRNEMHKILEHLAELKSPWNCPHGRPTMRHLADLTKIHKR  932



>ref|XP_002523056.1| DNA mismatch repair protein pms2, putative [Ricinus communis]
 gb|EEF39241.1| DNA mismatch repair protein pms2, putative [Ricinus communis]
Length=924

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA L SPWNCPHGRPTMRHL+D+T+++KR
Sbjct  877  GRNEMQKILEHLADLNSPWNCPHGRPTMRHLVDMTSIYKR  916



>ref|XP_008386660.1| PREDICTED: DNA mismatch repair protein PMS1 [Malus domestica]
Length=985

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL+DL T+ +R
Sbjct  937  GRNEMQKILEHLAGLKSPWNCPHGRPTMRHLVDLKTIRRR  976



>ref|XP_006480112.1| PREDICTED: DNA mismatch repair protein PMS1-like [Citrus sinensis]
Length=1058

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1     GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
             GRNEMQKILEHLA L SPWNCPHGRPTMRHL+DLTT+ K
Sbjct  1011  GRNEMQKILEHLADLNSPWNCPHGRPTMRHLVDLTTIRK  1049



>gb|KJB49940.1| hypothetical protein B456_008G146300 [Gossypium raimondii]
Length=967

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKI+EHLA LKSPWNCPHGRPTMRHL+DLTT+ K
Sbjct  921  GRNEMQKIVEHLADLKSPWNCPHGRPTMRHLVDLTTLSK  959



>gb|KHG16579.1| Mismatch repair endonuclease PMS2 [Gossypium arboreum]
Length=969

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKI+EHLA LKSPWNCPHGRPTMRHL+DLTT+ K
Sbjct  922  GRNEMQKIVEHLADLKSPWNCPHGRPTMRHLVDLTTLSK  960



>emb|CAN75888.1| hypothetical protein VITISV_023640 [Vitis vinifera]
Length=3804

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1     GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
             GR EMQ+ILEHL+ LKSPWNCPHGRPTMRHL+DLTT++K
Sbjct  3617  GRKEMQRILEHLSDLKSPWNCPHGRPTMRHLVDLTTIYK  3655



>ref|XP_006359387.1| PREDICTED: DNA mismatch repair protein PMS1-like [Solanum tuberosum]
Length=939

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKIL++L+ LKSPWNCPHGRPTMRHL+DL TVH+R
Sbjct  892  GRNEMQKILDNLSRLKSPWNCPHGRPTMRHLVDLRTVHRR  931



>ref|XP_011033555.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Populus 
euphratica]
Length=915

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHL  LKSPWNCPHGRPTMRHLID++++++R
Sbjct  868  GRNEMQKILEHLVDLKSPWNCPHGRPTMRHLIDMSSIYER  907



>ref|XP_011033556.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Populus 
euphratica]
Length=826

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHL  LKSPWNCPHGRPTMRHLID++++++R
Sbjct  779  GRNEMQKILEHLVDLKSPWNCPHGRPTMRHLIDMSSIYER  818



>ref|XP_009791019.1| PREDICTED: DNA mismatch repair protein PMS1 [Nicotiana sylvestris]
Length=907

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKIL++L+ LKSPWNCPHGRPTMRHL+DL TVH+R
Sbjct  858  GRNEMQKILDNLSRLKSPWNCPHGRPTMRHLVDLRTVHRR  897



>ref|XP_002321013.1| DNA mismatch repair family protein [Populus trichocarpa]
 gb|EEE99328.1| DNA mismatch repair family protein [Populus trichocarpa]
Length=915

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHL  LKSPWNCPHGRPTMRHLID++++++R
Sbjct  868  GRNEMQKILEHLVDLKSPWNCPHGRPTMRHLIDMSSIYER  907



>ref|XP_009598044.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Nicotiana 
tomentosiformis]
Length=940

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKIL++L+ L+SPWNCPHGRPTMRHL+DL TVH+R
Sbjct  891  GRNEMQKILDNLSRLRSPWNCPHGRPTMRHLVDLRTVHRR  930



>ref|XP_009598045.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Nicotiana 
tomentosiformis]
Length=939

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKIL++L+ L+SPWNCPHGRPTMRHL+DL TVH+R
Sbjct  890  GRNEMQKILDNLSRLRSPWNCPHGRPTMRHLVDLRTVHRR  929



>ref|XP_010038198.1| PREDICTED: DNA mismatch repair protein PMS1 [Eucalyptus grandis]
 gb|KCW50017.1| hypothetical protein EUGRSUZ_K03466 [Eucalyptus grandis]
Length=922

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            G++EMQKILEHLA LKSPWNCPHGRPTMRHL+DL TV KR
Sbjct  877  GKSEMQKILEHLADLKSPWNCPHGRPTMRHLVDLATVGKR  916



>ref|XP_010684604.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=801

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL++L  + +R
Sbjct  753  GRNEMQKILEHLAELKSPWNCPHGRPTMRHLVNLAVIRER  792



>ref|XP_004247536.1| PREDICTED: DNA mismatch repair protein PMS1 [Solanum lycopersicum]
Length=940

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKIL++L+ LKSPWNCPHGRPTMRHL+DL TVH+R
Sbjct  893  GRNEMQKILDNLSRLKSPWNCPHGRPTMRHLVDLRTVHRR  932



>emb|CBI36837.3| unnamed protein product [Vitis vinifera]
Length=854

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GR EMQ+ILEHL+ LKSPWNCPHGRPTMRHL+DLTT++K
Sbjct  795  GRKEMQRILEHLSDLKSPWNCPHGRPTMRHLVDLTTIYK  833



>ref|XP_010684598.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=909

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            GRNEMQKILEHLA LKSPWNCPHGRPTMRHL++L  + +R
Sbjct  861  GRNEMQKILEHLAELKSPWNCPHGRPTMRHLVNLAVIRER  900



>ref|XP_010652175.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Vitis 
vinifera]
 ref|XP_010652176.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Vitis 
vinifera]
Length=958

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GR EMQ+ILEHL+ LKSPWNCPHGRPTMRHL+DLTT++K
Sbjct  899  GRKEMQRILEHLSDLKSPWNCPHGRPTMRHLVDLTTIYK  937



>gb|KCW50018.1| hypothetical protein EUGRSUZ_K03466 [Eucalyptus grandis]
Length=899

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            G++EMQKILEHLA LKSPWNCPHGRPTMRHL+DL TV KR
Sbjct  854  GKSEMQKILEHLADLKSPWNCPHGRPTMRHLVDLATVGKR  893



>ref|XP_010652177.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Vitis 
vinifera]
Length=943

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GR EMQ+ILEHL+ LKSPWNCPHGRPTMRHL+DLTT++K
Sbjct  884  GRKEMQRILEHLSDLKSPWNCPHGRPTMRHLVDLTTIYK  922



>ref|XP_010522786.1| PREDICTED: DNA mismatch repair protein PMS1 [Tarenaya hassleriana]
Length=924

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            G+NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLTT+H
Sbjct  876  GKNEMQKIVEHLAGLESPWNCPHGRPTMRHLVDLTTLH  913



>gb|EYU46682.1| hypothetical protein MIMGU_mgv1a024383mg [Erythranthe guttata]
Length=876

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            G+NEM K+LEHLA LKSPWNCPHGRPTMRHL+DL TV +R
Sbjct  831  GKNEMHKVLEHLAILKSPWNCPHGRPTMRHLVDLKTVRRR  870



>ref|XP_011458719.1| PREDICTED: DNA mismatch repair protein PMS1 [Fragaria vesca subsp. 
vesca]
Length=953

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEM+KILEHLA LKSPWNCPHGRPTMRHLIDL T+ +
Sbjct  906  GRNEMRKILEHLAGLKSPWNCPHGRPTMRHLIDLKTIRR  944



>ref|XP_008235055.1| PREDICTED: DNA mismatch repair protein PMS1 [Prunus mume]
Length=981

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQ+ILEHLA LKSPWNCPHGRPTMRHL+DL T+ +
Sbjct  934  GRNEMQRILEHLAGLKSPWNCPHGRPTMRHLVDLKTIRR  972



>ref|XP_006840542.1| hypothetical protein AMTR_s00045p00213360 [Amborella trichopoda]
 gb|ERN02217.1| hypothetical protein AMTR_s00045p00213360 [Amborella trichopoda]
Length=963

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +NEMQK+L HLA LKSPWNCPHGRPTMRHL+DL+TV K
Sbjct  925  KNEMQKVLRHLAELKSPWNCPHGRPTMRHLVDLSTVRK  962



>ref|XP_007050885.1| DNA mismatch repair protein pms2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX95042.1| DNA mismatch repair protein pms2, putative isoform 1 [Theobroma 
cacao]
Length=1017

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  1     GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
             GRNEMQKI+E LA LKSPWNCPHGRPTMRHL+DLT + K
Sbjct  970   GRNEMQKIIERLADLKSPWNCPHGRPTMRHLVDLTALSK  1008



