BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015G10 567 bp,

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P85190.1|FTSH_HELAN  RecName: Full=ATP-dependent zinc metallop...    291   2e-96   Helianthus annuus
emb|CDP09162.1|  unnamed protein product                                305   4e-95   Coffea canephora [robusta coffee]
ref|XP_007208088.1|  hypothetical protein PRUPE_ppa001447mg             304   1e-94   Prunus persica
ref|XP_008220458.1|  PREDICTED: ATP-dependent zinc metalloproteas...    302   7e-94   Prunus mume [ume]
gb|KDO66808.1|  hypothetical protein CISIN_1g003473mg                   297   8e-94   Citrus sinensis [apfelsine]
ref|XP_009616258.1|  PREDICTED: ATP-dependent zinc metalloproteas...    300   1e-93   Nicotiana tomentosiformis
ref|XP_009616257.1|  PREDICTED: ATP-dependent zinc metalloproteas...    300   1e-93   Nicotiana tomentosiformis
ref|XP_009758156.1|  PREDICTED: ATP-dependent zinc metalloproteas...    300   2e-93   Nicotiana sylvestris
ref|XP_006344040.1|  PREDICTED: ATP-dependent zinc metalloproteas...    301   2e-93   Solanum tuberosum [potatoes]
ref|XP_004240393.1|  PREDICTED: ATP-dependent zinc metalloproteas...    301   2e-93   Solanum lycopersicum
ref|XP_011080858.1|  PREDICTED: ATP-dependent zinc metalloproteas...    300   2e-93   Sesamum indicum [beniseed]
emb|CBI15999.3|  unnamed protein product                                293   4e-93   Vitis vinifera
gb|KDO66807.1|  hypothetical protein CISIN_1g003473mg                   294   6e-93   Citrus sinensis [apfelsine]
gb|KDO66806.1|  hypothetical protein CISIN_1g003473mg                   296   1e-92   Citrus sinensis [apfelsine]
gb|KDO66805.1|  hypothetical protein CISIN_1g003473mg                   297   2e-92   Citrus sinensis [apfelsine]
ref|XP_009374276.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    298   2e-92   Pyrus x bretschneideri [bai li]
ref|XP_007142220.1|  hypothetical protein PHAVU_008G262300g             294   4e-92   Phaseolus vulgaris [French bean]
ref|XP_006425024.1|  hypothetical protein CICLE_v10027831mg             297   4e-92   Citrus clementina
gb|EEE57480.1|  hypothetical protein OsJ_07728                          290   4e-92   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006425023.1|  hypothetical protein CICLE_v10027831mg             297   4e-92   Citrus clementina
ref|XP_008355315.1|  PREDICTED: ATP-dependent zinc metalloproteas...    297   5e-92   Malus domestica [apple tree]
ref|XP_010256642.1|  PREDICTED: ATP-dependent zinc metalloproteas...    295   6e-92   Nelumbo nucifera [Indian lotus]
ref|XP_007146736.1|  hypothetical protein PHAVU_006G065400g             295   7e-92   Phaseolus vulgaris [French bean]
gb|AHM26644.1|  ATP-dependent zinc metalloprotease FTSH 9 protein       296   1e-91   Pyrus x bretschneideri [bai li]
ref|XP_010535408.1|  PREDICTED: ATP-dependent zinc metalloproteas...    296   1e-91   Tarenaya hassleriana [spider flower]
gb|AID69950.1|  metalloprotease                                         295   1e-91   Cicer arietinum [garbanzo]
ref|XP_010256641.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   1e-91   Nelumbo nucifera [Indian lotus]
ref|XP_007146737.1|  hypothetical protein PHAVU_006G065400g             295   1e-91   Phaseolus vulgaris [French bean]
gb|KDP46528.1|  hypothetical protein JCGZ_08500                         295   1e-91   Jatropha curcas
ref|XP_002299826.2|  hypothetical protein POPTR_0001s25620g             295   2e-91   Populus trichocarpa [western balsam poplar]
gb|KHG16546.1|  ATP-dependent zinc metalloprotease FTSH 7, chloro...    295   2e-91   Gossypium arboreum [tree cotton]
ref|XP_007016170.1|  Cell division protease ftsH isoform 3              293   3e-91   Theobroma cacao [chocolate]
ref|XP_003556951.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   3e-91   Glycine max [soybeans]
ref|XP_009346878.1|  PREDICTED: ATP-dependent zinc metalloproteas...    295   3e-91   Pyrus x bretschneideri [bai li]
ref|XP_010256640.1|  PREDICTED: ATP-dependent zinc metalloproteas...    295   4e-91   Nelumbo nucifera [Indian lotus]
ref|XP_004295740.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   5e-91   Fragaria vesca subsp. vesca
ref|XP_010043456.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   6e-91   Eucalyptus grandis [rose gum]
ref|XP_002279721.1|  PREDICTED: ATP-dependent zinc metalloproteas...    294   6e-91   Vitis vinifera
ref|XP_007142221.1|  hypothetical protein PHAVU_008G262300g             293   6e-91   Phaseolus vulgaris [French bean]
ref|XP_010104679.1|  ATP-dependent zinc metalloprotease FTSH 9          294   7e-91   Morus notabilis
ref|XP_007016169.1|  Cell division protease ftsH isoform 2              294   7e-91   Theobroma cacao [chocolate]
gb|EYU38475.1|  hypothetical protein MIMGU_mgv1a002459mg                290   8e-91   Erythranthe guttata [common monkey flower]
gb|AFW63224.1|  hypothetical protein ZEAMMB73_643139                    289   8e-91   Zea mays [maize]
gb|KEH34197.1|  ATP-dependent zinc metalloprotease FTSH protein         293   1e-90   Medicago truncatula
ref|XP_007016168.1|  Cell division protease ftsH isoform 1              294   1e-90   Theobroma cacao [chocolate]
ref|XP_003544874.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   1e-90   Glycine max [soybeans]
gb|KHN40054.1|  ATP-dependent zinc metalloprotease FTSH 9, chloro...    292   1e-90   Glycine soja [wild soybean]
ref|XP_004164592.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    292   1e-90   
ref|XP_011035193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   2e-90   Populus euphratica
gb|KHN06251.1|  ATP-dependent zinc metalloprotease FTSH 9, chloro...    292   2e-90   Glycine soja [wild soybean]
ref|XP_002525603.1|  Cell division protein ftsH, putative               292   2e-90   Ricinus communis
ref|XP_003552962.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   2e-90   Glycine max [soybeans]
ref|XP_008384845.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   2e-90   Malus domestica [apple tree]
ref|XP_006575403.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   2e-90   Glycine max [soybeans]
ref|XP_004150623.1|  PREDICTED: ATP-dependent zinc metalloproteas...    293   2e-90   Cucumis sativus [cucumbers]
gb|KHN46165.1|  ATP-dependent zinc metalloprotease FTSH 9, chloro...    292   2e-90   Glycine soja [wild soybean]
dbj|BAJ93504.1|  predicted protein                                      283   2e-90   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010685603.1|  PREDICTED: ATP-dependent zinc metalloproteas...    292   3e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002314122.2|  FtsH protease family protein                       291   3e-90   Populus trichocarpa [western balsam poplar]
gb|KJB55765.1|  hypothetical protein B456_009G093300                    287   8e-90   Gossypium raimondii
ref|XP_006648884.1|  PREDICTED: ATP-dependent zinc metalloproteas...    290   8e-90   Oryza brachyantha
ref|XP_003615585.1|  Cell division protease ftsH-like protein           290   1e-89   
gb|KHG03482.1|  ATP-dependent zinc metalloprotease FTSH 7, chloro...    290   1e-89   Gossypium arboreum [tree cotton]
ref|XP_003615584.1|  Cell division protease ftsH-like protein           290   2e-89   Medicago truncatula
ref|XP_011032148.1|  PREDICTED: ATP-dependent zinc metalloproteas...    290   2e-89   Populus euphratica
ref|XP_004490581.1|  PREDICTED: ATP-dependent zinc metalloproteas...    290   2e-89   Cicer arietinum [garbanzo]
ref|NP_001047584.1|  Os02g0649700                                       290   3e-89   
ref|XP_008676836.1|  PREDICTED: uncharacterized protein LOC100273...    289   3e-89   Zea mays [maize]
ref|XP_010503322.1|  PREDICTED: ATP-dependent zinc metalloproteas...    289   3e-89   Camelina sativa [gold-of-pleasure]
ref|XP_008785415.1|  PREDICTED: ATP-dependent zinc metalloproteas...    290   3e-89   Phoenix dactylifera
ref|XP_010426160.1|  PREDICTED: ATP-dependent zinc metalloproteas...    289   3e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010515032.1|  PREDICTED: ATP-dependent zinc metalloproteas...    289   4e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010541444.1|  PREDICTED: ATP-dependent zinc metalloproteas...    288   5e-89   Tarenaya hassleriana [spider flower]
ref|XP_002875825.1|  hypothetical protein ARALYDRAFT_485083             288   7e-89   Arabidopsis lyrata subsp. lyrata
gb|KJB55769.1|  hypothetical protein B456_009G093300                    288   8e-89   Gossypium raimondii
gb|KJB55766.1|  hypothetical protein B456_009G093300                    288   1e-88   Gossypium raimondii
ref|XP_010923113.1|  PREDICTED: ATP-dependent zinc metalloproteas...    288   1e-88   Elaeis guineensis
ref|XP_004953292.1|  PREDICTED: ATP-dependent zinc metalloproteas...    287   2e-88   Setaria italica
ref|XP_006290608.1|  hypothetical protein CARUB_v10016697mg             287   3e-88   Capsella rubella
ref|NP_566889.1|  cell division protease ftsH-7                         286   3e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002454560.1|  hypothetical protein SORBIDRAFT_04g033360          286   6e-88   Sorghum bicolor [broomcorn]
ref|XP_002866296.1|  hypothetical protein ARALYDRAFT_496010             285   1e-87   Arabidopsis lyrata subsp. lyrata
ref|XP_009407555.1|  PREDICTED: ATP-dependent zinc metalloproteas...    285   1e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS68957.1|  ATP-dependent zinc metalloprotease FTSH 7, chloro...    282   2e-87   Triticum urartu
ref|XP_003569989.1|  PREDICTED: ATP-dependent zinc metalloproteas...    283   5e-87   Brachypodium distachyon [annual false brome]
ref|NP_001183588.1|  hypothetical protein                               283   9e-87   Zea mays [maize]
ref|XP_010483495.1|  PREDICTED: ATP-dependent zinc metalloproteas...    282   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010443637.1|  PREDICTED: ATP-dependent zinc metalloproteas...    282   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010454356.1|  PREDICTED: ATP-dependent zinc metalloproteas...    281   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006281572.1|  hypothetical protein CARUB_v10027679mg             281   3e-86   Capsella rubella
emb|CDX99070.1|  BnaA06g17610D                                          281   3e-86   Brassica napus [oilseed rape]
emb|CDX86121.1|  BnaC03g56360D                                          281   4e-86   Brassica napus [oilseed rape]
ref|XP_006404418.1|  hypothetical protein EUTSA_v10010128mg             281   5e-86   Eutrema salsugineum
ref|XP_006848119.1|  hypothetical protein AMTR_s00029p00219050          281   5e-86   Amborella trichopoda
ref|NP_568892.1|  FTSH protease 9                                       280   6e-86   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19912.1|  hypothetical protein B456_003G124400                    280   1e-85   Gossypium raimondii
ref|XP_009149936.1|  PREDICTED: ATP-dependent zinc metalloproteas...    279   2e-85   Brassica rapa
ref|XP_009149935.1|  PREDICTED: ATP-dependent zinc metalloproteas...    279   2e-85   Brassica rapa
emb|CDX80331.1|  BnaC09g34110D                                          278   2e-85   Brassica napus [oilseed rape]
emb|CDY54177.1|  BnaA10g29130D                                          278   4e-85   Brassica napus [oilseed rape]
gb|KFK27417.1|  hypothetical protein AALP_AA8G380000                    278   4e-85   Arabis alpina [alpine rockcress]
ref|XP_009120396.1|  PREDICTED: ATP-dependent zinc metalloproteas...    274   7e-84   Brassica rapa
ref|XP_009120395.1|  PREDICTED: ATP-dependent zinc metalloproteas...    274   8e-84   Brassica rapa
ref|XP_002883545.1|  hypothetical protein ARALYDRAFT_479981             273   2e-83   Arabidopsis lyrata subsp. lyrata
gb|KFK34023.1|  hypothetical protein AALP_AA5G091900                    274   2e-83   Arabis alpina [alpine rockcress]
gb|EAY86903.1|  hypothetical protein OsI_08286                          273   4e-83   Oryza sativa Indica Group [Indian rice]
ref|XP_006425022.1|  hypothetical protein CICLE_v10027831mg             259   2e-79   Citrus clementina
ref|XP_006488487.1|  PREDICTED: ATP-dependent zinc metalloproteas...    265   1e-78   
ref|XP_008457389.1|  PREDICTED: phosphomethylpyrimidine synthase,...    262   6e-78   Cucumis melo [Oriental melon]
ref|XP_004500235.1|  PREDICTED: phosphomethylpyrimidine synthase,...    262   9e-78   
gb|AFN53660.1|  ThiC family protein                                     255   9e-76   Linum usitatissimum
ref|XP_010923120.1|  PREDICTED: phosphomethylpyrimidine synthase,...    253   2e-74   Elaeis guineensis
ref|XP_009407557.1|  PREDICTED: phosphomethylpyrimidine synthase,...    252   5e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69421.1|  hypothetical protein M569_05343                         234   1e-71   Genlisea aurea
ref|XP_002968084.1|  hypothetical protein SELMODRAFT_440261             243   1e-71   Selaginella moellendorffii
ref|XP_002965601.1|  hypothetical protein SELMODRAFT_167789             242   2e-71   Selaginella moellendorffii
ref|XP_001753685.1|  predicted protein                                  227   4e-66   Physcomitrella patens
dbj|BAD25581.1|  cell division protein FtsH3-like                       202   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005848949.1|  hypothetical protein CHLNCDRAFT_51635              203   5e-58   Chlorella variabilis
ref|XP_005645741.1|  ATP-dependent metallopeptidase Hfl                 199   7e-57   Coccomyxa subellipsoidea C-169
gb|KIZ06390.1|  cell division protease FtsH                             199   2e-56   Monoraphidium neglectum
ref|XP_001420133.1|  AAA-metalloprotease FtsH, chloroplast precursor    193   3e-54   Ostreococcus lucimarinus CCE9901
ref|WP_035907900.1|  cell division protein FtsH                         192   3e-54   
ref|WP_024790353.1|  cell division protein FtsH                         192   4e-54   Lebetimonas sp. JH292
ref|WP_024791044.1|  MULTISPECIES: cell division protein FtsH           192   4e-54   Lebetimonas
ref|WP_007474894.1|  cell division protein FtsH                         192   4e-54   Caminibacter mediatlanticus
ref|XP_003055580.1|  predicted protein                                  191   6e-54   Micromonas pusilla CCMP1545
ref|WP_036488675.1|  cell division protein FtsH                         191   1e-53   Myxosarcina sp. GI1
ref|WP_009457520.1|  MULTISPECIES: cell division protein FtsH           190   3e-53   Fischerella
ref|XP_003081603.1|  putative cell division protein FtsH3 [Oryza ...    191   3e-53   Ostreococcus tauri
emb|CEF99366.1|  P-loop containing nucleoside triphosphate hydrolase    191   3e-53   Ostreococcus tauri
ref|WP_012663665.1|  cell division protein FtsH                         189   4e-53   Nautilia profundicola
ref|WP_026086128.1|  cell division protein FtsH                         189   5e-53   Fischerella muscicola
ref|WP_026943798.1|  cell division protein FtsH                         189   5e-53   Helicobacter rodentium
ref|WP_016877481.1|  hypothetical protein                               189   5e-53   Chlorogloeopsis fritschii
gb|KGL36723.1|  cell division protein FtsH                              189   6e-53   Helicobacter sp. MIT 05-5294
ref|WP_015154152.1|  membrane protease FtsH catalytic subunit           189   7e-53   Chroococcidiopsis thermalis
ref|WP_039714311.1|  cell division protein FtsH                         189   8e-53   Scytonema millei
ref|WP_034553264.1|  cell division protein FtsH                         188   1e-52   Helicobacter apodemus
ref|XP_002503552.1|  predicted protein                                  190   1e-52   Micromonas commoda
ref|WP_016859315.1|  cell division protein FtsH                         188   1e-52   Fischerella muscicola
ref|WP_006802112.1|  cell division protein FtsH                         188   1e-52   Helicobacter winghamensis
ref|WP_015208959.1|  membrane protease FtsH catalytic subunit           188   1e-52   Cylindrospermum stagnale
ref|WP_009555088.1|  membrane protease FtsH catalytic subunit           188   1e-52   Oscillatoriales cyanobacterium JSC-12
dbj|BAF70516.1|  cell division protein FtsH                             188   1e-52   Nitratiruptor sp. SB155-2
ref|WP_041354322.1|  cell division protein FtsH                         188   2e-52   
ref|WP_016874966.1|  cell division protein FtsH                         188   2e-52   Chlorogloeopsis fritschii
ref|WP_006656079.1|  cell division protein FtsH                         187   2e-52   Helicobacter canadensis
ref|WP_005021552.1|  cell division protein FtsH                         187   4e-52   Helicobacter pullorum
ref|WP_024962264.1|  cell division protein FtsH                         186   5e-52   Campylobacter ureolyticus
ref|WP_026081972.1|  MULTISPECIES: cell division protein FtsH           186   5e-52   Hapalosiphonaceae
ref|WP_011319019.1|  cell division protein FtsH                         186   6e-52   
ref|WP_015188679.1|  membrane protease FtsH catalytic subunit           186   6e-52   Gloeocapsa sp. PCC 7428
ref|WP_026720283.1|  cell division protein FtsH                         186   7e-52   Fischerella sp. PCC 9431
ref|WP_010999062.1|  cell division protein FtsH                         186   7e-52   Nostoc sp. PCC 7120
ref|WP_034562379.1|  cell division protein FtsH                         186   7e-52   Helicobacter bilis
ref|WP_034575614.1|  cell division protein FtsH                         186   8e-52   Helicobacter bilis
ref|WP_034290148.1|  cell division protein FtsH                         186   8e-52   Helicobacter sp. MIT 11-5569
ref|WP_034346232.1|  cell division protein FtsH                         186   9e-52   Helicobacter trogontum
ref|WP_034318612.1|  cell division protein FtsH                         186   1e-51   Helicobacter trogontum
ref|WP_017292221.1|  hypothetical protein                               186   1e-51   Leptolyngbya boryana
ref|WP_005219947.1|  cell division protein FtsH                         186   1e-51   Helicobacter bilis
ref|WP_026735191.1|  cell division protein FtsH                         186   1e-51   Fischerella sp. PCC 9605
ref|WP_004084199.1|  ATP-dependent zinc metalloprotease FtsH            185   1e-51   Helicobacter bilis
ref|WP_018712818.1|  cell division protein FtsH                         185   2e-51   Campylobacter ureolyticus
ref|WP_017320334.1|  cell division protein FtsH                         185   2e-51   cyanobacterium PCC 7702
ref|WP_041034268.1|  cell division protein FtsH                         185   2e-51   Tolypothrix campylonemoides
ref|WP_036000502.1|  cell division protein FtsH                         185   3e-51   Leptolyngbya sp. JSC-1
ref|WP_027403321.1|  cell division protein FtsH                         184   3e-51   Aphanizomenon flos-aquae
ref|WP_011138552.1|  cell division protein FtsH                         184   3e-51   Wolinella succinogenes
ref|WP_016646602.1|  ATP-dependent metallopeptidase HflB                184   3e-51   Campylobacter ureolyticus
ref|WP_034587126.1|  cell division protein FtsH                         181   4e-51   Helicobacter magdeburgensis
ref|WP_015139746.1|  ATP-dependent metalloprotease FtsH                 184   4e-51   Nostoc sp. PCC 7524
ref|WP_034571832.1|  cell division protein FtsH                         184   5e-51   Helicobacter saguini
ref|WP_009294674.1|  cell division protein FtsH                         184   5e-51   Campylobacter sp. 10_1_50
gb|KIE07254.1|  cell division protein FtsH                              184   5e-51   Tolypothrix bouteillei VB521301
ref|WP_034557617.1|  cell division protein FtsH                         183   6e-51   Helicobacter muridarum
ref|WP_034963332.1|  cell division protein FtsH                         183   8e-51   Campylobacter
ref|WP_038453951.1|  cell division protein FtsH                         183   8e-51   Campylobacter fetus
ref|WP_017286499.1|  cell division protein FtsH                         183   9e-51   Leptolyngbya boryana
ref|WP_023929095.1|  ATP-dependent zinc metalloprotease FtsH            183   9e-51   Helicobacter canis
ref|WP_042204380.1|  cell division protein FtsH                         183   9e-51   
ref|WP_024954334.1|  cell division protein FtsH                         183   9e-51   Sulfurospirillum arcachonense
ref|WP_002850165.1|  cell division protein FtsH                         183   1e-50   Campylobacter fetus
ref|WP_017318012.1|  cell division protein FtsH                         183   1e-50   Mastigocladopsis repens
ref|WP_039674317.1|  cell division protein FtsH                         183   1e-50   
ref|WP_042960456.1|  cell division protein FtsH                         183   1e-50   Campylobacter fetus
ref|WP_021085972.1|  Cell division protein FtsH                         183   1e-50   Campylobacter concisus
ref|WP_014770003.1|  cell division protein FtsH                         183   1e-50   Sulfurospirillum barnesii
ref|WP_021087314.1|  Cell division protein FtsH                         182   1e-50   Campylobacter concisus
ref|WP_002939560.1|  cell division protein FtsH                         182   1e-50   Campylobacter concisus
ref|WP_041962243.1|  cell division protein FtsH                         182   1e-50   Sulfurospirillum cavolei
ref|WP_011056378.1|  cell division protein FtsH                         182   1e-50   Thermosynechococcus elongatus
gb|ADV46934.1|  membrane protease FtsH catalytic subunit                183   1e-50   Nitratifractor salsuginis DSM 16511
ref|WP_021093258.1|  Cell division protein FtsH                         182   1e-50   Campylobacter concisus
ref|WP_021083679.1|  Cell division protein FtsH                         182   1e-50   Campylobacter concisus
ref|WP_021088663.1|  Cell division protein FtsH                         182   1e-50   Campylobacter concisus
ref|WP_012857526.1|  cell division protein FtsH                         182   2e-50   Sulfurospirillum deleyianum
ref|WP_026098162.1|  cell division protein FtsH                         182   2e-50   Oscillatoria sp. PCC 10802
ref|WP_023948357.1|  cell division protein FtsH                         182   2e-50   Helicobacter fennelliae
ref|WP_009756749.1|  cell division protein FtsH                         182   2e-50   Fischerella sp. JSC-11
ref|WP_036001999.1|  cell division protein FtsH                         182   2e-50   Leptolyngbya sp. JSC-1
ref|WP_013191669.1|  cell division protein FtsH                         182   2e-50   Trichormus azollae
ref|WP_026803284.1|  cell division protein FtsH                         182   2e-50   Arcobacter lanthieri
ref|WP_021091790.1|  Cell division protein FtsH                         182   2e-50   Campylobacter concisus
ref|WP_026807393.1|  MULTISPECIES: cell division protein FtsH           182   2e-50   Arcobacter lanthieri
ref|WP_016872112.1|  cell division protein FtsH                         182   2e-50   Fischerella thermalis
ref|WP_024125932.1|  ATP-dependent metalloprotease FtsH                 182   2e-50   Thermosynechococcus sp. NK55a
ref|WP_015214840.1|  membrane protease FtsH catalytic subunit           182   3e-50   Anabaena cylindrica
ref|WP_025345545.1|  cell division protein FtsH                         182   3e-50   Sulfurospirillum multivorans
ref|WP_006276244.1|  cell division protein FtsH                         181   4e-50   Cylindrospermopsis
ref|WP_022176679.1|  aTP-dependent zinc metalloprotease FtsH 1          179   4e-50   
ref|WP_034370032.1|  cell division protein FtsH                         181   4e-50   Helicobacter sp. MIT 05-5293
ref|WP_041960193.1|  cell division protein FtsH                         181   4e-50   Sulfurospirillum arsenophilum
ref|WP_026731936.1|  cell division protein FtsH                         181   5e-50   Fischerella sp. PCC 9605
ref|WP_016870296.1|  cell division protein FtsH                         181   5e-50   Fischerella muscicola
ref|WP_034561122.1|  cell division protein FtsH                         181   5e-50   
ref|WP_022188277.1|  aTP-dependent zinc metalloprotease FtsH 3          181   5e-50   
ref|WP_010474225.1|  ATP-dependent metalloprotease FtsH-like protein    172   6e-50   
gb|ETD24210.1|  ATP-dependent zinc metalloprotease FtsH                 181   6e-50   Helicobacter macacae MIT 99-5501
ref|WP_038454863.1|  cell division protein FtsH                         181   6e-50   Campylobacter iguaniorum
ref|WP_034418645.1|  cell division protein FtsH                         181   6e-50   
ref|WP_037959274.1|  cell division protein FtsH                         181   7e-50   
ref|WP_021998469.1|  aTP-dependent zinc metalloprotease FtsH 2          180   7e-50   
ref|WP_035989179.1|  cell division protein FtsH                         180   7e-50   
ref|WP_002957163.1|  cell division protein FtsH                         181   7e-50   Helicobacter cinaedi
ref|WP_022221351.1|  aTP-dependent zinc metalloprotease FtsH 2          180   7e-50   
ref|WP_023385675.1|  integral membrane ATP-dependent zinc metallo...    181   7e-50   Campylobacter fetus
ref|WP_013022576.1|  cell division protein FtsH                         180   8e-50   Helicobacter mustelae
ref|WP_039362711.1|  cell division protein FtsH                         181   8e-50   Campylobacter fetus
ref|WP_006017260.1|  Cell division protein FtsH                         180   8e-50   Helicobacter bizzozeronii
ref|WP_035157439.1|  cell division protein FtsH                         180   8e-50   Calothrix sp. 336/3
gb|AFY47588.1|  ATP-dependent metalloprotease FtsH                      180   9e-50   Nostoc sp. PCC 7524
ref|WP_013890273.1|  cell division protein FtsH                         180   9e-50   Helicobacter bizzozeronii
ref|WP_025803181.1|  cell division protein FtsH                         180   9e-50   Campylobacter corcagiensis
ref|WP_016950143.1|  cell division protein FtsH                         180   9e-50   Anabaena sp. PCC 7108 [Anabaena PCC7108]
gb|EEC55736.1|  ATP-dependent metallopeptidase HflB [                   178   9e-50   [Bacteroides] pectinophilus ATCC 43243
emb|CCM11394.1|  Cell division protein FtsH                             180   9e-50   Helicobacter heilmannii ASB1.4
ref|WP_039741395.1|  cell division protein FtsH                         180   1e-49   Hassallia byssoidea
ref|WP_013469705.1|  cell division protein FtsH                         180   1e-49   Helicobacter felis
gb|KIJ83876.1|  cell division protein FtsH                              180   1e-49   Scytonema tolypothrichoides VB-61278
ref|WP_014660828.1|  cell division protein FtsH                         180   1e-49   Helicobacter cetorum
ref|WP_012083718.1|  cell division protein FtsH                         180   1e-49   Sulfurovum sp. NBC37-1
ref|WP_027326950.1|  cell division protein FtsH                         180   1e-49   Helicobacter pametensis
ref|WP_034375414.1|  cell division protein FtsH                         180   1e-49   Helicobacter suis
ref|WP_002951763.1|  cell division protein FtsH                         177   1e-49   Campylobacter showae
ref|WP_029636553.1|  cell division protein FtsH [                       180   1e-49   [Scytonema hofmanni] UTEX B 1581
ref|WP_022080378.1|  aTP-dependent zinc metalloprotease FtsH 2          179   2e-49   
gb|AAP77419.1|  membrane bound zinc metallopeptidase                    179   2e-49   Helicobacter hepaticus ATCC 51449
ref|WP_026072804.1|  cell division protein FtsH                         179   2e-49   Nodosilinea nodulosa
gb|EFX42304.1|  cell division protein (ftsH)                            179   2e-49   Helicobacter suis HS5
ref|WP_016874424.1|  cell division protein FtsH                         179   2e-49   Chlorogloeopsis fritschii
ref|WP_034328022.1|  MULTISPECIES: cell division protein FtsH           179   2e-49   Helicobacter
ref|WP_022518287.1|  aTP-dependent zinc metalloprotease FtsH 3          175   2e-49   
ref|WP_017651750.1|  cell division protein FtsH                         179   2e-49   Fortiea contorta
ref|WP_041309026.1|  cell division protein FtsH                         179   2e-49   Helicobacter hepaticus
ref|WP_034366577.1|  cell division protein FtsH                         179   2e-49   Helicobacter sp. MIT 03-1614
ref|WP_014659755.1|  cell division protein FtsH                         179   2e-49   Helicobacter cetorum
ref|WP_017321055.1|  cell division protein FtsH                         179   2e-49   cyanobacterium PCC 7702
ref|WP_034354142.1|  cell division protein FtsH                         179   2e-49   Helicobacter sp. MIT 09-6949
ref|WP_022143227.1|  aTP-dependent zinc metalloprotease FtsH 2          179   3e-49   
ref|WP_034216553.1|  MULTISPECIES: cell division protein FtsH           179   3e-49   Arcobacter
ref|WP_022177404.1|  aTP-dependent zinc metalloprotease FtsH 2          179   3e-49   
ref|WP_000805324.1|  cell division protein FtsH                         179   3e-49   Helicobacter pylori
ref|WP_018136955.1|  cell division protein FtsH                         179   3e-49   Campylobacter curvus
ref|WP_015178108.1|  ATP-dependent metalloprotease FtsH                 178   3e-49   Oscillatoria nigro-viridis
ref|WP_009651011.1|  cell division protein FtsH                         179   4e-49   Campylobacter sp. FOBRC14
ref|WP_011991921.1|  cell division protein FtsH                         179   4e-49   Campylobacter curvus
ref|WP_009492849.1|  Cell division protein FtsH                         178   4e-49   Campylobacter showae
ref|WP_015521940.1|  ATP-dependent metalloprotease FtsH                 177   4e-49   
ref|WP_044667285.1|  cell division protein FtsH                         174   4e-49   
ref|WP_015117438.1|  membrane protease FtsH catalytic subunit           178   5e-49   Rivularia sp. PCC 7116
ref|WP_034218497.1|  cell division protein FtsH                         178   5e-49   Arcobacter cibarius
ref|WP_021857567.1|  aTP-dependent zinc metalloprotease FtsH 2          178   5e-49   
ref|WP_026609054.1|  cell division protein FtsH                         178   5e-49   
ref|WP_022123159.1|  aTP-dependent zinc metalloprotease FtsH 2          178   5e-49   
ref|WP_009342487.1|  cell division protein FtsH                         178   6e-49   Raphidiopsis brookii
ref|WP_014081103.1|  cell division protein FtsH                         177   6e-49   Roseburia hominis
emb|CDZ75612.1|  ATP-dependent zinc metalloprotease FtsH                178   6e-49   Peptoniphilus sp. 1-1
ref|WP_012740920.1|  cell division protein FtsH [                       177   6e-49   
ref|WP_005360262.1|  cell division protein FtsH                         177   6e-49   
ref|WP_006858448.1|  cell division protein FtsH                         177   6e-49   
ref|WP_007887598.1|  cell division protein FtsH                         177   6e-49   
ref|WP_015559639.1|  ATP-dependent metalloprotease FtsH                 177   6e-49   
ref|WP_005425239.1|  cell division protein FtsH [                       178   6e-49   
ref|WP_008370202.1|  cell division protein FtsH                         177   6e-49   
ref|WP_015567831.1|  ATP-dependent metalloprotease FtsH                 177   6e-49   
ref|WP_012744216.1|  cell division protein FtsH                         177   7e-49   
ref|WP_033754548.1|  cell division protein FtsH                         177   8e-49   
ref|WP_013327528.1|  cell division protein FtsH                         178   8e-49   
ref|WP_035400140.1|  ATPase AAA                                         178   8e-49   
ref|WP_024053390.1|  ATP-dependent zinc metalloprotease FtsH            171   8e-49   
ref|WP_015113687.1|  membrane protease FtsH catalytic subunit           177   9e-49   
ref|WP_027845049.1|  cell division protein FtsH                         177   9e-49   
ref|WP_041140520.1|  MULTISPECIES: cell division protein FtsH           177   1e-48   
ref|WP_012499911.1|  ATPase AAA                                         177   1e-48   
gb|EJG48268.1|  hypothetical protein AMCSP06_002295                     173   1e-48   
ref|WP_000805269.1|  cell division protein FtsH                         177   1e-48   
ref|WP_022387846.1|  aTP-dependent zinc metalloprotease FtsH 3          177   1e-48   
ref|WP_006779945.1|  cell division protein FtsH [                       177   1e-48   