>ref|XP_007199731.1| hypothetical protein PRUPE_ppa002523mg [Prunus persica]
 gb|EMJ00930.1| hypothetical protein PRUPE_ppa002523mg [Prunus persica]
Length=662

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQ+ILEHLA LKSPWNCPHGRPTMRHL+DL T+ +
Sbjct  615  GRNEMQRILEHLAGLKSPWNCPHGRPTMRHLVDLKTIRR  653



>ref|XP_007050886.1| DNA mismatch repair protein, putative isoform 2 [Theobroma cacao]
 gb|EOX95043.1| DNA mismatch repair protein, putative isoform 2 [Theobroma cacao]
Length=847

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            GRNEMQKI+E LA LKSPWNCPHGRPTMRHL+DLT + K
Sbjct  800  GRNEMQKIIERLADLKSPWNCPHGRPTMRHLVDLTALSK  838



>gb|EPS64298.1| hypothetical protein M569_10482, partial [Genlisea aurea]
Length=855

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            G NEM+KI+E+LA LKSPWNCPHGRPTMRHL+DL TVHK
Sbjct  812  GMNEMRKIVENLATLKSPWNCPHGRPTMRHLVDLRTVHK  850



>ref|XP_010429737.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
Length=424

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLTT+ K
Sbjct  370  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTTLLK  407



>ref|XP_010456026.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
 ref|XP_010456027.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
Length=921

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLTT+ K
Sbjct  868  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTTLLK  905



>ref|XP_006287017.1| hypothetical protein CARUB_v10000165mg [Capsella rubella]
 gb|EOA19915.1| hypothetical protein CARUB_v10000165mg [Capsella rubella]
Length=923

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLTT+ K
Sbjct  868  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTTLLK  905



>ref|XP_010422584.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
Length=922

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLTT+ K
Sbjct  868  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTTLLK  905



>emb|CDX91318.1| BnaC02g27290D [Brassica napus]
Length=886

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLT++
Sbjct  601  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTSL  636



>gb|ADE76812.1| unknown [Picea sitchensis]
Length=150

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + +M+ IL+HL+ L SPWNCPHGRPTMRHL+DLTTV++R
Sbjct  112  KKDMETILQHLSTLNSPWNCPHGRPTMRHLVDLTTVYRR  150



>ref|XP_009144562.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Brassica 
rapa]
Length=915

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLT++
Sbjct  858  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTSL  893



>ref|XP_009144561.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Brassica 
rapa]
Length=917

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLT++
Sbjct  860  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTSL  895



>emb|CDX97265.1| BnaA02g20560D [Brassica napus]
Length=1121

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+DLT+
Sbjct  862  KNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTS  896



>gb|KFK30838.1| hypothetical protein AALP_AA6G032200 [Arabis alpina]
Length=671

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +NEMQKI+EHLA L SPWNCPHGRPTMRHL+DL ++
Sbjct  617  KNEMQKIVEHLADLDSPWNCPHGRPTMRHLVDLASL  652



>ref|XP_010914441.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X4 [Elaeis 
guineensis]
Length=906

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            R EMQ+IL +LA LKSPWNCPHGRPTMRHL DL ++H
Sbjct  841  RKEMQRILHNLADLKSPWNCPHGRPTMRHLADLISIH  877



>ref|XP_010914434.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010914435.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010914436.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010914437.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
Length=944

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            R EMQ+IL +LA LKSPWNCPHGRPTMRHL DL ++H
Sbjct  879  RKEMQRILHNLADLKSPWNCPHGRPTMRHLADLISIH  915



>ref|XP_010914440.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X3 [Elaeis 
guineensis]
Length=922

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            R EMQ+IL +LA LKSPWNCPHGRPTMRHL DL ++H
Sbjct  879  RKEMQRILHNLADLKSPWNCPHGRPTMRHLADLISIH  915



>ref|XP_010914439.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Elaeis 
guineensis]
Length=932

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            R EMQ+IL +LA LKSPWNCPHGRPTMRHL DL ++H
Sbjct  879  RKEMQRILHNLADLKSPWNCPHGRPTMRHLADLISIH  915



>ref|XP_008805742.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein PMS1 
[Phoenix dactylifera]
Length=919

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            R EMQ+IL  LA LKSPWNCPHGRPTMRHL DL ++H
Sbjct  876  RKEMQRILHDLADLKSPWNCPHGRPTMRHLADLISIH  912



>gb|AAC19275.1| T14P8.6 [Arabidopsis thaliana]
 emb|CAB80739.1| AT4g02460 [Arabidopsis thaliana]
Length=779

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLI  96
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+
Sbjct  722  KNEMQKIVEHLADLESPWNCPHGRPTMRHLV  752



>ref|XP_002872835.1| hypothetical protein ARALYDRAFT_490319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49094.1| hypothetical protein ARALYDRAFT_490319 [Arabidopsis lyrata subsp. 
lyrata]
Length=923

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLI  96
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+
Sbjct  870  KNEMQKIVEHLADLESPWNCPHGRPTMRHLV  900



>ref|NP_567236.1| DNA mismatch repair protein PMS1 [Arabidopsis thaliana]
 sp|Q941I6.1|PMS1_ARATH RecName: Full=DNA mismatch repair protein PMS1; AltName: Full=Postmeiotic 
segregation protein 1; AltName: Full=Protein POSTMEIOTIC 
SEGREGATION 1 [Arabidopsis thaliana]
 gb|AAL01156.1| DNA mismatch repair protein [Arabidopsis thaliana]
 gb|AEE82175.1| DNA mismatch repair protein PMS1 [Arabidopsis thaliana]
Length=923

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLI  96
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+
Sbjct  866  KNEMQKIVEHLADLESPWNCPHGRPTMRHLV  896



>ref|XP_006396455.1| hypothetical protein EUTSA_v10028404mg [Eutrema salsugineum]
 gb|ESQ37908.1| hypothetical protein EUTSA_v10028404mg [Eutrema salsugineum]
Length=916

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLI  96
            +NEMQKI+EHLA L+SPWNCPHGRPTMRHL+
Sbjct  863  KNEMQKIVEHLADLESPWNCPHGRPTMRHLV  893



>ref|XP_002454101.1| hypothetical protein SORBIDRAFT_04g024565 [Sorghum bicolor]
 gb|EES07077.1| hypothetical protein SORBIDRAFT_04g024565 [Sorghum bicolor]
Length=102

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + EM+KIL++L  L+SPWNCPHGRPTMRHL DL T+  +
Sbjct  64   KAEMKKILKNLTGLRSPWNCPHGRPTMRHLADLRTIKDK  102



>ref|XP_001785478.1| predicted protein [Physcomitrella patens]
 gb|EDQ49719.1| predicted protein [Physcomitrella patens]
Length=742

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + EM+KIL HLA L +PWNCPHGRPTMRHL DL  + ++
Sbjct  704  KKEMEKILCHLADLDAPWNCPHGRPTMRHLADLEVLRQK  742



>ref|XP_008861480.1| hypothetical protein H310_00455 [Aphanomyces invadans]
 gb|ETW10069.1| hypothetical protein H310_00455 [Aphanomyces invadans]
Length=829

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            R+EMQKIL  LA L+ PWNCPHGRPTMRHL+DL+
Sbjct  785  RDEMQKILLQLAELEQPWNCPHGRPTMRHLVDLS  818



>gb|AFW62793.1| hypothetical protein ZEAMMB73_370746 [Zea mays]
Length=205

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + EM+KIL+++A L+SPWNCPHGRPTMRHL DL T+  +
Sbjct  161  KAEMKKILKNMAGLRSPWNCPHGRPTMRHLADLRTMKAK  199



>gb|KHJ96730.1| MutL dimerization domain protein [Oesophagostomum dentatum]
Length=163

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
             RN+MQ I+ HL  L  PWNCPHGRPT+RHL DL T+ K
Sbjct  125  SRNQMQTIVSHLGTLDQPWNCPHGRPTLRHLADLHTILK  163



>gb|EMT21505.1| Mismatch repair endonuclease PMS2 [Aegilops tauschii]
Length=1379

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
             + EM+KIL++L  L+SPWNCPHGRPTMRHL DLT++
Sbjct  1061  KTEMKKILKNLTGLRSPWNCPHGRPTMRHLADLTSI  1096



>ref|XP_002617364.1| hypothetical protein CLUG_02808 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ38682.1| hypothetical protein CLUG_02808 [Clavispora lusitaniae ATCC 42720]
Length=878

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            +N M K++ HL+ L+ PWNCPHGRPTMRHL DL  VH
Sbjct  835  KNTMAKVVRHLSRLEKPWNCPHGRPTMRHLADLGGVH  871



>ref|XP_002985153.1| hypothetical protein SELMODRAFT_121896 [Selaginella moellendorffii]
 gb|EFJ13647.1| hypothetical protein SELMODRAFT_121896 [Selaginella moellendorffii]
Length=722

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            + EM+K++ HLA L +PWNCPHGRPTMRHL DL    K
Sbjct  680  KKEMEKVVRHLADLDAPWNCPHGRPTMRHLYDLNAKKK  717