ref|WP_017323727.1|  hypothetical protein                               177   1e-48   
ref|WP_006860728.1|  cell division protein FtsH                         177   1e-48   
ref|WP_014473312.1|  cell division protein FtsH                         177   1e-48   
ref|WP_039376273.1|  hypothetical protein                               177   1e-48   
ref|XP_010680899.1|  PREDICTED: ATP-dependent zinc metalloproteas...    165   1e-48   
ref|WP_001941969.1|  cell division protease FtsH                        177   1e-48   
ref|WP_034362287.1|  cell division protein FtsH                         177   1e-48   
ref|WP_000805265.1|  cell division protein FtsH                         177   1e-48   
ref|WP_037044691.1|  cell division protein FtsH                         177   1e-48   
ref|WP_024542056.1|  MULTISPECIES: cell division protein FtsH           177   1e-48   
ref|WP_001956677.1|  cell division protease FtsH                        177   1e-48   
ref|WP_000805323.1|  cell division protein FtsH                         177   1e-48   
ref|WP_000805266.1|  cell division protein FtsH                         177   1e-48   
ref|WP_001940393.1|  cell division protease FtsH                        177   1e-48   
ref|WP_000805263.1|  cell division protein FtsH                         177   1e-48   
ref|WP_000805260.1|  cell division protein FtsH                         177   1e-48   
ref|WP_001923652.1|  ATP-dependent zinc metalloprotease FtsH            177   1e-48   
gb|ENZ75995.1|  membrane protease FtsH catalytic subunit                177   1e-48   
ref|WP_000805308.1|  cell division protein FtsH                         177   1e-48   
ref|WP_033778324.1|  cell division protein FtsH                         177   2e-48   
ref|WP_033597204.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805311.1|  cell division protein FtsH                         177   2e-48   
ref|WP_001943162.1|  cell division protease FtsH                        177   2e-48   
ref|WP_000805310.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805309.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805322.1|  cell division protein FtsH                         177   2e-48   
gb|ACD29480.1|  ATP-dependent metalloprotease FtsH                      177   2e-48   
ref|WP_033745006.1|  cell division protein FtsH                         177   2e-48   
ref|WP_001928072.1|  cell division protease FtsH                        177   2e-48   
ref|WP_000805291.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805298.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805303.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805321.1|  cell division protein FtsH                         177   2e-48   
ref|WP_002949836.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805305.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805304.1|  cell division protein FtsH                         177   2e-48   
ref|WP_009241739.1|  MULTISPECIES: ATPase AAA                           177   2e-48   
ref|WP_000805264.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805307.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805306.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805273.1|  cell division protein FtsH                         177   2e-48   
ref|WP_035986982.1|  cell division protein FtsH                         177   2e-48   
ref|WP_033743349.1|  cell division protein FtsH                         177   2e-48   
ref|WP_021582438.1|  cell division protease FtsH                        177   2e-48   
ref|WP_042631649.1|  cell division protein FtsH                         177   2e-48   
ref|WP_024368987.1|  cell division protein FtsH                         177   2e-48   
ref|WP_001962669.1|  cell division protease FtsH                        177   2e-48   
ref|WP_000805317.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805255.1|  cell division protein FtsH                         177   2e-48   
ref|WP_001964812.1|  cell division protease FtsH                        177   2e-48   
ref|WP_000805293.1|  cell division protein FtsH                         177   2e-48   
ref|WP_008244273.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805253.1|  cell division protein FtsH                         177   2e-48   
ref|WP_033777386.1|  cell division protein FtsH                         177   2e-48   
ref|WP_000805316.1|  cell division protein FtsH                         177   2e-48   
ref|WP_021173343.1|  cell division protein FtsH                         177   2e-48   
ref|WP_001947529.1|  cell division protease FtsH                        177   2e-48   
ref|WP_000805262.1|  cell division protein FtsH                         177   2e-48   
ref|WP_015168022.1|  ATP-dependent metalloprotease FtsH                 176   2e-48   
ref|WP_015086990.1|  cell division protein (ftsH)                       176   2e-48   
ref|WP_011143134.1|  cell division protein FtsH                         176   2e-48   
ref|WP_000805297.1|  cell division protein FtsH                         176   2e-48   
emb|CCY32286.1|  aTP-dependent zinc metalloprotease FtsH 2              176   2e-48   
ref|WP_015513037.1|  ATP-dependent metalloprotease FtsH                 176   2e-48   
ref|WP_000805292.1|  cell division protein FtsH                         176   2e-48   
ref|WP_015129291.1|  membrane protease FtsH catalytic subunit           176   2e-48   
ref|WP_003014770.1|  ATP-dependent zinc metalloprotease FtsH            176   2e-48   
ref|WP_000805274.1|  cell division protein FtsH                         176   2e-48   
ref|WP_013977027.1|  cell division protein FtsH                         176   2e-48   
ref|WP_001256130.1|  cell division protein FtsH                         176   2e-48   
ref|WP_000805261.1|  cell division protein FtsH                         176   2e-48   
ref|WP_033761340.1|  cell division protein FtsH                         176   2e-48   
ref|WP_009284088.1|  peptidase M41                                      176   2e-48   
ref|WP_000805314.1|  cell division protein FtsH                         176   2e-48   
ref|WP_000805312.1|  cell division protein FtsH                         176   2e-48   
ref|WP_021175347.1|  cell division protein FtsH                         176   2e-48   
ref|WP_024111791.1|  cell division protein FtsH                         176   2e-48   
ref|WP_039093065.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805251.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805267.1|  cell division protein FtsH                         176   3e-48   
ref|WP_039083020.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805287.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805313.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805296.1|  cell division protein FtsH                         176   3e-48   
ref|WP_039086127.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805299.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805256.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805249.1|  cell division protein FtsH                         176   3e-48   
ref|WP_015428766.1|  cell division protein                              176   3e-48   
ref|WP_000805250.1|  cell division protein FtsH                         176   3e-48   
ref|WP_022215479.1|  aTP-dependent zinc metalloprotease FtsH 3          176   3e-48   
ref|WP_001916920.1|  cell division protease FtsH                        176   3e-48   
ref|WP_000805319.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805282.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805283.1|  cell division protein FtsH                         176   3e-48   
ref|WP_040158114.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805281.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805300.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805277.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805275.1|  cell division protein FtsH                         176   3e-48   
ref|WP_039704328.1|  cell division protein FtsH                         176   3e-48   
ref|WP_039089629.1|  cell division protein FtsH                         176   3e-48   
ref|WP_024750829.1|  cell division protein FtsH                         176   3e-48   
ref|WP_021305117.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805288.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805286.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805259.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805295.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805279.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805325.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805328.1|  cell division protein FtsH                         176   3e-48   
gb|EET43564.1|  ATP-dependent metallopeptidase HflB                     171   3e-48   
ref|WP_025366364.1|  cell division protein FtsH                         176   3e-48   
ref|WP_022576873.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805284.1|  cell division protein FtsH                         176   3e-48   
ref|WP_041050908.1|  cell division protein FtsH                         176   3e-48   
ref|WP_017281327.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805326.1|  cell division protein FtsH                         176   3e-48   
ref|WP_015085560.1|  cell division protein (ftsH)                       176   3e-48   
ref|WP_000805318.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805276.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805254.1|  cell division protein FtsH                         176   3e-48   
ref|WP_039086689.1|  cell division protein FtsH                         176   3e-48   
ref|WP_042636217.1|  cell division protein FtsH                         176   3e-48   
ref|WP_042634096.1|  cell division protein FtsH                         176   3e-48   
ref|WP_015643037.1|  cell division protein                              176   3e-48   
ref|WP_000805294.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805280.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805301.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805278.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805289.1|  cell division protein FtsH                         176   3e-48   
ref|WP_033742329.1|  cell division protein FtsH                         176   3e-48   
ref|WP_015643995.1|  cell division protein (FtsH)                       176   3e-48   
ref|WP_000805327.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805320.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805258.1|  cell division protein FtsH                         176   3e-48   
ref|WP_024113192.1|  cell division protein FtsH                         176   3e-48   
ref|WP_021304637.1|  cell division protein FtsH                         176   3e-48   
ref|WP_021299980.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805302.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000805285.1|  cell division protein FtsH                         176   3e-48   
ref|WP_033736259.1|  cell division protein FtsH                         176   3e-48   
ref|WP_021944518.1|  aTP-dependent zinc metalloprotease FtsH 2          176   3e-48   
ref|WP_017280184.1|  cell division protein FtsH                         176   3e-48   
ref|WP_033755883.1|  cell division protein FtsH                         176   3e-48   
ref|WP_000652203.1|  hypothetical protein                               172   3e-48   
ref|WP_008352470.1|  cell division protein FtsH                         176   3e-48   
ref|WP_015540655.1|  ATP-dependent metalloprotease FtsH [               176   3e-48   
ref|WP_000805329.1|  cell division protein FtsH                         176   3e-48   
ref|WP_034579304.1|  cell division protein FtsH                         176   3e-48   
ref|WP_021436395.1|  ATP-dependent metallopeptidase HflB family p...    176   3e-48   
ref|WP_015142181.1|  ATP-dependent metalloprotease FtsH                 176   3e-48   
ref|WP_000805268.1|  cell division protein FtsH                         176   4e-48   
ref|WP_007595654.1|  cell division protein FtsH                         176   4e-48   
ref|WP_033615246.1|  cell division protein FtsH                         176   4e-48   
ref|WP_001933660.1|  cell division protease FtsH                        176   4e-48   
ref|WP_000805315.1|  cell division protein FtsH                         176   4e-48   
ref|WP_000805257.1|  cell division protein FtsH                         176   4e-48   
ref|WP_015122871.1|  membrane protease FtsH catalytic subunit           176   4e-48   
ref|WP_033616494.1|  cell division protein FtsH                         176   4e-48   
ref|WP_000805270.1|  cell division protein FtsH                         176   4e-48   
ref|WP_033751055.1|  cell division protein FtsH                         176   4e-48   
ref|WP_020972056.1|  ATP-dependent metallopeptidase HflB family p...    176   4e-48   
ref|WP_033764447.1|  cell division protein FtsH                         176   4e-48   
ref|WP_033754259.1|  cell division protein FtsH                         176   4e-48   
ref|WP_033602144.1|  cell division protein FtsH                         176   4e-48   
ref|WP_033759420.1|  cell division protein FtsH                         176   4e-48   
ref|WP_011578046.1|  cell division protein FtsH                         176   4e-48   
gb|EQY56812.1|  ATP-dependent zinc metalloprotease FtsH                 166   5e-48   
ref|WP_036010247.1|  cell division protein FtsH                         175   5e-48   
ref|WP_019490592.1|  cell division protein FtsH                         175   5e-48   
ref|WP_016413152.1|  aTP-dependent zinc metalloprotease FtsH 1          175   6e-48   
ref|WP_027725245.1|  cell division protein FtsH                         175   6e-48   
ref|WP_041135541.1|  cell division protein FtsH                         175   6e-48   
ref|WP_033604061.1|  cell division protein FtsH                         175   6e-48   
ref|WP_006513597.1|  membrane protease FtsH catalytic subunit           175   6e-48   
ref|WP_021986000.1|  aTP-dependent zinc metalloprotease FtsH 2          175   7e-48   
ref|WP_023526763.1|  cell division protein FtsH                         175   7e-48   
ref|WP_013967933.1|  cell division protein FtsH                         175   7e-48   
ref|WP_021906937.1|  aTP-dependent zinc metalloprotease FtsH 1          175   7e-48   
ref|WP_006635192.1|  cell division protein FtsH                         175   7e-48   
gb|EHO49456.1|  putative cell division protease FtsH                    171   7e-48   
ref|WP_026087179.1|  cell division protein FtsH                         175   7e-48   
ref|WP_033122428.1|  cell division protein FtsH                         175   7e-48   
ref|WP_000805252.1|  cell division protein FtsH                         175   7e-48   
ref|WP_027305719.1|  cell division protein FtsH                         175   7e-48   
ref|WP_005345402.1|  cell division protein FtsH [                       174   8e-48   
ref|WP_022169752.1|  aTP-dependent zinc metalloprotease FtsH 1          174   8e-48   
ref|WP_009220057.1|  cell division protein FtsH                         174   8e-48   
ref|WP_012108362.1|  cell division protein FtsH                         175   9e-48   
ref|WP_021686796.1|  ATP-dependent metallopeptidase HflB                175   9e-48   
ref|WP_015142682.1|  ATP-dependent metalloprotease FtsH                 174   9e-48   
ref|WP_021858839.1|  aTP-dependent zinc metalloprotease FtsH 1          174   9e-48   
ref|WP_033794296.1|  cell division protein FtsH                         174   9e-48   
ref|WP_028324854.1|  cell division protein FtsH                         174   9e-48   
ref|WP_038840415.1|  cell division protein FtsH                         175   9e-48   
ref|WP_038838461.1|  cell division protein FtsH                         174   1e-47   
ref|WP_038842648.1|  cell division protein FtsH                         174   1e-47   
ref|XP_007510243.1|  ATP-dependent metalloprotease FtsH                 176   1e-47   
emb|CDG57226.1|  Cell division protein FtsH                             174   1e-47   