>ref|XP_008678747.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Zea mays]
Length=983

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + EM+KIL+++A L+SPWNCPHGRPTMRHL DL T+  +
Sbjct  939  KAEMKKILKNMAGLRSPWNCPHGRPTMRHLADLRTMKAK  977



>ref|XP_009405473.1| PREDICTED: DNA mismatch repair protein PMS1 [Musa acuminata subsp. 
malaccensis]
Length=916

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            ++EMQKIL +LA L SPWNCPHGRPTMRHL D+  +
Sbjct  870  KSEMQKILRNLADLNSPWNCPHGRPTMRHLADMAAI  905



>ref|XP_002969817.1| hypothetical protein SELMODRAFT_171139 [Selaginella moellendorffii]
 gb|EFJ28941.1| hypothetical protein SELMODRAFT_171139 [Selaginella moellendorffii]
Length=705

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            + EM+K++ HLA L +PWNCPHGRPTMRHL DL    K
Sbjct  663  KKEMEKVVRHLADLDAPWNCPHGRPTMRHLYDLNAKKK  700



>ref|XP_004955044.1| PREDICTED: DNA mismatch repair protein PMS1-like [Setaria italica]
Length=840

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + EM+KIL++L  L+SPWNCPHGRPTMRHL+DL  +  +
Sbjct  793  KAEMRKILKNLTGLRSPWNCPHGRPTMRHLVDLRAIKNK  831



>ref|XP_009822431.1| hypothetical protein H257_01095 [Aphanomyces astaci]
 gb|ETV87568.1| hypothetical protein H257_01095 [Aphanomyces astaci]
Length=789

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
            R +MQKI+  LA L+ PWNCPHGRPTMRHL+DL++
Sbjct  749  REDMQKIVVQLAELEQPWNCPHGRPTMRHLVDLSS  783



>ref|XP_006647441.1| PREDICTED: DNA mismatch repair protein PMS1-like [Oryza brachyantha]
Length=921

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            + EM+KIL++L  L+SPWNCPHGRPTMRHL DL T+
Sbjct  876  KAEMKKILKNLTGLRSPWNCPHGRPTMRHLADLRTI  911



>ref|XP_003575262.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Brachypodium 
distachyon]
Length=921

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + EM+KIL++L  L+SPWNCPHGRPTMRHL DL T+  +
Sbjct  871  KAEMKKILKNLTGLRSPWNCPHGRPTMRHLADLHTIKSQ  909



>ref|XP_009822432.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV87569.1| hypothetical protein, variant [Aphanomyces astaci]
Length=596

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
            R +MQKI+  LA L+ PWNCPHGRPTMRHL+DL++
Sbjct  556  REDMQKIVVQLAELEQPWNCPHGRPTMRHLVDLSS  590



>ref|XP_008618743.1| hypothetical protein SDRG_14397 [Saprolegnia diclina VS20]
 gb|EQC27813.1| hypothetical protein SDRG_14397 [Saprolegnia diclina VS20]
Length=672

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            + EM KI+  LA L  PWNCPHGRPTMRHL+DL ++ K
Sbjct  635  KEEMLKIVTQLAVLDQPWNCPHGRPTMRHLVDLNSLEK  672



>ref|XP_003388127.1| PREDICTED: mismatch repair endonuclease PMS2-like [Amphimedon 
queenslandica]
Length=759

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            G+ EM KI+ H+A +  PWNCPHGRPT+RHLID++ +
Sbjct  720  GKKEMSKIVAHMAEMDQPWNCPHGRPTIRHLIDISKL  756



>ref|NP_001047292.1| Os02g0592300 [Oryza sativa Japonica Group]
 dbj|BAD34084.1| putative PMS2 postmeiotic segregation increased 2 [Oryza sativa 
Japonica Group]
 dbj|BAF09206.1| Os02g0592300 [Oryza sativa Japonica Group]
 gb|EEC73509.1| hypothetical protein OsI_07875 [Oryza sativa Indica Group]
 gb|EEE57283.1| hypothetical protein OsJ_07338 [Oryza sativa Japonica Group]
Length=923

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            + EM+KIL++L  L+SPWNCPHGRPTMRHL DL  +
Sbjct  878  KTEMKKILKNLTGLRSPWNCPHGRPTMRHLADLHAI  913



>gb|EHJ64985.1| putative DNA mismatch repair protein pms2 [Danaus plexippus]
Length=820

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            + +M+K+++H+A +  PWNCPHGRPT+RHLI+L  VH
Sbjct  781  KGDMRKLVDHMAEIDKPWNCPHGRPTIRHLINLAMVH  817



>gb|EYC09890.1| hypothetical protein Y032_0058g2875 [Ancylostoma ceylanicum]
Length=245

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            N+MQ I+ HL  L  PWNCPHGRPT+RHL+DL
Sbjct  203  NQMQTIVAHLGTLDQPWNCPHGRPTLRHLVDL  234



>gb|EYC09889.1| hypothetical protein Y032_0058g2875 [Ancylostoma ceylanicum]
Length=249

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            N+MQ I+ HL  L  PWNCPHGRPT+RHL+DL
Sbjct  207  NQMQTIVAHLGTLDQPWNCPHGRPTLRHLVDL  238



>ref|XP_003702377.1| PREDICTED: mismatch repair endonuclease PMS2-like [Megachile 
rotundata]
Length=692

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEMQK++  +A +++PW+CPHGRPT+RHL+ L  VHK
Sbjct  655  NEMQKLVTQMAQMENPWSCPHGRPTIRHLLSLHLVHK  691



>ref|XP_003961536.1| PREDICTED: mismatch repair endonuclease PMS2-like [Takifugu rubripes]
Length=837

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            NEM+K+L H+  ++ PWNCPHGRPTMRHLI+L  +
Sbjct  802  NEMKKLLVHMGEIEHPWNCPHGRPTMRHLINLDII  836



>ref|XP_002998214.1| mismatch repair endonuclease pms1, putative [Phytophthora infestans 
T30-4]
 gb|EEY70560.1| mismatch repair endonuclease pms1, putative [Phytophthora infestans 
T30-4]
Length=686

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  644  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  676



>gb|EKC38171.1| Mismatch repair endonuclease PMS2 [Crassostrea gigas]
Length=794

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            ++EM+K++ H+  ++ PWNCPHGRPTMRHLI+L  V K
Sbjct  757  KSEMKKLVCHMGEIEQPWNCPHGRPTMRHLINLNMVPK  794



>ref|XP_002595431.1| hypothetical protein BRAFLDRAFT_69263 [Branchiostoma floridae]
 gb|EEN51443.1| hypothetical protein BRAFLDRAFT_69263 [Branchiostoma floridae]
Length=219

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            R EMQ++L H+  ++ PWNCPHGRPTMRHL +L  +
Sbjct  182  RGEMQQLLTHMGEIEQPWNCPHGRPTMRHLFNLNML  217



>ref|XP_005838471.1| Pms1 mismatch repair mutL [Guillardia theta CCMP2712]
 gb|EKX51491.1| Pms1 mismatch repair mutL [Guillardia theta CCMP2712]
Length=629

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            R +M+ I++H++ ++ PWNCPHGRPTMRHL DL  V +
Sbjct  578  RQQMRVIVDHMSSMEQPWNCPHGRPTMRHLFDLAEVEE  615



>gb|ESA07485.1| hypothetical protein GLOINDRAFT_98750 [Rhizophagus irregularis 
DAOM 181602]
Length=863

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            R +M KI++H+  +  PWNCPHGRPTMRHL DL+
Sbjct  801  RQQMGKIVKHMGDIDQPWNCPHGRPTMRHLFDLS  834



>gb|ETI30638.1| hypothetical protein F443_22254 [Phytophthora parasitica P1569]
 gb|ETI30639.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
Length=799

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  757  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  789



>gb|EXX79123.1| Pms1p [Rhizophagus irregularis DAOM 197198w]
Length=865

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            R +M KI++H+  +  PWNCPHGRPTMRHL DL+
Sbjct  803  RQQMGKIVKHMGDIDQPWNCPHGRPTMRHLFDLS  836



>gb|ETP28587.1| hypothetical protein F442_22125 [Phytophthora parasitica P10297]
Length=799

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  757  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  789



>gb|ETO59390.1| hypothetical protein F444_22247 [Phytophthora parasitica P1976]
 gb|ETO59391.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=799

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  757  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  789



>ref|XP_008915522.1| hypothetical protein PPTG_18950 [Phytophthora parasitica INRA-310]
 ref|XP_008915523.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETM99208.1| hypothetical protein PPTG_18950 [Phytophthora parasitica INRA-310]
 gb|ETM99209.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=799

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  757  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  789



>gb|ETK71041.1| hypothetical protein L915_21644 [Phytophthora parasitica]
 gb|ETK71042.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL24485.1| hypothetical protein L916_21515 [Phytophthora parasitica]
 gb|ETL24486.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETP00431.1| hypothetical protein F441_22156 [Phytophthora parasitica CJ01A1]
 gb|ETP00432.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=808

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  757  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  789



>ref|XP_011417733.1| PREDICTED: mismatch repair endonuclease PMS2-like [Crassostrea 
gigas]
Length=882

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            ++EM+K++ H+  ++ PWNCPHGRPTMRHLI+L  V K
Sbjct  845  KSEMKKLVCHMGEIEQPWNCPHGRPTMRHLINLNMVPK  882



>gb|ETM30970.1| hypothetical protein L914_21370 [Phytophthora parasitica]
 gb|ETM30971.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=799

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  757  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  789



>gb|ETL77706.1| hypothetical protein L917_21365 [Phytophthora parasitica]
 gb|ETL77707.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=799

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  757  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  789



>ref|XP_003374110.1| mismatch repair endonuclease PMS2 [Trichinella spiralis]
 gb|EFV53722.1| mismatch repair endonuclease PMS2 [Trichinella spiralis]
Length=765

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
            EMQ+I+E L+ ++ PWNCPHGRPT+RHLI+L T
Sbjct  732  EMQQIVERLSSIEHPWNCPHGRPTVRHLINLAT  764



>emb|CDK28467.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=861

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            R  MQ +++HLA L  PWNCPHGRPTMRHL++L
Sbjct  817  RRTMQTVVQHLAGLDKPWNCPHGRPTMRHLMEL  849



>gb|KDN40420.1| hypothetical protein K437DRAFT_269978 [Tilletiaria anomala UBC 
951]
Length=1342

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
             R +M  IL H+  ++SPWNCPHGRPTMRHL +L TV
Sbjct  1042  RRQMTAILRHMGTMESPWNCPHGRPTMRHLANLNTV  1077



>ref|XP_003031353.1| hypothetical protein SCHCODRAFT_16115 [Schizophyllum commune 
H4-8]
 gb|EFI96450.1| hypothetical protein SCHCODRAFT_16115 [Schizophyllum commune 
H4-8]
Length=462

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + +M  +++H+  +  PWNCPHGRPTMRHLIDL  ++ R
Sbjct  408  KGQMTAVVQHMGTMDQPWNCPHGRPTMRHLIDLADLNGR  446



>ref|XP_003243755.1| PREDICTED: mismatch repair endonuclease PMS2 [Acyrthosiphon pisum]
Length=591

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            +M+K+++H+  ++ PWNCPHGRPTMRHL++LT ++
Sbjct  553  DMRKLIDHMGDIEQPWNCPHGRPTMRHLVNLTLLN  587



>gb|KFB50618.1| AGAP007126-PA-like protein [Anopheles sinensis]
Length=913

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            EM+++L H+  +  PWNCPHGRPTMRHL++L  +++
Sbjct  870  EMERLLRHMGEIDQPWNCPHGRPTMRHLVNLAMINQ  905



>dbj|GAN04390.1| mismatch repair endonuclease PMS2-like [Mucor ambiguus]
Length=811

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            +N+M KI+ H+  +  PWNCPHGRPTMRHL +++
Sbjct  753  KNQMTKIVRHMGEIDQPWNCPHGRPTMRHLFNIS  786



>emb|CAG04443.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=866

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            EM+K+L H+  ++ PWNCPHGRPTMRHLI+L  V +
Sbjct  830  EMKKLLVHMGEMEHPWNCPHGRPTMRHLINLDIVSQ  865



>ref|XP_001660584.1| AAEL010033-PA [Aedes aegypti]
 gb|EAT38049.1| AAEL010033-PA [Aedes aegypti]
Length=874

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            + EM++++ H+  ++ PWNCPHGRPTMRHL++L+ + +
Sbjct  827  KAEMRRLVSHMGEIEQPWNCPHGRPTMRHLVNLSMLQQ  864



>ref|XP_001886812.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR02449.1| predicted protein [Laccaria bicolor S238N-H82]
Length=269

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +M  +L H+  +  PWNCPHGRPTMRHL+D+TT+
Sbjct  219  QMLTVLRHMGTIDQPWNCPHGRPTMRHLLDITTI  252



>gb|KDR15822.1| Mismatch repair endonuclease PMS2 [Zootermopsis nevadensis]
Length=855

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
             R +M++++E++  ++ PWNCPHGRPTMRHLI+L  +H
Sbjct  816  SRADMRRLIENMGQIEQPWNCPHGRPTMRHLINLDLIH  853



>gb|ETL77708.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL77709.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=674

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  632  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  664



>gb|ETI30640.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETI30641.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
Length=674

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  632  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  664



>gb|ETO59393.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
Length=583

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  541  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  573



>ref|XP_008915524.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 ref|XP_008915525.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETM99210.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETM99211.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=674

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  632  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  664



>gb|ETK71043.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=683

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  632  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  664



>ref|XP_004347900.2| hypothetical protein CAOG_04075 [Capsaspora owczarzaki ATCC 30864]
Length=1093

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  7     NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
             ++M ++L H+  ++ PWNCPHGRPTMRHL+DL+ +
Sbjct  988   SQMYRLLRHMGQIEQPWNCPHGRPTMRHLLDLSMI  1022



>gb|EPZ35376.1| DNA mismatch repair protein domain-containing protein [Rozella 
allomycis CSF55]
Length=562

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +M+KI++HL  L  PWNCPHGRPT+RHL+D 
Sbjct  528  QMRKIIKHLEQLDQPWNCPHGRPTIRHLLDF  558



>gb|ETM30973.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=674

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  632  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  664



>gb|KDO31448.1| hypothetical protein SPRG_04063 [Saprolegnia parasitica CBS 223.65]
Length=785

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            + EM KI+  LA L  PWNCPHGRPTMRHL+DL ++
Sbjct  748  KEEMLKIVTQLAVLDQPWNCPHGRPTMRHLVDLNSL  783



>ref|XP_004997038.1| Pms2 protein [Salpingoeca rosetta]
 gb|EGD81834.1| Pms2 protein [Salpingoeca rosetta]
Length=934

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
            R EM+ IL+H+  ++ PWNCPHGRPTMRHL D+++
Sbjct  883  RPEMRAILQHMGTMEQPWNCPHGRPTMRHLCDISS  917



>ref|XP_001663861.1| AAEL013690-PA [Aedes aegypti]
 gb|EAT34048.1| AAEL013690-PA [Aedes aegypti]
Length=926

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            + EM++++ H+  ++ PWNCPHGRPTMRHL++L+ + +
Sbjct  879  KAEMRRLVSHMGEIEQPWNCPHGRPTMRHLVNLSMLQQ  916



>gb|KIW49369.1| hypothetical protein PV05_11050 [Exophiala xenobiotica]
Length=1031

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
             R +M+K++ H+  +  PWNCPHGRPTMRHL  L T+ 
Sbjct  969   RKQMEKVVSHMGTIDKPWNCPHGRPTMRHLCSLNTLQ  1005



>gb|EFA79872.1| MutL DNA mismatch repair protein [Polysphondylium pallidum PN500]
Length=945

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            EM+KIL++L+ L +PW CPHGRPTMRHL+DL
Sbjct  847  EMKKILDNLSTLDNPWCCPHGRPTMRHLLDL  877



>ref|XP_005998427.1| PREDICTED: mismatch repair endonuclease PMS2 [Latimeria chalumnae]
Length=872

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  +++PWNCPHGRPTMRHL +L  + +
Sbjct  835  NEMKKLVSHMGEIENPWNCPHGRPTMRHLANLDMISQ  871



>gb|ETN61231.1| DNA mismatch repair protein pms2 [Anopheles darlingi]
Length=896

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            EM++++ H+  ++ PWNCPHGRPTMRHL++L  +++
Sbjct  854  EMERLVRHMGEIEQPWNCPHGRPTMRHLVNLAMINR  889



>ref|XP_011108494.1| hypothetical protein H072_2507 [Dactylellina haptotyla CBS 200.50]
 gb|EPS43470.1| hypothetical protein H072_2507 [Dactylellina haptotyla CBS 200.50]
Length=1091

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1     GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
             G N+M+K+++H+  L  PWNCPHGRPTMRHL D+
Sbjct  1006  GFNDMKKVVKHMGELDKPWNCPHGRPTMRHLCDV  1039



>gb|EFN75866.1| Mismatch repair endonuclease PMS2 [Harpegnathos saltator]
Length=672

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEMQ+++  +  +++PWNCPHGRPT+RHL+ L  V+K
Sbjct  636  NEMQRLIMQMTQMQNPWNCPHGRPTIRHLLSLLLVNK  672



>ref|XP_004342239.1| DNA mismatch repair protein, C-terminal domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR20129.1| DNA mismatch repair protein, C-terminal domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=1076

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
             + EM+++L ++  L++PW+CPHGRPTMRHL DL+T+
Sbjct  999   KKEMKRVLHNMTLLENPWSCPHGRPTMRHLFDLSTI  1034



>gb|KIN98531.1| hypothetical protein M404DRAFT_1005195 [Pisolithus tinctorius 
Marx 270]
Length=473