>sp|P85190.1|FTSH_HELAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic, 
partial [Helianthus annuus]
Length=260

 Score =   291 bits (746),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  42   AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  101

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GR++IL VH SKKELPL  DVDL  IASMTTGF
Sbjct  102  RADVLDPALRRPGRFDRVVMVETPDRVGRQAILNVHVSKKELPLGDDVDLASIASMTTGF  161

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEKIDFI AVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  162  TGADLANLVNEAALLAGRQNKVVVEKIDFIHAVERSIAGIEKKTAKLQGSEKAVVARH  219



>emb|CDP09162.1| unnamed protein product [Coffea canephora]
Length=819

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  430  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  489

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDRTGRE+ILKVH +KKELPLA+DVD+GDIA MTTGF
Sbjct  490  RSDVLDPALRRPGRFDRVVMVEAPDRTGREAILKVHIAKKELPLAEDVDIGDIACMTTGF  549

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+KL+VEKIDFIQAVERSIAGIEKK AKL+G EKAVVARH
Sbjct  550  TGADLANLVNEAALLAGRQSKLVVEKIDFIQAVERSIAGIEKKTAKLKGGEKAVVARH  607



>ref|XP_007208088.1| hypothetical protein PRUPE_ppa001447mg [Prunus persica]
 gb|EMJ09287.1| hypothetical protein PRUPE_ppa001447mg [Prunus persica]
Length=827

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  429  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  488

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDRTGRE+ILKVH SKKELPLA+DV LGDIASMTTGF
Sbjct  489  RSDVLDPALRRPGRFDRVVMVETPDRTGREAILKVHVSKKELPLAKDVYLGDIASMTTGF  548

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+K++VEKIDFIQAVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  549  TGADLANLVNEAALLAGRQSKVVVEKIDFIQAVERSIAGIEKKTAKLQGSEKAVVARH  606



>ref|XP_008220458.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Prunus mume]
Length=835

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  429  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  488

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDRTGRE+ILKVH SKKELPLA+DV LGDIASMTTGF
Sbjct  489  RSDVLDPALRRPGRFDRVVMVETPDRTGREAILKVHVSKKELPLAKDVYLGDIASMTTGF  548

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+K++VEKIDFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  549  TGADLANLVNEAALLAGRQSKVVVEKIDFIQAVERSIAGIEKKTAKLRGSEKAVVARH  606



>gb|KDO66808.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
 gb|KDO66809.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
Length=641

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  420  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  479

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  480  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  539

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  540  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARH  597



>ref|XP_009616258.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=759

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  411  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  470

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR GRE+ILKVH SKKELPLAQDV+LG+IASMTTGF
Sbjct  471  RSDVLDPALRRPGRFDRVVMVEAPDRAGREAILKVHVSKKELPLAQDVNLGNIASMTTGF  530

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  531  TGADLANLVNEAALLAGRQNKVVVEKEDFIQAVERSIAGIEKKTAKLQGSEKAVVARH  588



>ref|XP_009616257.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=800

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  411  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  470

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR GRE+ILKVH SKKELPLAQDV+LG+IASMTTGF
Sbjct  471  RSDVLDPALRRPGRFDRVVMVEAPDRAGREAILKVHVSKKELPLAQDVNLGNIASMTTGF  530

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  531  TGADLANLVNEAALLAGRQNKVVVEKEDFIQAVERSIAGIEKKTAKLQGSEKAVVARH  588