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
            ++ M  I+ H+A +  PWNCPHGRPTMRHL DLT+
Sbjct  420  KSRMTTIVRHMASMDQPWNCPHGRPTMRHLSDLTS  454



>ref|XP_007879476.1| hypothetical protein PFL1_03761 [Pseudozyma flocculosa PF-1]
 gb|EPQ28458.1| hypothetical protein PFL1_03761 [Pseudozyma flocculosa PF-1]
Length=1069

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
             + +M++ILEH+  ++ PWNCPHGRPTMRHL  L  +
Sbjct  1011  KRQMKRILEHMGEIEQPWNCPHGRPTMRHLACLQAI  1046



>ref|XP_011152383.1| PREDICTED: mismatch repair endonuclease PMS2 [Harpegnathos saltator]
Length=676

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEMQ+++  +  +++PWNCPHGRPT+RHL+ L  V+K
Sbjct  640  NEMQRLIMQMTQMQNPWNCPHGRPTIRHLLSLLLVNK  676



>ref|XP_001644784.1| hypothetical protein Kpol_1020p35 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO16926.1| hypothetical protein Kpol_1020p35 [Vanderwaltozyma polyspora 
DSM 70294]
Length=957

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +  M K+++HL+ L  PWNCPHGRPTMRHL++L
Sbjct  913  KKTMSKVVKHLSELHKPWNCPHGRPTMRHLMEL  945



>ref|NP_594417.1| MutL family mismatch-repair protein Pms1 [Schizosaccharomyces 
pombe 972h-]
 sp|P54280.1|PMS1_SCHPO RecName: Full=DNA mismatch repair protein pms1 [Schizosaccharomyces 
pombe 972h-]
 emb|CAA65400.1| pms1 [Schizosaccharomyces pombe]
 emb|CAB10113.1| MutL family mismatch-repair protein Pms1 [Schizosaccharomyces 
pombe]
Length=794

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +EM  I+ HLA L  PWNCPHGRPTMRHL+ L  +
Sbjct  760  SEMNTIVRHLAELSKPWNCPHGRPTMRHLLRLKDI  794



>gb|ETP28589.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
 gb|ETP28590.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=767

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  725  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  757



>gb|KJE93263.1| hypothetical protein CAOG_004075 [Capsaspora owczarzaki ATCC 
30864]
Length=1154

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  7     NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
             ++M ++L H+  ++ PWNCPHGRPTMRHL+DL+ +
Sbjct  1049  SQMYRLLRHMGQIEQPWNCPHGRPTMRHLLDLSMI  1083



>gb|KIJ97474.1| hypothetical protein K443DRAFT_105649 [Laccaria amethystina LaAM-08-1]
Length=269

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +M  ++ H+  +  PWNCPHGRPTMRHL+D+TT+
Sbjct  219  QMLTVMRHMGTIDQPWNCPHGRPTMRHLLDITTI  252



>dbj|GAM22137.1| hypothetical protein SAMD00019534_053120 [Acytostelium subglobosum 
LB1]
Length=987

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 4/42 (10%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL----TTVHKR  120
            +EM+K+L++L+ L++PW CPHGRPTMRHL+DL    T ++KR
Sbjct  916  SEMKKVLDNLSLLENPWCCPHGRPTMRHLVDLSALSTLINKR  957



>gb|KIK18874.1| hypothetical protein PISMIDRAFT_108669 [Pisolithus microcarpus 
441]
Length=302

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            ++ M  I+ H+A +  PWNCPHGRPTMRHL DLT++
Sbjct  249  KSRMTAIIRHMASMDQPWNCPHGRPTMRHLSDLTSL  284



>gb|ETL24487.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETP00433.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=775

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EMQKI+ +L+ L  PWNCPHGRPT+RHL+DL
Sbjct  724  KEEMQKIVRNLSGLDQPWNCPHGRPTLRHLVDL  756



>ref|XP_004562400.1| PREDICTED: mismatch repair endonuclease PMS2-like [Maylandia 
zebra]
Length=861

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  L+ PWNCPHGRPTMRHL +L  + +
Sbjct  824  NEMKKLVVHMGELEHPWNCPHGRPTMRHLANLDVISQ  860



>emb|CCK68952.1| hypothetical protein KNAG_0B05200 [Kazachstania naganishii CBS 
8797]
Length=873

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            +  M ++++HL  L  PWNCPHGRPTMRHL++LT
Sbjct  828  KTTMARVVKHLGTLDKPWNCPHGRPTMRHLLELT  861



>ref|XP_007498329.1| PREDICTED: mismatch repair endonuclease PMS2 [Monodelphis domestica]
Length=863

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +NEM+K++ H+  ++ PWNCPHGRPTMRH+  L  + +
Sbjct  825  KNEMKKLITHMGEIEHPWNCPHGRPTMRHIASLNIISQ  862



>emb|CEG70059.1| Putative DNA mismatch repair protein pms1 [Rhizopus microsporus]
Length=786

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +N+M  I+ H+  +  PWNCPHGRPTMRHL+ L+ + +
Sbjct  735  KNKMTTIIRHMGEIDQPWNCPHGRPTMRHLLSLSQLKQ  772



>gb|EFA00116.1| hypothetical protein TcasGA2_TC002932 [Tribolium castaneum]
Length=807

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +++M++++ H+  ++ PWNCPHGRPTMRHLI+L  + +
Sbjct  768  KSDMRRLVNHMGEIEQPWNCPHGRPTMRHLINLDLIQE  805



>gb|ENN73117.1| hypothetical protein YQE_10258, partial [Dendroctonus ponderosae]
Length=722

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            R EM+ ++ H+  ++ PWNCPHGRPTMRHL++L+
Sbjct  680  RTEMKNLVAHMGDIEQPWNCPHGRPTMRHLVNLS  713



>ref|XP_003740613.1| PREDICTED: mismatch repair endonuclease PMS2 [Metaseiulus occidentalis]
Length=841

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            +M++++  L+ L+ PWNCPHGRPTMRHL++L  VH
Sbjct  806  DMKRVVSQLSGLQHPWNCPHGRPTMRHLVNLNLVH  840



>ref|XP_010727980.1| PREDICTED: mismatch repair endonuclease PMS2 [Larimichthys crocea]
Length=851

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +EM+K+L H+  ++ PWNCPHGRPTMRHL +L  + K
Sbjct  814  SEMKKLLVHMGEIEHPWNCPHGRPTMRHLANLDIISK  850



>ref|XP_001486293.1| hypothetical protein PGUG_01964 [Meyerozyma guilliermondii ATCC 
6260]
Length=859

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            M+K++ +L+HL  PWNCPHGRPTMRHL +L   H
Sbjct  817  MKKVVHNLSHLDKPWNCPHGRPTMRHLTELNEWH  850



>ref|XP_008190970.1| PREDICTED: mismatch repair endonuclease PMS2 [Tribolium castaneum]
Length=853

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +++M++++ H+  ++ PWNCPHGRPTMRHLI+L  + +
Sbjct  814  KSDMRRLVNHMGEIEQPWNCPHGRPTMRHLINLDLIQE  851



>ref|XP_308635.4| AGAP007126-PA [Anopheles gambiae str. PEST]
 gb|EAA04111.4| AGAP007126-PA [Anopheles gambiae str. PEST]
Length=882

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            EM++++ H+  +  PWNCPHGRPTMRHL++L  + +
Sbjct  828  EMERLIRHMGEIDQPWNCPHGRPTMRHLVNLAMIRQ  863



>gb|EDK37866.2| hypothetical protein PGUG_01964 [Meyerozyma guilliermondii ATCC 
6260]
Length=859

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            M+K++ +L+HL  PWNCPHGRPTMRHL +L   H
Sbjct  817  MKKVVHNLSHLDKPWNCPHGRPTMRHLTELNEWH  850



>gb|EPQ65457.1| ATP-binding protein [Blumeria graminis f. sp. tritici 96224]
Length=1062

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  10    EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
             +M+KI+ HL  L  PWNCPHGRPTMRHL  L+T   R
Sbjct  990   QMEKIVLHLGELDKPWNCPHGRPTMRHLFSLSTWDSR  1026



>ref|XP_003393628.1| PREDICTED: mismatch repair endonuclease PMS2-like [Bombus terrestris]
Length=692

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            N+M K++  +A +++PWNCPHGRPT+RHL+ L  ++K
Sbjct  656  NDMHKLITQMAEMENPWNCPHGRPTIRHLLSLNLIYK  692



>gb|KEQ58208.1| DNA mismatch repair protein MutL, partial [Aureobasidium melanogenum 
CBS 110374]
Length=925

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
            N+M K++ +L  +  PWNCPHGRPTMRHL DL+T
Sbjct  868  NQMLKVVRNLGEMDKPWNCPHGRPTMRHLADLST  901



>ref|XP_001747286.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ87753.1| predicted protein [Monosiga brevicollis MX1]
Length=871

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/34 (56%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            EM ++++H++ L+ PWNCPHGRPTMRHL++L  +
Sbjct  824  EMAEVVQHMSQLEHPWNCPHGRPTMRHLVNLDRI  857



>ref|XP_010051928.1| PREDICTED: DNA mismatch repair protein PMS1-like [Eucalyptus 
grandis]
Length=161

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  19   KILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            +ILEHLA LKSPWN P GRP M  L+DLT + KR
Sbjct  124  QILEHLADLKSPWNYPDGRPVMHRLVDLTAISKR  157



>ref|XP_005721744.1| PREDICTED: mismatch repair endonuclease PMS2-like isoform X1 
[Pundamilia nyererei]
 ref|XP_005721745.1| PREDICTED: mismatch repair endonuclease PMS2-like isoform X2 
[Pundamilia nyererei]
Length=861

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  ++ PWNCPHGRPTMRHL +L  + +
Sbjct  824  NEMKKLVVHMGEIEHPWNCPHGRPTMRHLANLDVISQ  860



>ref|XP_004182718.1| hypothetical protein TBLA_0J02050 [Tetrapisispora blattae CBS 
6284]
 emb|CCH63199.1| hypothetical protein TBLA_0J02050 [Tetrapisispora blattae CBS 
6284]
Length=890

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            N M +++ HL  L  PWNCPHGRPTMRHL++L
Sbjct  847  NSMVRVVRHLGELDKPWNCPHGRPTMRHLMEL  878



>ref|XP_003490132.1| PREDICTED: mismatch repair endonuclease PMS2-like [Bombus impatiens]
Length=692

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            N+M K++  +A +++PWNCPHGRPT+RHL+ L  ++K
Sbjct  656  NDMHKLITQMAEMENPWNCPHGRPTIRHLLSLNLIYK  692



>gb|KII84937.1| hypothetical protein PLICRDRAFT_117097 [Plicaturopsis crispa 
FD-325 SS-3]
Length=311

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            RN+M  +++H+  +  PWNCPHGRPTMRHL D+ 
Sbjct  259  RNQMATVVQHMGTMDQPWNCPHGRPTMRHLTDIA  292



>emb|CEP11351.1| hypothetical protein [Parasitella parasitica]
Length=817

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + +M++I++H+  +  PWNCPHGRPTMRHL +L
Sbjct  760  KRQMERIVQHMGEIDQPWNCPHGRPTMRHLFNL  792



>ref|XP_009029561.1| hypothetical protein HELRODRAFT_157945 [Helobdella robusta]
 gb|ESN92320.1| hypothetical protein HELRODRAFT_157945 [Helobdella robusta]
Length=397

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +EM+K+++H+  +  PWNCPHGRPT+RHLID+
Sbjct  361  SEMRKLVDHMGEIDQPWNCPHGRPTIRHLIDM  392



>gb|KIL56445.1| hypothetical protein M378DRAFT_89291 [Amanita muscaria Koide 
BX008]
Length=284

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            +++M  +++H+  +  PWNCPHGRPTMRHLIDL     R
Sbjct  234  QSQMTSVVQHMGTMDQPWNCPHGRPTMRHLIDLCQTSLR  272



>ref|XP_005932908.1| PREDICTED: mismatch repair endonuclease PMS2-like [Haplochromis 
burtoni]
Length=861

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  ++ PWNCPHGRPTMRHL +L  + +
Sbjct  824  NEMKKLVVHMGEIEHPWNCPHGRPTMRHLANLDVISQ  860



>ref|XP_006690118.1| DNA mismatch repair protein MutL [Candida tenuis ATCC 10573]
 gb|EGV60904.1| DNA mismatch repair protein MutL [Candida tenuis ATCC 10573]
Length=624

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            M+KIL HL+ L  PWNCPHGRPT+RHL DL  ++ +
Sbjct  582  MKKILSHLSELDKPWNCPHGRPTLRHLHDLGGINNK  617



>ref|XP_008162801.1| PREDICTED: mismatch repair endonuclease PMS2 [Chrysemys picta 
bellii]
 ref|XP_008162802.1| PREDICTED: mismatch repair endonuclease PMS2 [Chrysemys picta 
bellii]
 ref|XP_008162803.1| PREDICTED: mismatch repair endonuclease PMS2 [Chrysemys picta 
bellii]
Length=619

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  ++ PWNCPHGRPTMRH+++L  + +
Sbjct  582  NEMKKLITHMGEIEHPWNCPHGRPTMRHIVNLDLISQ  618



>ref|XP_006801008.1| PREDICTED: mismatch repair endonuclease PMS2-like [Neolamprologus 
brichardi]
Length=862

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  ++ PWNCPHGRPTMRHL +L  + +
Sbjct  825  NEMKKLVVHMGEIEHPWNCPHGRPTMRHLANLDVISQ  861



>ref|XP_002110081.1| hypothetical protein TRIADDRAFT_21244 [Trichoplax adhaerens]
 gb|EDV28247.1| hypothetical protein TRIADDRAFT_21244 [Trichoplax adhaerens]
Length=832

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            ++M+KIL+H+  ++ PWNCPHGRPTMRHL +L
Sbjct  787  SQMKKILKHMGEIEHPWNCPHGRPTMRHLFNL  818



>ref|XP_005448203.1| PREDICTED: mismatch repair endonuclease PMS2 [Oreochromis niloticus]
Length=862

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  ++ PWNCPHGRPTMRHL +L  + +
Sbjct  825  NEMKKLVVHMGEIEHPWNCPHGRPTMRHLANLDVISQ  861



>ref|XP_008543169.1| PREDICTED: mismatch repair endonuclease PMS2 [Microplitis demolitor]
Length=697

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            +EM+++L  ++ +++PWNCPHGRPT+RHL+ L  +H
Sbjct  660  SEMERLLTQMSQMENPWNCPHGRPTIRHLLSLKLLH  695



>gb|KIW78871.1| hypothetical protein Z517_08710 [Fonsecaea pedrosoi CBS 271.37]
Length=1032

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
             R +MQK++ ++  +  PWNCPHGRPTMRHL  L T+ 
Sbjct  970   RRQMQKVVANMGTIDKPWNCPHGRPTMRHLCSLDTLQ  1006



>emb|CCA17251.1| mismatch repair endonuclease pms1 putative [Albugo laibachii 
Nc14]
Length=667

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            + EM +I+  L  L  PWNCPHGRPTMRHL D+T +
Sbjct  631  KAEMTRIVHQLTGLDQPWNCPHGRPTMRHLFDITAL  666



>ref|XP_007060701.1| PREDICTED: LOW QUALITY PROTEIN: mismatch repair endonuclease 
PMS2 [Chelonia mydas]
Length=879

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  ++ PWNCPHGRPTMRH+ +L  + +
Sbjct  843  NEMKKLITHMGEIEHPWNCPHGRPTMRHIANLDMISQ  879



>gb|KFH67634.1| hypothetical protein MVEG_06366 [Mortierella verticillata NRRL 
6337]
Length=687

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +M++I+ H+  +  PWNCPHGRPTMRHL+DL  + +
Sbjct  598  QMKRIVRHMGEIDQPWNCPHGRPTMRHLLDLAEMEQ  633



>gb|KEQ95134.1| hypothetical protein AUEXF2481DRAFT_5375 [Aureobasidium subglaciale 
EXF-2481]
Length=944

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            +N+M K++ +L  +  PWNCPHGRPTMRHL DL+
Sbjct  872  KNQMLKVVRNLGEMDKPWNCPHGRPTMRHLADLS  905



>ref|XP_011124903.1| hypothetical protein AOL_s00109g120 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX46548.1| hypothetical protein AOL_s00109g120 [Arthrobotrys oligospora 
ATCC 24927]
Length=1066

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  1     GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
             G  +M+K+++H+  L  PWNCPHGRPTMRHL D+
Sbjct  981   GLKDMKKVVKHMGELDKPWNCPHGRPTMRHLCDV  1014



>emb|CEG70060.1| hypothetical protein RMATCC62417_06025 [Rhizopus microsporus]
Length=583

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +N+M  I+ H+  +  PWNCPHGRPTMRHL+ L+ + +
Sbjct  532  KNKMTTIIRHMGEIDQPWNCPHGRPTMRHLLSLSQLKQ  569



>ref|XP_002736491.1| PREDICTED: mismatch repair endonuclease PMS2-like, partial [Saccoglossus 
kowalevskii]
Length=532

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            + EM+K++ H+  ++ PWNCPHGRPTMRHL ++T +
Sbjct  495  KTEMKKLICHMGEIEQPWNCPHGRPTMRHLFNITML  530



>ref|XP_001526024.1| hypothetical protein LELG_02582 [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK44403.1| hypothetical protein LELG_02582 [Lodderomyces elongisporus NRRL 
YB-4239]
Length=948

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            +  MQK++ +L+ L  PWNCPHGRPTMRHLI+      R
Sbjct  904  KQRMQKVVANLSKLDKPWNCPHGRPTMRHLIESNNWQSR  942