>ref|XP_009758156.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Nicotiana sylvestris]
Length=800

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  411  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  470

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR GRE+IL VH SKKELPLAQDVDLG+IASMTTGF
Sbjct  471  RSDVLDPALRRPGRFDRVVMVEAPDRAGREAILNVHVSKKELPLAQDVDLGNIASMTTGF  530

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  531  TGADLANLVNEAALLAGRQNKVVVEKEDFIQAVERSIAGIEKKTAKLQGSEKAVVARH  588



>ref|XP_006344040.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Solanum tuberosum]
Length=828

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  439  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  498

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR+GRE+ILKVH SKKELPLAQDVDLG+IASMTTGF
Sbjct  499  RSDVLDPALRRPGRFDRVVMVEAPDRSGREAILKVHVSKKELPLAQDVDLGNIASMTTGF  558

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K++VE+IDFIQAVERSIAGIEKK AKLQG+EK VVARH
Sbjct  559  TGADLANLVNEAALLAGRLSKVVVERIDFIQAVERSIAGIEKKTAKLQGSEKGVVARH  616



>ref|XP_004240393.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic 
[Solanum lycopersicum]
Length=828

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  439  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  498

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR GRE+ILKVH SKKELPLAQDVDLG+IASMTTGF
Sbjct  499  RSDVLDPALRRPGRFDRVVMVEAPDRCGREAILKVHVSKKELPLAQDVDLGNIASMTTGF  558

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K++VE+IDFIQAVERSIAGIEKK AKLQG+EK VVARH
Sbjct  559  TGADLANLVNEAALLAGRLSKVVVERIDFIQAVERSIAGIEKKTAKLQGSEKGVVARH  616



>ref|XP_011080858.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Sesamum indicum]
 ref|XP_011080859.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Sesamum indicum]
Length=805

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  416  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  475

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRE+IL+VHASKKELPL +DVDLGDIASMTTGF
Sbjct  476  RADVLDPALRRPGRFDRVVMVEAPDRAGREAILEVHASKKELPLGKDVDLGDIASMTTGF  535

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K  VEKIDFIQAVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  536  TGADLANLVNEAALLAGRKNKFEVEKIDFIQAVERSIAGIEKKTAKLQGSEKAVVARH  593



>emb|CBI15999.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  162  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  221

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DVDL DIASMTT F
Sbjct  222  RSDVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLGEDVDLSDIASMTTSF  281

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEKIDF+ AVERSIAGIEKK  KLQG+EKAVVARH
Sbjct  282  TGADLANLVNEAALLAGRQNKVVVEKIDFVHAVERSIAGIEKKTTKLQGSEKAVVARH  339



>gb|KDO66807.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
Length=597

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  420  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  479

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  480  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  539

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVAR 
Sbjct  540  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARQ  597



>gb|KDO66806.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
Length=731

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  420  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  479

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  480  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  539

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  540  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARH  597



>gb|KDO66805.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
Length=794

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  420  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  479

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  480  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  539

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  540  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARH  597



>ref|XP_009374276.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 9, chloroplastic-like [Pyrus x bretschneideri]
Length=835

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  432  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  491

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE ILKVHA+KKELPLA+DV LGDIASMTTGF
Sbjct  492  RADVLDPALRRPGRFDRVVMVETPDRRGREEILKVHATKKELPLAKDVYLGDIASMTTGF  551

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+KL+VEKIDFIQAVER IAGIEKK AKLQG+EKAVVARH
Sbjct  552  TGADLANLVNEAALLAGRQSKLVVEKIDFIQAVERLIAGIEKKTAKLQGSEKAVVARH  609



>ref|XP_007142220.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris]
 gb|ESW14214.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris]
Length=679

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  407  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  466

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PDR GRE+ILKVHASKKELPLA+DVDLG +A MTTGF
Sbjct  467  RADVLDPALRRPGRFDRVVTVETPDRIGREAILKVHASKKELPLAKDVDLGAVACMTTGF  526

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  527  TGADLANLVNEAALLAGRQNKIIVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARH  584



>ref|XP_006425024.1| hypothetical protein CICLE_v10027831mg [Citrus clementina]
 ref|XP_006488484.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR38264.1| hypothetical protein CICLE_v10027831mg [Citrus clementina]
 gb|KDO66803.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
Length=817

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  421  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  480

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  481  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  540

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  541  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARH  598



>gb|EEE57480.1| hypothetical protein OsJ_07728 [Oryza sativa Japonica Group]
Length=550

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  162  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  221

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH S+KELPL +DVDL DIA+MTTGF
Sbjct  222  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVSRKELPLGKDVDLSDIAAMTTGF  281

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  282  TGADLANLVNEAALLAGRSNKEIVEKIDFICAVERSIAGIEKKHAKLKGNEKAVVARH  339



>ref|XP_006425023.1| hypothetical protein CICLE_v10027831mg [Citrus clementina]
 gb|ESR38263.1| hypothetical protein CICLE_v10027831mg [Citrus clementina]
 gb|KDO66804.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
Length=816

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  420  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  479

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  480  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  539

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  540  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARH  597



>ref|XP_008355315.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Malus domestica]
Length=822

 Score =   297 bits (760),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  432  AKKESPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  491

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE ILKVHA+KKELPLA+DV LGDIASMTTGF
Sbjct  492  RADVLDPALRRPGRFDRVVMVETPDRRGREEILKVHATKKELPLAKDVYLGDIASMTTGF  551

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+KL+VEKIDFIQAVER IAGIEKK AKLQG+EKAVVARH
Sbjct  552  TGADLANLVNEAALLAGRQSKLVVEKIDFIQAVERLIAGIEKKTAKLQGSEKAVVARH  609



>ref|XP_010256642.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
isoform X3 [Nelumbo nucifera]
Length=729

 Score =   295 bits (754),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  436  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  495

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPL +DVDL DIASMTTGF
Sbjct  496  RADVLDPALRRPGRFDRVVMVETPDKLGREAILKVHVSKKELPLGEDVDLSDIASMTTGF  555

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEKIDFI+AVERSIAGIEKK+AKLQG+EKAVVARH
Sbjct  556  TGADLANLVNEAALLAGRENKIVVEKIDFIRAVERSIAGIEKKHAKLQGSEKAVVARH  613



>ref|XP_007146736.1| hypothetical protein PHAVU_006G065400g [Phaseolus vulgaris]
 gb|ESW18730.1| hypothetical protein PHAVU_006G065400g [Phaseolus vulgaris]
Length=731

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAP+IIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  405  AKREAPAIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  464

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPLA+DVDLGDIA MTTGF
Sbjct  465  RSDVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLAKDVDLGDIACMTTGF  524

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK+DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  525  TGADLANLVNEAALLAGRQNKIVVEKLDFIQAVERSIAGIEKKTAKLRGSEKAVVARH  582



>gb|AHM26644.1| ATP-dependent zinc metalloprotease FTSH 9 protein [Pyrus x bretschneideri]
Length=822

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  432  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  491

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE ILKVHA++KELPLA+DV LGDIASMTTGF
Sbjct  492  RADVLDPALRRPGRFDRVVMVETPDRRGREEILKVHATQKELPLAKDVYLGDIASMTTGF  551

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+KL+VEKIDFIQAVERSIAGIEKK AKLQG EKAVVARH
Sbjct  552  TGADLANLVNEAALLAGRQSKLVVEKIDFIQAVERSIAGIEKKTAKLQGIEKAVVARH  609



>ref|XP_010535408.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Tarenaya hassleriana]
Length=815

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  428  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  487

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDRTGRESILKVH SKKELPL  DV+LGDIASMTTGF
Sbjct  488  RADVLDPALRRPGRFDRVVMVETPDRTGRESILKVHVSKKELPLGDDVNLGDIASMTTGF  547

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K +VEKIDFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  548  TGADLANLVNEAALLAGRKSKTIVEKIDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  605



>gb|AID69950.1| metalloprotease [Cicer arietinum]
Length=807

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  418  AKREAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  477

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVV VEAPDR GRE+ILKVH SKKELPLA+DV LGDIASMTTGF
Sbjct  478  RSDVLDPALRRPGRFDRVVTVEAPDRIGREAILKVHVSKKELPLAKDVGLGDIASMTTGF  537

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+K +VEKIDFI AVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  538  TGADLANLVNEAALLAGRQSKAVVEKIDFIHAVERSIAGIEKKTAKLQGSEKAVVARH  595



>ref|XP_010256641.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=754

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  436  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  495

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPL +DVDL DIASMTTGF
Sbjct  496  RADVLDPALRRPGRFDRVVMVETPDKLGREAILKVHVSKKELPLGEDVDLSDIASMTTGF  555

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEKIDFI+AVERSIAGIEKK+AKLQG+EKAVVARH
Sbjct  556  TGADLANLVNEAALLAGRENKIVVEKIDFIRAVERSIAGIEKKHAKLQGSEKAVVARH  613



>ref|XP_007146737.1| hypothetical protein PHAVU_006G065400g [Phaseolus vulgaris]
 gb|ESW18731.1| hypothetical protein PHAVU_006G065400g [Phaseolus vulgaris]
Length=790

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAP+IIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  405  AKREAPAIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  464

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPLA+DVDLGDIA MTTGF
Sbjct  465  RSDVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLAKDVDLGDIACMTTGF  524

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK+DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  525  TGADLANLVNEAALLAGRQNKIVVEKLDFIQAVERSIAGIEKKTAKLRGSEKAVVARH  582



>gb|KDP46528.1| hypothetical protein JCGZ_08500 [Jatropha curcas]
Length=805

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  417  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  476

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR+GRE+ILKVH SKKELPLA +VDL DIASMTTGF
Sbjct  477  RSDVLDPALRRPGRFDRVVMVETPDRSGREAILKVHVSKKELPLADNVDLSDIASMTTGF  536

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEK+DFI AVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  537  TGADLANLVNEAALLAGRKNKIVVEKVDFIHAVERSIAGIEKKTAKLQGSEKAVVARH  594



>ref|XP_002299826.2| hypothetical protein POPTR_0001s25620g [Populus trichocarpa]
 gb|EEE84631.2| hypothetical protein POPTR_0001s25620g [Populus trichocarpa]
Length=807

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  419  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  478

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DVDL DIASMTTGF
Sbjct  479  RSDVLDPALRRPGRFDRVVMVETPDRNGREAILKVHVSKKELPLGEDVDLSDIASMTTGF  538

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEK+DFIQAVER+IAGIEKK A+LQG+EKAVVARH
Sbjct  539  TGADLANLVNEAALLAGRKNKVVVEKLDFIQAVERAIAGIEKKTARLQGSEKAVVARH  596



>gb|KHG16546.1| ATP-dependent zinc metalloprotease FTSH 7, chloroplastic -like 
protein [Gossypium arboreum]
Length=818

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  428  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  487

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDR+VMVE PDR GRE+I+KVHASKKELPL  DVDLGDIASMTTGF
Sbjct  488  RSDVLDPALRRPGRFDRIVMVETPDRIGREAIIKVHASKKELPLGDDVDLGDIASMTTGF  547

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVERSIAGIEKK AKL+G EKAVVARH
Sbjct  548  TGADLANLVNEAALLAGRNNKVVVERIDFIQAVERSIAGIEKKTAKLKGCEKAVVARH  605



>ref|XP_007016170.1| Cell division protease ftsH isoform 3 [Theobroma cacao]
 gb|EOY33789.1| Cell division protease ftsH isoform 3 [Theobroma cacao]
Length=745

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DVDLGDIA+MTTGF
Sbjct  493  RSDVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLGEDVDLGDIAAMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVER+IAGIEKK AKL+G+E+AVVARH
Sbjct  553  TGADLANLVNEAALLAGRNNKIVVERIDFIQAVERAIAGIEKKTAKLKGSERAVVARH  610



>ref|XP_003556951.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Glycine max]
Length=799

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  409  AKREAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  468

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR GRE+ILKVH SKKELPLA++VDL DIA MTTGF
Sbjct  469  RSDVLDPALRRPGRFDRVVMVEAPDRIGREAILKVHVSKKELPLAKNVDLSDIACMTTGF  528

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK+DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  529  TGADLANLVNEAALLAGRQNKVVVEKLDFIQAVERSIAGIEKKTAKLRGSEKAVVARH  586



>ref|XP_009346878.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Pyrus x bretschneideri]
Length=831

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  432  AKKESPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  491