>ref|XP_002493530.1| ATP-binding protein required for mismatch repair in mitosis and 
meiosis [Komagataella pastoris GS115]
 emb|CAY71351.1| ATP-binding protein required for mismatch repair in mitosis and 
meiosis [Komagataella pastoris GS115]
 emb|CCA41043.1| Mismatch repair endonuclease PMS2 [Komagataella pastoris CBS 
7435]
Length=903

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            M +++ HL+ L  PWNCPHGRPTMRHLI+L+
Sbjct  862  MTRVVHHLSGLDKPWNCPHGRPTMRHLIELS  892



>ref|XP_002508138.1| DNA mismatch repair protein-MLH2/PMS1/Pms2 family, partial [Micromonas 
sp. RCC299]
 gb|ACO69396.1| DNA mismatch repair protein-MLH2/PMS1/Pms2 family, partial [Micromonas 
sp. RCC299]
Length=771

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            M+++L++L+ L++PWNCPHGRPTMRHL DL
Sbjct  739  MRRVLDNLSDLQAPWNCPHGRPTMRHLADL  768



>ref|XP_007868321.1| Pms2 protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ53007.1| Pms2 protein [Gloeophyllum trabeum ATCC 11539]
Length=217

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            +++M  ++ H+  ++ PWNCPHGRPTMRHL D+++  +R
Sbjct  164  KSQMTTVVRHMGAIEQPWNCPHGRPTMRHLSDISSTSRR  202



>ref|XP_007771758.1| hypothetical protein CONPUDRAFT_61519 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW78024.1| hypothetical protein CONPUDRAFT_61519 [Coniophora puteana RWD-64-598 
SS2]
Length=326

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            + +M  ++ H+  +  PWNCPHGRPTMRHL+D+ TV  +
Sbjct  266  QAQMTTVVRHMGTMDQPWNCPHGRPTMRHLVDVQTVKSK  304



>ref|XP_006150251.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Tupaia 
chinensis]
Length=842

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  805  NEMKKLITHMGEMDHPWNCPHGRPTMRHIANLDIISQ  841



>ref|XP_009219093.1| hypothetical protein GGTG_03051 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT77948.1| hypothetical protein GGTG_03051 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=1115

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTT  108
             R +M+K++ H+  ++ PWNCPHGRPTMRHL  L +
Sbjct  1053  RAQMEKVVRHMGEMEKPWNCPHGRPTMRHLCGLAS  1087



>ref|XP_003680528.1| hypothetical protein TDEL_0C04280 [Torulaspora delbrueckii]
 emb|CCE91317.1| hypothetical protein TDEL_0C04280 [Torulaspora delbrueckii]
Length=885

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            M K++ HL+ L+ PWNCPHGRPTMRHL++L
Sbjct  844  MVKVVRHLSELEKPWNCPHGRPTMRHLMEL  873



>ref|XP_008822235.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Nannospalax 
galili]
Length=859

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  822  NEMKKLITHMGEMDHPWNCPHGRPTMRHIANLDVLSQ  858



>ref|XP_005794329.1| hypothetical protein EMIHUDRAFT_447507 [Emiliania huxleyi CCMP1516]
 gb|EOD41900.1| hypothetical protein EMIHUDRAFT_447507 [Emiliania huxleyi CCMP1516]
Length=549

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            M+ I+ +LA L  PWNCPHGRPT+RHLIDL+++
Sbjct  502  MRTIVSNLAGLDQPWNCPHGRPTLRHLIDLSSL  534



>emb|CCU74286.1| DNA mismatch repair protein pms1 [Blumeria graminis f. sp. hordei 
DH14]
Length=1062

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  10    EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
             +M+KI+ HL  L  PWNCPHGRPTMRHL  L T   R
Sbjct  990   QMEKIVLHLGELDKPWNCPHGRPTMRHLFSLGTWDSR  1026



>emb|CDJ87024.1| MutL domain containing protein, partial [Haemonchus contortus]
Length=292

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +MQ I+  L+ L  PWNCPHGRPT+RHL+DL
Sbjct  256  QMQTIVRQLSTLDQPWNCPHGRPTLRHLVDL  286



>ref|XP_638844.1| MutL DNA mismatch repair protein [Dictyostelium discoideum AX4]
 sp|Q54QA0.1|PMS1_DICDI RecName: Full=Mismatch repair endonuclease pms1 [Dictyostelium 
discoideum]
 gb|EAL65478.1| MutL DNA mismatch repair protein [Dictyostelium discoideum AX4]
Length=1022

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  10    EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
             EM+ +L +L+ L +PW CPHGRPTMRHL+DL+   K
Sbjct  969   EMKDVLNNLSTLDNPWCCPHGRPTMRHLVDLSIKDK  1004



>gb|KGU28996.1| DNA mismatch repair protein MutL [Candida albicans P34048]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KHC80721.1| DNA mismatch repair protein MutL [Candida albicans P78042]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>ref|XP_002418831.1| DNA mismatch repair protein, putative; postmeiotic segregation 
protein, putative [Candida dubliniensis CD36]
 emb|CAX44137.1| DNA mismatch repair protein, putative [Candida dubliniensis CD36]
Length=911

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  846  KSKMKEIISNLSTLDKPWNCPHGRPTMRHLIDI  878



>gb|KGQ89466.1| DNA mismatch repair protein MutL [Candida albicans P94015]
Length=912

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  854  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  886



>gb|KHC54010.1| DNA mismatch repair protein MutL [Candida albicans P60002]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGR13916.1| DNA mismatch repair protein MutL [Candida albicans P78048]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGQ95932.1| DNA mismatch repair protein MutL [Candida albicans P37005]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KHC44649.1| DNA mismatch repair protein MutL [Candida albicans Ca6]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGU35515.1| DNA mismatch repair protein MutL [Candida albicans P57055]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGU33017.1| DNA mismatch repair protein MutL [Candida albicans P75063]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGT70318.1| DNA mismatch repair protein MutL [Candida albicans 12C]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGR20754.1| DNA mismatch repair protein MutL [Candida albicans P37037]
 gb|KGU15719.1| DNA mismatch repair protein MutL [Candida albicans L26]
 gb|KHC81973.1| DNA mismatch repair protein MutL [Candida albicans SC5314]
 gb|KHC88296.1| DNA mismatch repair protein MutL [Candida albicans SC5314]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|EEQ47445.1| conserved hypothetical protein [Candida albicans WO-1]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGU12934.1| DNA mismatch repair protein MutL [Candida albicans 19F]
 gb|KHC58041.1| DNA mismatch repair protein MutL [Candida albicans P37039]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|ELT88556.1| hypothetical protein CAPTEDRAFT_218769 [Capitella teleta]
Length=469

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            EM K+L H++ ++ PWNCPHGRPTMRHLI+L  +
Sbjct  432  EMNKLLRHMSEIEHPWNCPHGRPTMRHLINLDRI  465



>ref|XP_010788658.1| PREDICTED: mismatch repair endonuclease PMS2 [Notothenia coriiceps]
Length=847

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +EM+K+L H+  ++ PWNCPHGRPTMRHL +L  + +
Sbjct  810  SEMKKLLIHMGEIEQPWNCPHGRPTMRHLANLDMISQ  846



>gb|KHC39978.1| DNA mismatch repair protein MutL [Candida albicans P76067]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>gb|KGR11783.1| DNA mismatch repair protein MutL [Candida albicans P57072]
Length=910

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>ref|XP_004933000.1| PREDICTED: mismatch repair endonuclease PMS2-like [Bombyx mori]
Length=816

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            +++M+ +++H+A +  PWNCPHGRPT+RHL++L  V 
Sbjct  771  KSDMRTLVDHMAEIDKPWNCPHGRPTIRHLVNLAMVQ  807



>gb|EPE08337.1| dna mismatch repair protein [Ophiostoma piceae UAMH 11346]
Length=1082

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
             R +M  +L H+  +  PWNCPHGRPTMRHL  L T   R
Sbjct  1008  RRQMAGVLSHMGEMDKPWNCPHGRPTMRHLCSLGTAWDR  1046



>ref|XP_006150250.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Tupaia 
chinensis]
Length=892

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  855  NEMKKLITHMGEMDHPWNCPHGRPTMRHIANLDIISQ  891



>gb|KHC38533.1| DNA mismatch repair protein MutL [Candida albicans P76055]
Length=910

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  852  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  884



>ref|XP_008822236.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Nannospalax 
galili]
Length=803

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  766  NEMKKLITHMGEMDHPWNCPHGRPTMRHIANLDVLSQ  802



>emb|CEG81516.1| hypothetical protein RMATCC62417_15710 [Rhizopus microsporus]
Length=585

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +N+M  I+ H+  +  PWNCPHGRPTMRHL+ L+ + +
Sbjct  534  KNKMTTIIRHMGEIDQPWNCPHGRPTMRHLLSLSQLKQ  571



>ref|XP_710686.1| hypothetical protein CaO19.1605 [Candida albicans SC5314]
 ref|XP_710677.1| hypothetical protein CaO19.9173 [Candida albicans SC5314]
 gb|EAK91429.1| hypothetical protein CaO19.9173 [Candida albicans SC5314]
 gb|EAK91438.1| hypothetical protein CaO19.1605 [Candida albicans SC5314]
Length=776