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE ILKVHA++KELPLA+DV LGDIASMTTGF
Sbjct  492  RADVLDPALRRPGRFDRVVMVETPDRRGREEILKVHATQKELPLAKDVYLGDIASMTTGF  551

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+KL+VEKIDFIQAVERSIAGIEKK AKLQG EKAVVARH
Sbjct  552  TGADLANLVNEAALLAGRQSKLVVEKIDFIQAVERSIAGIEKKTAKLQGIEKAVVARH  609



>ref|XP_010256640.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=825

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  436  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  495

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPL +DVDL DIASMTTGF
Sbjct  496  RADVLDPALRRPGRFDRVVMVETPDKLGREAILKVHVSKKELPLGEDVDLSDIASMTTGF  555

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEKIDFI+AVERSIAGIEKK+AKLQG+EKAVVARH
Sbjct  556  TGADLANLVNEAALLAGRENKIVVEKIDFIRAVERSIAGIEKKHAKLQGSEKAVVARH  613



>ref|XP_004295740.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=820

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+ R+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  432  AKKEAPSIIFIDEIDAVAKSRDGKHRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  491

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRESILKVH +KKELPLA+DV LGDIASMTTGF
Sbjct  492  RADVLDPALRRPGRFDRVVMVETPDRIGRESILKVHVTKKELPLAKDVYLGDIASMTTGF  551

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+K++VEKIDFIQAVERSIAGIEKK AKLQG EK VVARH
Sbjct  552  TGADLANLVNEAALLAGRQSKVVVEKIDFIQAVERSIAGIEKKTAKLQGCEKGVVARH  609



>ref|XP_010043456.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW85470.1| hypothetical protein EUGRSUZ_B02274 [Eucalyptus grandis]
Length=832

 Score =   294 bits (753),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  441  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  500

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVV VEAPDRTGRE+ILKVH SKKELPL +DVDL  IASMTTGF
Sbjct  501  RSDVLDPALRRPGRFDRVVTVEAPDRTGREAILKVHVSKKELPLGEDVDLTGIASMTTGF  560

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ KL+VEK+DFIQAVERSIAGIEKK  KLQG+EKAVVARH
Sbjct  561  TGADLANLVNEAALLAGRQNKLVVEKVDFIQAVERSIAGIEKKTVKLQGSEKAVVARH  618



>ref|XP_002279721.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Vitis vinifera]
Length=818

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  428  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  487

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DVDL DIASMTT F
Sbjct  488  RSDVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLGEDVDLSDIASMTTSF  547

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEKIDF+ AVERSIAGIEKK  KLQG+EKAVVARH
Sbjct  548  TGADLANLVNEAALLAGRQNKVVVEKIDFVHAVERSIAGIEKKTTKLQGSEKAVVARH  605



>ref|XP_007142221.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris]
 gb|ESW14215.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris]
Length=796

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  407  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  466

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PDR GRE+ILKVHASKKELPLA+DVDLG +A MTTGF
Sbjct  467  RADVLDPALRRPGRFDRVVTVETPDRIGREAILKVHASKKELPLAKDVDLGAVACMTTGF  526

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEKIDFI AVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  527  TGADLANLVNEAALLAGRQNKIIVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARH  584



>ref|XP_010104679.1| ATP-dependent zinc metalloprotease FTSH 9 [Morus notabilis]
 gb|EXC01485.1| ATP-dependent zinc metalloprotease FTSH 9 [Morus notabilis]
Length=821

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  426  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  485

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDRTGRE+ILKVH SKKELPL +D+DL  IASMTTGF
Sbjct  486  RSDVLDPALRRPGRFDRVVMVETPDRTGREAILKVHVSKKELPLGEDIDLSHIASMTTGF  545

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  546  TGADLANLVNEAALLAGRQNKVVVEKADFIQAVERSIAGIEKKTAKLKGSEKAVVARH  603



>ref|XP_007016169.1| Cell division protease ftsH isoform 2 [Theobroma cacao]
 gb|EOY33788.1| Cell division protease ftsH isoform 2 [Theobroma cacao]
Length=823

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DVDLGDIA+MTTGF
Sbjct  493  RSDVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLGEDVDLGDIAAMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVER+IAGIEKK AKL+G+E+AVVARH
Sbjct  553  TGADLANLVNEAALLAGRNNKIVVERIDFIQAVERAIAGIEKKTAKLKGSERAVVARH  610



>gb|EYU38475.1| hypothetical protein MIMGU_mgv1a002459mg [Erythranthe guttata]
Length=671

 Score =   290 bits (743),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  281  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  340

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+IL VHASKKELPL +DV+L DIASMTTGF
Sbjct  341  RADVLDPALRRPGRFDRVVMVETPDRIGREAILNVHASKKELPLGKDVNLSDIASMTTGF  400

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +KLLVE+ DFIQAVERSIAGIEKK AKL+G+EK VVARH
Sbjct  401  TGADLANLVNEAALLAGRSSKLLVERDDFIQAVERSIAGIEKKTAKLKGSEKGVVARH  458



>gb|AFW63224.1| hypothetical protein ZEAMMB73_643139 [Zea mays]
Length=627

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  427  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  486

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH S++ELPL++DVDL DIA+MTTGF
Sbjct  487  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVSRRELPLSKDVDLADIAAMTTGF  546

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  547  TGADLANLVNEAALLAGRLNKEIVEKIDFIHAVERSIAGIEKKHAKLKGNEKAVVARH  604



>gb|KEH34197.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=791

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAPSIIFIDEIDAVAKSRDG+FR   NDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  395  AKREAPSIIFIDEIDAVAKSRDGKFRNVGNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  454

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPA+RRPGRFDRVVMVEAPDR GRE+ILKVH SKKELPLA+DV LGDIASMTTGF
Sbjct  455  RSDVLDPAIRRPGRFDRVVMVEAPDRIGREAILKVHVSKKELPLAKDVCLGDIASMTTGF  514

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+K +VEKIDFI AVERSIAGIEKK AKLQG+EKAVVARH
Sbjct  515  TGADLANLVNEAALLAGRQSKSVVEKIDFIHAVERSIAGIEKKTAKLQGSEKAVVARH  572



>ref|XP_007016168.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOY33787.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=875

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DVDLGDIA+MTTGF
Sbjct  493  RSDVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLGEDVDLGDIAAMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVER+IAGIEKK AKL+G+E+AVVARH
Sbjct  553  TGADLANLVNEAALLAGRNNKIVVERIDFIQAVERAIAGIEKKTAKLKGSERAVVARH  610



>ref|XP_003544874.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Glycine max]
Length=795

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  406  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  465

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPLA+DV+LGDIA MTTGF
Sbjct  466  RADVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLAKDVNLGDIACMTTGF  525

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  526  TGADLANLVNEAALLAGRQNKIVVEKNDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  583



>gb|KHN40054.1| ATP-dependent zinc metalloprotease FTSH 9, chloroplastic [Glycine 
soja]
Length=791

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  402  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  461

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPLA+DV+LGDIA MTTGF
Sbjct  462  RADVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLAKDVNLGDIACMTTGF  521

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  522  TGADLANLVNEAALLAGRQNKIVVEKNDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  579



>ref|XP_004164592.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 9, chloroplastic-like [Cucumis sativus]
Length=795

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  401  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  460

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDRTGRESIL VH +KKELPLA DV+L DIASMTTGF
Sbjct  461  RSDVLDPALRRPGRFDRVVMVETPDRTGRESILNVHVTKKELPLADDVNLSDIASMTTGF  520

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VE+ DFIQAVERSIAGIEKK AKLQG+EK VVARH
Sbjct  521  TGADLANLVNEAALLAGRQNKIVVERDDFIQAVERSIAGIEKKTAKLQGSEKTVVARH  578



>ref|XP_011035193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Populus euphratica]
Length=810

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  422  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  481

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DVDL DIASMTTGF
Sbjct  482  RSDVLDPALRRPGRFDRVVMVETPDRNGREAILKVHVSKKELPLGEDVDLSDIASMTTGF  541

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEK+DFIQAVER+IAGIEKK A+LQG+EKAVVA H
Sbjct  542  TGADLANLVNEAALLAGRKNKVVVEKLDFIQAVERAIAGIEKKTARLQGSEKAVVAHH  599



>gb|KHN06251.1| ATP-dependent zinc metalloprotease FTSH 9, chloroplastic [Glycine 
soja]
Length=784

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNS+VIVLGATN
Sbjct  395  AKREAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSSVIVLGATN  454

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR GRE+ILKVH SKKELPLA+DVDL  IA MTTGF
Sbjct  455  RSDVLDPALRRPGRFDRVVMVEAPDRIGREAILKVHVSKKELPLAKDVDLSGIACMTTGF  514

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK+DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  515  TGADLANLVNEAALLAGRQNKVVVEKLDFIQAVERSIAGIEKKTAKLRGSEKAVVARH  572



>ref|XP_002525603.1| Cell division protein ftsH, putative [Ricinus communis]
 gb|EEF36721.1| Cell division protein ftsH, putative [Ricinus communis]
Length=816

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  428  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  487

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL ++VDL DIASMTTGF
Sbjct  488  RSDVLDPALRRPGRFDRVVMVETPDRKGREAILKVHVSKKELPLGEEVDLSDIASMTTGF  547

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEK+DFI AVER+IAGIEKK AKLQG+EKAVVARH
Sbjct  548  TGADLANLVNEAALLAGRNNKIVVEKVDFIHAVERAIAGIEKKTAKLQGSEKAVVARH  605



>ref|XP_003552962.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Glycine max]
Length=792

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNS+VIVLGATN
Sbjct  403  AKREAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSSVIVLGATN  462

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVEAPDR GRE+ILKVH SKKELPLA+DVDL  IA MTTGF
Sbjct  463  RSDVLDPALRRPGRFDRVVMVEAPDRIGREAILKVHVSKKELPLAKDVDLSGIACMTTGF  522

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK+DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  523  TGADLANLVNEAALLAGRQNKVVVEKLDFIQAVERSIAGIEKKTAKLRGSEKAVVARH  580



>ref|XP_008384845.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Malus domestica]
Length=820

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  432  AKKESPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  491

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPG FDRVVMVE PDR GRE ILKVHA++KELPLA+DV LGDIASMTTGF
Sbjct  492  RADVLDPALRRPGXFDRVVMVETPDRRGREEILKVHATQKELPLAKDVYLGDIASMTTGF  551

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ+KL+VEKIDFIQAVERSIAGIEKK AKLQG EKAVVARH
Sbjct  552  TGADLANLVNEAALLAGRQSKLVVEKIDFIQAVERSIAGIEKKTAKLQGIEKAVVARH  609



>ref|XP_006575403.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Glycine max]
Length=803

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  414  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  473

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPLA+DVDLG+IA MTTGF
Sbjct  474  RADVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLAKDVDLGNIACMTTGF  533

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  534  TGADLANLVNEAALLAGRQNKIVVEKNDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  591



>ref|XP_004150623.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65793.1| hypothetical protein Csa_1G528580 [Cucumis sativus]
Length=827

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDRTGRESIL VH +KKELPLA DV+L DIASMTTGF
Sbjct  493  RSDVLDPALRRPGRFDRVVMVETPDRTGRESILNVHVTKKELPLADDVNLSDIASMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VE+ DFIQAVERSIAGIEKK AKLQG+EK VVARH
Sbjct  553  TGADLANLVNEAALLAGRQNKIVVERDDFIQAVERSIAGIEKKTAKLQGSEKTVVARH  610



>gb|KHN46165.1| ATP-dependent zinc metalloprotease FTSH 9, chloroplastic [Glycine 
soja]
Length=803

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  414  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  473

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPLA+DVDLG+IA MTTGF
Sbjct  474  RADVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLAKDVDLGNIACMTTGF  533

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  534  TGADLANLVNEAALLAGRQNKIVVEKNDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  591



>dbj|BAJ93504.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  65   AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  124

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VEAPD+ GRESILKVHA++KELPL +DVDL  IA+MTTGF
Sbjct  125  RADVLDPALRRPGRFDRVVTVEAPDKFGRESILKVHANRKELPLGKDVDLSGIAAMTTGF  184

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+ KL+GNEKAVVARH
Sbjct  185  TGADLANLVNEAALLAGRSNKEIVEKIDFISAVERSIAGIEKKHVKLKGNEKAVVARH  242



>ref|XP_010685603.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=832

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  443  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  502

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PD+TGRESILKVH SKKELPL  DVDL D+A MTTGF
Sbjct  503  RADVLDPALRRPGRFDRVVMVETPDKTGRESILKVHVSKKELPLEDDVDLRDVARMTTGF  562