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            +++M++I+ +L+ L  PWNCPHGRPTMRHLID+
Sbjct  718  KSKMREIISNLSTLDKPWNCPHGRPTMRHLIDI  750



>ref|XP_002951883.1| hypothetical protein VOLCADRAFT_61856 [Volvox carteri f. nagariensis]
 gb|EFJ46988.1| hypothetical protein VOLCADRAFT_61856 [Volvox carteri f. nagariensis]
Length=187

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHL  93
            R EM+++L+ LA L+ PWNCPHGRPTMRH+
Sbjct  146  RGEMRRLLDGLADLRQPWNCPHGRPTMRHV  175



>gb|ETE59428.1| Mismatch repair endonuclease PMS2, partial [Ophiophagus hannah]
Length=767

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            EM+K++ H+  ++ PWNCPHGRPT+RHL++L  +
Sbjct  731  EMKKLISHMGEIEHPWNCPHGRPTIRHLVNLDLI  764



>ref|XP_006150253.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X4 [Tupaia 
chinensis]
Length=740

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  703  NEMKKLITHMGEMDHPWNCPHGRPTMRHIANLDIISQ  739



>ref|XP_002836027.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ80184.1| unnamed protein product [Tuber melanosporum]
Length=1023

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  13   MQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            M+K+++H+  L  PWNCPHGRPTMRHL DL
Sbjct  958  MEKLVKHMGELDKPWNCPHGRPTMRHLSDL  987



>ref|XP_001384508.2| hypothetical protein PICST_58454 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN66479.2| predicted protein [Scheffersomyces stipitis CBS 6054]
Length=809

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            R  M K++++L+ L  PWNCPHGRPTMRHL++ 
Sbjct  765  RGRMTKVVQNLSQLDKPWNCPHGRPTMRHLVEF  797



>gb|KIY71044.1| hypothetical protein CYLTODRAFT_441541, partial [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=1059

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  7     NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
             ++M  ++ H+  +  PWNCPHGRPTMRHL DLT+V
Sbjct  1013  SQMVSVVRHMGKMDQPWNCPHGRPTMRHLCDLTSV  1047



>emb|CAP39693.2| Protein CBR-PMS-2 [Caenorhabditis briggsae]
Length=838

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            EM +I+ HL+ L  PWNCPHGRPT+RHL+ L
Sbjct  801  EMTRIIRHLSKLDQPWNCPHGRPTIRHLVSL  831



>emb|CCD55285.1| hypothetical protein BofuT4_P156810.1 [Botrytis cinerea T4]
Length=325

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            R +M+K++ H+  ++ PWNCPHGRPTMRHL  L
Sbjct  260  RGQMEKVVRHMGEIEQPWNCPHGRPTMRHLCGL  292



>ref|XP_011209746.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Bactrocera 
dorsalis]
Length=880

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            R  M+K++ H+  ++ PWNCPHGRPTMRHLI++  +
Sbjct  832  RATMKKLVTHMGEIEQPWNCPHGRPTMRHLINIAML  867



>ref|XP_006265348.1| PREDICTED: mismatch repair endonuclease PMS2 [Alligator mississippiensis]
Length=875

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            NEM+K++ H+  ++ PWNCPHGRPTMRH++ L  +
Sbjct  838  NEMKKLITHMGEIEHPWNCPHGRPTMRHIVSLDLI  872



>gb|KIK39084.1| hypothetical protein CY34DRAFT_808670 [Suillus luteus UH-Slu-Lm8-n1]
Length=1000

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLT  105
            N M  I++H++ +  PWNCPHGRPTMRH+ DLT
Sbjct  949  NRMNSIVQHMSTMDQPWNCPHGRPTMRHVSDLT  981



>ref|XP_004534945.1| PREDICTED: mismatch repair endonuclease PMS2-like [Ceratitis 
capitata]
Length=880

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            R  M K++ H+  ++ PWNCPHGRPTMRHLI++  + 
Sbjct  836  RTTMMKLVTHMGEIEQPWNCPHGRPTMRHLINIAMLQ  872



>ref|XP_005537463.1| similar to postmeiotic segregation increased 2 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81427.1| similar to postmeiotic segregation increased 2 [Cyanidioschyzon 
merolae strain 10D]
Length=830

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            R  MQ I+  LA L+ PWNCPHGRPTMRHL+ ++ +  R
Sbjct  788  RTHMQSIVARLATLEQPWNCPHGRPTMRHLVRVSEIGFR  826



>ref|XP_002636616.1| C. briggsae CBR-PMS-2 protein [Caenorhabditis briggsae]
Length=797

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            EM +I+ HL+ L  PWNCPHGRPT+RHL+ L
Sbjct  760  EMTRIIRHLSKLDQPWNCPHGRPTIRHLVSL  790



>ref|XP_006150252.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Tupaia 
chinensis]
Length=782

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM+K++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  745  NEMKKLITHMGEMDHPWNCPHGRPTMRHIANLDIISQ  781



>gb|KFV95334.1| Mismatch repair endonuclease PMS2, partial [Eurypyga helias]
Length=887

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            EM+K++ H+  ++ PWNCPHGRPTMRHL+ L
Sbjct  853  EMRKLITHMGEIEHPWNCPHGRPTMRHLVSL  883



>gb|EMR91049.1| putative dna mismatch repair protein [Botrytis cinerea BcDW1]
Length=1086

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
             R +M+K++ H+  ++ PWNCPHGRPTMRHL  L
Sbjct  1021  RGQMEKVVRHMGEIEQPWNCPHGRPTMRHLCGL  1053



>gb|EJU03169.1| DNA mismatch repair protein MutL [Dacryopinax sp. DJM-731 SS1]
Length=1010

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
            R +M  ++ H+  ++ PWNCPHGRPTMRHL+ L    KR
Sbjct  957  RQQMTNVVRHMGTMEQPWNCPHGRPTMRHLLSLPDFIKR  995



>ref|XP_005339809.1| PREDICTED: mismatch repair endonuclease PMS2 [Ictidomys tridecemlineatus]
Length=629

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            +EM+K++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  592  SEMKKLITHMGEMDHPWNCPHGRPTMRHIANLDVISQ  628



>ref|XP_005145373.1| PREDICTED: LOW QUALITY PROTEIN: mismatch repair endonuclease 
PMS2 [Melopsittacus undulatus]
Length=874

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            EM+K++ H+  ++ PWNCPHGRPTMRH+++L  +
Sbjct  838  EMRKLVTHMGEIEHPWNCPHGRPTMRHIVNLDLI  871



>ref|XP_007513353.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16911.1| predicted protein [Bathycoccus prasinos]
Length=906

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRH  90
            R  M+KIL++L+ L+ PWNCPHGRPTMRH
Sbjct  874  RRRMKKILQNLSALERPWNCPHGRPTMRH  902



>ref|XP_006623631.1| PREDICTED: mismatch repair endonuclease PMS2-like, partial [Apis 
dorsata]
Length=609

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVH  114
            ++MQK++  +A +K+PW+CPHGRPT+RHL+ L  ++
Sbjct  574  SDMQKLIAQMAQMKNPWSCPHGRPTIRHLLSLNLIY  609



>ref|XP_003761534.1| PREDICTED: mismatch repair endonuclease PMS2 [Sarcophilus harrisii]
Length=997

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            +NEM+K++ H+  ++ PWNCPHGRPTMRH+  L  +
Sbjct  959  KNEMKKLISHMGEIEHPWNCPHGRPTMRHIASLNII  994



>ref|XP_006456424.1| hypothetical protein AGABI2DRAFT_122323 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV42739.1| hypothetical protein AGABI2DRAFT_122323 [Agaricus bisporus var. 
bisporus H97]
Length=1016

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  4     RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  120
             R++M  I+ H+  +  PWNCPHGRPTMRHL DL  V ++
Sbjct  965   RHQMLNIVRHMGTIDQPWNCPHGRPTMRHLADLWDVERQ  1003



>ref|XP_003114045.1| CRE-PMS-2 protein [Caenorhabditis remanei]
 gb|EFP05383.1| CRE-PMS-2 protein [Caenorhabditis remanei]
Length=831

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  4    RNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  102
            + EM +I+ HLA L  PWNCPHGRPT+RHL  L
Sbjct  792  QREMTRIIRHLAKLDQPWNCPHGRPTIRHLATL  824



>gb|KFO97904.1| Mismatch repair endonuclease PMS2, partial [Calypte anna]
Length=867

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  10   EMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTV  111
            EM+K++ H+  ++ PWNCPHGRPTMRH++ L  +
Sbjct  833  EMRKLITHMGEIEHPWNCPHGRPTMRHIVSLDMI  866



>gb|EFN70759.1| Mismatch repair endonuclease PMS2 [Camponotus floridanus]
Length=672

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    NEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  117
            NEM K++  +A +++PWNCPHGRPT+RH++ L  ++K
Sbjct  636  NEMHKLIMQMAQMQNPWNCPHGRPTIRHILSLLLINK  672



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563956788320