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K++VEKIDFIQAVERS+AGIEKK AKLQG EKAVVARH
Sbjct  563  TGADLANLVNEAALLAGRQNKVVVEKIDFIQAVERSLAGIEKKTAKLQGIEKAVVARH  620



>ref|XP_002314122.2| FtsH protease family protein [Populus trichocarpa]
 gb|EEE88077.2| FtsH protease family protein [Populus trichocarpa]
Length=792

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG++R+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  408  AKKEAPSIIFIDEIDAVAKSRDGKYRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  467

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DV+L DIASMTTG 
Sbjct  468  RSDVLDPALRRPGRFDRVVMVETPDRNGREAILKVHVSKKELPLGEDVNLSDIASMTTGL  527

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K+LVEK DFIQAVERSIAGIEKK  KLQG+EKAVVARH
Sbjct  528  TGADLANLVNEAALLAGRKNKVLVEKFDFIQAVERSIAGIEKKTVKLQGSEKAVVARH  585



>gb|KJB55765.1| hypothetical protein B456_009G093300 [Gossypium raimondii]
Length=658

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK APSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  268  AKKVAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  327

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRESILKVH SKK++PL +DVDL  IASMTTGF
Sbjct  328  RSDVLDPALRRPGRFDRVVMVETPDRIGRESILKVHVSKKDIPLGEDVDLCHIASMTTGF  387

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  388  TGADLANLVNEAALLAGRNNKIIVERIDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  445



>ref|XP_006648884.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like, 
partial [Oryza brachyantha]
Length=758

 Score =   290 bits (741),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  370  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  429

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH S+KELPL++DVDL DIA+MTTGF
Sbjct  430  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVSRKELPLSKDVDLSDIAAMTTGF  489

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  490  TGADLANLVNEAALLAGRSNKEIVEKIDFICAVERSIAGIEKKHAKLKGNEKAVVARH  547



>ref|XP_003615585.1| Cell division protease ftsH-like protein [Medicago truncatula]
Length=800

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+  NDEREQTLNQLLTEMDGFDSNSAVIVL ATN
Sbjct  411  AKKEAPSIIFIDEIDAVAKSRDGKFRIVGNDEREQTLNQLLTEMDGFDSNSAVIVLAATN  470

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDR+VMVE PDR GRESILKVH SKKELPLA+DV +GDIASMTTGF
Sbjct  471  RADVLDPALRRPGRFDRIVMVETPDRIGRESILKVHVSKKELPLAKDVYIGDIASMTTGF  530

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEKIDFI+AVERSIAGIEKK AKLQG+EK VVARH
Sbjct  531  TGADLANLVNEAALLAGRKNKVVVEKIDFIEAVERSIAGIEKKTAKLQGSEKGVVARH  588



>gb|KHG03482.1| ATP-dependent zinc metalloprotease FTSH 7, chloroplastic -like 
protein [Gossypium arboreum]
Length=823

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK APSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKVAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRESILKVH SKK++PL +DVDL DIASMTTGF
Sbjct  493  RSDVLDPALRRPGRFDRVVMVETPDRIGRESILKVHVSKKDIPLGEDVDLCDIASMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  553  TGADLANLVNEAALLAGRNNKIIVERIDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  610



>ref|XP_003615584.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES98542.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=793

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+  NDEREQTLNQLLTEMDGFDSNSAVIVL ATN
Sbjct  404  AKKEAPSIIFIDEIDAVAKSRDGKFRIVGNDEREQTLNQLLTEMDGFDSNSAVIVLAATN  463

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDR+VMVE PDR GRESILKVH SKKELPLA+DV +GDIASMTTGF
Sbjct  464  RADVLDPALRRPGRFDRIVMVETPDRIGRESILKVHVSKKELPLAKDVYIGDIASMTTGF  523

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEKIDFI+AVERSIAGIEKK AKLQG+EK VVARH
Sbjct  524  TGADLANLVNEAALLAGRKNKVVVEKIDFIEAVERSIAGIEKKTAKLQGSEKGVVARH  581



>ref|XP_011032148.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Populus euphratica]
Length=795

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG++R+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  407  AKKEAPSIIFIDEIDAVAKSRDGKYRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  466

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPL +DV+L DIASMTTG 
Sbjct  467  RSDVLDPALRRPGRFDRVVMVETPDRNGREAILKVHVSKKELPLGEDVNLSDIASMTTGL  526

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEK DFIQAVERSIAGIEKK AKLQG+EKAVVA H
Sbjct  527  TGADLANLVNEAALLAGRKNKVVVEKFDFIQAVERSIAGIEKKTAKLQGSEKAVVAHH  584



>ref|XP_004490581.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Cicer arietinum]
Length=804

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  415  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  474

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH SKKELPLA+DV +GDIAS TTGF
Sbjct  475  RADVLDPALRRPGRFDRVVMVETPDRIGREAILKVHVSKKELPLAKDVYIGDIASTTTGF  534

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K++VEKIDFI+AVERSIAGIEKK AKLQG EK VVARH
Sbjct  535  TGADLANLVNEAALLAGRKNKVVVEKIDFIEAVERSIAGIEKKTAKLQGCEKGVVARH  592



>ref|NP_001047584.1| Os02g0649700 [Oryza sativa Japonica Group]
 sp|Q6H6R9.1|FTSH7_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 7, chloroplastic; 
Short=OsFTSH7; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD25580.1| putative cell division protein FtsH3 [Oryza sativa Japonica Group]
 dbj|BAF09498.1| Os02g0649700 [Oryza sativa Japonica Group]
Length=822

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  434  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  493

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH S+KELPL +DVDL DIA+MTTGF
Sbjct  494  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVSRKELPLGKDVDLSDIAAMTTGF  553

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  554  TGADLANLVNEAALLAGRSNKEIVEKIDFICAVERSIAGIEKKHAKLKGNEKAVVARH  611



>ref|XP_008676836.1| PREDICTED: uncharacterized protein LOC100273697 isoform X1 [Zea 
mays]
 gb|AFW63223.1| hypothetical protein ZEAMMB73_643139 [Zea mays]
Length=815

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  427  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  486

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH S++ELPL++DVDL DIA+MTTGF
Sbjct  487  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVSRRELPLSKDVDLADIAAMTTGF  546

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  547  TGADLANLVNEAALLAGRLNKEIVEKIDFIHAVERSIAGIEKKHAKLKGNEKAVVARH  604



>ref|XP_010503322.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Camelina sativa]
Length=819

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FRV +NDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  430  AKKEAPSIIFIDEIDAVAKSRDGKFRVGNNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  489

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH SKKELPL  DV+LG+IASMTTGF
Sbjct  490  RADVLDPALRRPGRFDRVVTVETPDKIGRESILRVHVSKKELPLGHDVNLGNIASMTTGF  549

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K  VEKIDFIQAVERSIAGIEKK+A+L+GNEKAVVARH
Sbjct  550  TGADLANLVNEAALLAGRQNKGTVEKIDFIQAVERSIAGIEKKSARLKGNEKAVVARH  607



>ref|XP_008785415.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008785416.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008785417.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Phoenix dactylifera]
Length=840

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  451  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  510

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRESILKVH +KKELPL  DVDL +IASMTTGF
Sbjct  511  RADVLDPALRRPGRFDRVVMVETPDRFGRESILKVHVNKKELPLGDDVDLSEIASMTTGF  570

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K++VEKIDFI AVERSIAGIEKK+AKLQG+EKA VARH
Sbjct  571  TGADLANLVNEAALLAGRTSKVVVEKIDFILAVERSIAGIEKKHAKLQGSEKAAVARH  628



>ref|XP_010426160.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Camelina sativa]
Length=822

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FRV +NDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKEAPSIIFIDEIDAVAKSRDGKFRVGNNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH SKKELPL  DV+LG+IASMTTGF
Sbjct  493  RADVLDPALRRPGRFDRVVTVETPDKIGRESILRVHVSKKELPLGHDVNLGNIASMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K  VEKIDFIQAVERSIAGIEKK+A+L+GNEKAVVARH
Sbjct  553  TGADLANLVNEAALLAGRQNKGTVEKIDFIQAVERSIAGIEKKSARLKGNEKAVVARH  610



>ref|XP_010515032.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like, 
partial [Camelina sativa]
Length=829

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FRV +NDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  440  AKKEAPSIIFIDEIDAVAKSRDGKFRVGNNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  499

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH SKKELPL  DV+LG+IASMTTGF
Sbjct  500  RADVLDPALRRPGRFDRVVTVETPDKIGRESILRVHVSKKELPLGHDVNLGNIASMTTGF  559

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGRQ K  VEKIDFIQAVERSIAGIEKK+A+L+GNEKAVVARH
Sbjct  560  TGADLANLVNEAALLAGRQNKGTVEKIDFIQAVERSIAGIEKKSARLKGNEKAVVARH  617



>ref|XP_010541444.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Tarenaya hassleriana]
Length=804

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+S+VIVLGATN
Sbjct  426  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSSSSVIVLGATN  485

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV+VE PDRTGRE+ILKVH SKKELPL  DV+LGDIAS TTGF
Sbjct  486  RADVLDPALRRPGRFDRVVLVETPDRTGREAILKVHVSKKELPLGDDVNLGDIASTTTGF  545

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADL NLVNEAALLAGR++K  VEKIDF+QAVERSIAGIEKK AKLQG EKAVVARH
Sbjct  546  TGADLGNLVNEAALLAGRKSKTTVEKIDFVQAVERSIAGIEKKTAKLQGGEKAVVARH  603



>ref|XP_002875825.1| hypothetical protein ARALYDRAFT_485083 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52084.1| hypothetical protein ARALYDRAFT_485083 [Arabidopsis lyrata subsp. 
lyrata]
Length=803

 Score =   288 bits (737),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  414  AKKEAPSIIFIDEIDAVAKSRDGKFRIGSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  473

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH SKKELPL  DV+LG IASMTTGF
Sbjct  474  RADVLDPALRRPGRFDRVVTVETPDKVGRESILRVHVSKKELPLGDDVNLGSIASMTTGF  533

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K  VEKIDFIQAVERSIAGIEKK+A+L+GNEKAVVARH
Sbjct  534  TGADLANLVNEAALLAGRKNKTTVEKIDFIQAVERSIAGIEKKSARLKGNEKAVVARH  591



>gb|KJB55769.1| hypothetical protein B456_009G093300 [Gossypium raimondii]
Length=810

 Score =   288 bits (737),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK APSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKVAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRESILKVH SKK++PL +DVDL  IASMTTGF
Sbjct  493  RSDVLDPALRRPGRFDRVVMVETPDRIGRESILKVHVSKKDIPLGEDVDLCHIASMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  553  TGADLANLVNEAALLAGRNNKIIVERIDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  610



>gb|KJB55766.1| hypothetical protein B456_009G093300 [Gossypium raimondii]
 gb|KJB55767.1| hypothetical protein B456_009G093300 [Gossypium raimondii]
 gb|KJB55768.1| hypothetical protein B456_009G093300 [Gossypium raimondii]
Length=823

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK APSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  433  AKKVAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  492

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDR GRESILKVH SKK++PL +DVDL  IASMTTGF
Sbjct  493  RSDVLDPALRRPGRFDRVVMVETPDRIGRESILKVHVSKKDIPLGEDVDLCHIASMTTGF  552

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VE+IDFIQAVERSIAGIEKK AKL+G+EKAVVARH
Sbjct  553  TGADLANLVNEAALLAGRNNKIIVERIDFIQAVERSIAGIEKKTAKLKGSEKAVVARH  610



>ref|XP_010923113.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010923114.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010923115.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010923117.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=836

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  447  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  506

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH +KKELPL  DVDL +IASMTTGF
Sbjct  507  RADVLDPALRRPGRFDRVVMVETPDRFGREAILKVHVNKKELPLGDDVDLSEIASMTTGF  566

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K++VEKIDFI AVERSIAGIEKK+AKLQG+EKAVVARH
Sbjct  567  TGADLANLVNEAALLAGRTSKVVVEKIDFILAVERSIAGIEKKHAKLQGSEKAVVARH  624



>ref|XP_004953292.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
[Setaria italica]
Length=815

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  425  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  484

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH +++ELPL++DVDL DIA+MTTGF
Sbjct  485  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVNRRELPLSKDVDLADIAAMTTGF  544

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEK+DFI+AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  545  TGADLANLVNEAALLAGRLNKEIVEKVDFIRAVERSIAGIEKKHAKLKGNEKAVVARH  602



>ref|XP_006290608.1| hypothetical protein CARUB_v10016697mg [Capsella rubella]
 gb|EOA23506.1| hypothetical protein CARUB_v10016697mg [Capsella rubella]
Length=816

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK+APSIIFIDEIDAVAKSRDG+FRV SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  425  AKKDAPSIIFIDEIDAVAKSRDGKFRVGSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  484

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH SKKELPL  DV+LG+IASMTTGF
Sbjct  485  RADVLDPALRRPGRFDRVVTVETPDKIGRESILRVHVSKKELPLGDDVNLGNIASMTTGF  544

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K  VEKIDFIQAVERSIAGIEKK+A+L+GNEKAVVARH
Sbjct  545  TGADLANLVNEAALLAGRKNKGTVEKIDFIQAVERSIAGIEKKSARLKGNEKAVVARH  602



>ref|NP_566889.1| cell division protease ftsH-7 [Arabidopsis thaliana]
 sp|Q9SD67.1|FTSH7_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 7, chloroplastic; 
Short=AtFTSH7; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB61952.1| FtsH metalloprotease-like protein [Arabidopsis thaliana]
 gb|AAM20588.1| FtsH metalloprotease-like protein [Arabidopsis thaliana]
 gb|AAN15687.1| FtsH metalloprotease-like protein [Arabidopsis thaliana]
 gb|AEE78239.1| cell division protease ftsH-7 [Arabidopsis thaliana]
Length=802

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  413  AKKEAPSIIFIDEIDAVAKSRDGKFRMGSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  472

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH SKKELPL  DV+LG IASMTTGF
Sbjct  473  RADVLDPALRRPGRFDRVVTVETPDKIGRESILRVHVSKKELPLGDDVNLGSIASMTTGF  532

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K  VEKIDFIQAVERSIAGIEKK+A+L+GNEKAVVARH
Sbjct  533  TGADLANLVNEAALLAGRKNKTNVEKIDFIQAVERSIAGIEKKSARLKGNEKAVVARH  590



>ref|XP_002454560.1| hypothetical protein SORBIDRAFT_04g033360 [Sorghum bicolor]
 gb|EES07536.1| hypothetical protein SORBIDRAFT_04g033360 [Sorghum bicolor]
Length=818

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  430  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  489

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH +++ELPL++DV+L DIA+MTTGF
Sbjct  490  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVNRRELPLSKDVNLADIAAMTTGF  549

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI+AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  550  TGADLANLVNEAALLAGRLNKEMVEKIDFIRAVERSIAGIEKKHAKLKGNEKAVVARH  607



>ref|XP_002866296.1| hypothetical protein ARALYDRAFT_496010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42555.1| hypothetical protein ARALYDRAFT_496010 [Arabidopsis lyrata subsp. 
lyrata]
Length=802

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  413  AKKEAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  472

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE+PD+ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  473  RADVLDPALRRPGRFDRVVTVESPDKVGRESILKVHVSKKELPLGNDVNLASIASMTTGF  532

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K+ VEKIDFIQAVERSIAGIEKK A+L+G+EKAVVARH
Sbjct  533  TGADLANLVNEAALLAGRKSKMTVEKIDFIQAVERSIAGIEKKTARLKGSEKAVVARH  590



>ref|XP_009407555.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=846

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  456  AKKEAPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  515

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH  KKELPL  DV+L +IASMTTGF
Sbjct  516  RADVLDPALRRPGRFDRVVMVETPDRLGREAILKVHVDKKELPLGDDVNLSEIASMTTGF  575

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIAGIEKK+AKLQG EKAVVARH
Sbjct  576  TGADLANLVNEAALLAGRANKVVVEKIDFILAVERSIAGIEKKHAKLQGGEKAVVARH  633



>gb|EMS68957.1| ATP-dependent zinc metalloprotease FTSH 7, chloroplastic [Triticum 
urartu]
Length=705

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  317  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  376

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VEAPD+ GRESILKVHA++KELPL +DVDL  IA+MTTGF
Sbjct  377  RADVLDPALRRPGRFDRVVTVEAPDKFGRESILKVHANRKELPLGKDVDLSGIAAMTTGF  436

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+ KL+GNEKAVVARH
Sbjct  437  TGADLANLVNEAALLAGRSNKEIVEKIDFISAVERSIAGIEKKHVKLKGNEKAVVARH  494



>ref|XP_003569989.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
[Brachypodium distachyon]
Length=811

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  423  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  482

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPD+ GRESILKVH ++KELPL +DVDL  IA+MTTGF
Sbjct  483  RADVLDPALRRPGRFDRVVMVEAPDKFGRESILKVHVNRKELPLGKDVDLSGIAAMTTGF  542

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+ KL+GNEKAVVARH
Sbjct  543  TGADLANLVNEAALLAGRSNKEIVEKIDFISAVERSIAGIEKKHVKLKGNEKAVVARH  600



>ref|NP_001183588.1| hypothetical protein [Zea mays]
 gb|ACR37667.1| unknown [Zea mays]
 gb|AFW72567.1| hypothetical protein ZEAMMB73_537821 [Zea mays]
Length=809

 Score =   283 bits (723),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRD R+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  421  AKKESPSIIFIDEIDAVAKSRDSRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  480

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH  ++ELPL++DVDL +IA+MTTGF
Sbjct  481  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVKRRELPLSKDVDLANIAAMTTGF  540

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEK+DFI+AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  541  TGADLANLVNEAALLAGRLNKEIVEKVDFIRAVERSIAGIEKKHAKLKGNEKAVVARH  598



>ref|XP_010483495.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like 
[Camelina sativa]
Length=812

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  423  AKKEAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  482

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLD ALRRPGRFDRVV VEAPD+ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  483  RADVLDSALRRPGRFDRVVTVEAPDKVGRESILKVHVSKKELPLGDDVNLASIASMTTGF  542

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K+ VEKIDFIQAVERSIAGIEKK A+L+G+EKAVVARH
Sbjct  543  TGADLANLVNEAALLAGRKSKMTVEKIDFIQAVERSIAGIEKKTARLKGSEKAVVARH  600



>ref|XP_010443637.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic 
[Camelina sativa]
Length=813

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  424  AKKEAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  483

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLD ALRRPGRFDRVV VEAPD+ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  484  RADVLDSALRRPGRFDRVVTVEAPDKVGRESILKVHVSKKELPLGDDVNLASIASMTTGF  543

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K+ VEKIDFIQAVERSIAGIEKK A+L+G+EKAVVARH
Sbjct  544  TGADLANLVNEAALLAGRKSKMTVEKIDFIQAVERSIAGIEKKTARLKGSEKAVVARH  601



>ref|XP_010454356.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic 
[Camelina sativa]
Length=817

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  428  AKKEAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  487

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLD ALRRPGRFDRVV VEAPD+ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  488  RADVLDSALRRPGRFDRVVTVEAPDKVGRESILKVHVSKKELPLGDDVNLASIASMTTGF  547

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K+ VEKIDFIQAVERSIAGIEKK A+L+G+EKAVVARH
Sbjct  548  TGADLANLVNEAALLAGRKSKMTVEKIDFIQAVERSIAGIEKKTARLKGSEKAVVARH  605



>ref|XP_006281572.1| hypothetical protein CARUB_v10027679mg [Capsella rubella]
 gb|EOA14470.1| hypothetical protein CARUB_v10027679mg [Capsella rubella]
Length=814

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  425  AKKEAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  484

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLD ALRRPGRFDRVV VEAPD+ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  485  RADVLDSALRRPGRFDRVVTVEAPDKVGRESILKVHVSKKELPLGDDVNLASIASMTTGF  544

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K+ VEKIDFIQAVERSIAGIEKK A+L+G+EKAVVARH
Sbjct  545  TGADLANLVNEAALLAGRKSKMTVEKIDFIQAVERSIAGIEKKTARLKGSEKAVVARH  602



>emb|CDX99070.1| BnaA06g17610D [Brassica napus]
Length=812

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  423  AKKEAPSIIFIDEIDAVAKSRDGKFRIASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  482

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH  KKELPL  DV+LG IASMTTGF
Sbjct  483  RADVLDPALRRPGRFDRVVTVETPDKVGRESILRVHVLKKELPLGNDVNLGSIASMTTGF  542

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K  V+KIDFIQAVERSIAGIEKK A+L+G+EK VVARH
Sbjct  543  TGADLANLVNEAALLAGRMSKTTVDKIDFIQAVERSIAGIEKKTARLKGSEKGVVARH  600



>emb|CDX86121.1| BnaC03g56360D [Brassica napus]
Length=812

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  423  AKKEAPSIIFIDEIDAVAKSRDGKFRIASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  482

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH  KKELPL  DV+LG IASMTTGF
Sbjct  483  RADVLDPALRRPGRFDRVVTVETPDKVGRESILRVHVLKKELPLGNDVNLGSIASMTTGF  542

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K  V+KIDFIQAVERSIAGIEKK A+L+G+EK VVARH
Sbjct  543  TGADLANLVNEAALLAGRMSKTTVDKIDFIQAVERSIAGIEKKTARLKGSEKGVVARH  600



>ref|XP_006404418.1| hypothetical protein EUTSA_v10010128mg [Eutrema salsugineum]
 gb|ESQ45871.1| hypothetical protein EUTSA_v10010128mg [Eutrema salsugineum]
Length=814

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ASNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  425  AKKEAPSIIFIDEIDAVAKSRDGKFRIASNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  484

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH  KKELPL  DV LG IASMTTGF
Sbjct  485  RADVLDPALRRPGRFDRVVTVETPDKIGRESILRVHVLKKELPLGDDVSLGSIASMTTGF  544

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K  V+KIDFIQAVERSIAGIEKK+A+L+G EKAVVARH
Sbjct  545  TGADLANLVNEAALLAGRKSKTTVDKIDFIQAVERSIAGIEKKSARLKGTEKAVVARH  602



>ref|XP_006848119.1| hypothetical protein AMTR_s00029p00219050 [Amborella trichopoda]
 gb|ERN09700.1| hypothetical protein AMTR_s00029p00219050 [Amborella trichopoda]
Length=828

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  439  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  498

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE P R GRE+ILKVH SKK+LPL  DV+L +IA+ TTGF
Sbjct  499  RSDVLDPALRRPGRFDRVVMVETPARIGREAILKVHVSKKQLPLGDDVNLSEIAAATTGF  558

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDF+QAVERSIAGIEKK+AKLQG+EK VVARH
Sbjct  559  TGADLANLVNEAALLAGRVNKNVVEKIDFMQAVERSIAGIEKKHAKLQGSEKGVVARH  616



>ref|NP_568892.1| FTSH protease 9 [Arabidopsis thaliana]
 sp|Q9FIM2.1|FTSH9_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 9, chloroplastic; 
Short=AtFTSH9; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09632.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAL24338.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AED97112.1| FTSH protease 9 [Arabidopsis thaliana]
Length=806

 Score =   280 bits (717),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  417  AKKEAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  476

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE+PD+ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  477  RADVLDPALRRPGRFDRVVTVESPDKVGRESILKVHVSKKELPLGDDVNLASIASMTTGF  536

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K+ V+KIDFI AVERSIAGIEKK A+L+G+EKAVVARH
Sbjct  537  TGADLANLVNEAALLAGRKSKMTVDKIDFIHAVERSIAGIEKKTARLKGSEKAVVARH  594



>gb|KJB19912.1| hypothetical protein B456_003G124400 [Gossypium raimondii]
Length=826

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 167/186 (90%), Gaps = 8/186 (4%)
 Frame = +3

Query  3    AKKEAPSIIFI--------DEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA  158
            AKKEAPSII +        + IDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSA
Sbjct  428  AKKEAPSIILLMRSAYEHYNFIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSA  487

Query  159  VIVLGATNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGD  338
            VIVLGATNRSDVLDPALRRPGRFDR+VMVE PDR GRE+I+KVHASKKELPL  DVDLGD
Sbjct  488  VIVLGATNRSDVLDPALRRPGRFDRIVMVETPDRIGREAIIKVHASKKELPLGDDVDLGD  547

Query  339  IASMTTGFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEK  518
            IASMTTGFTGADLANLVNEAALLAGR  K++VE+IDFIQAVERSIAGIEKK AKL+G EK
Sbjct  548  IASMTTGFTGADLANLVNEAALLAGRNNKVVVERIDFIQAVERSIAGIEKKTAKLKGCEK  607

Query  519  AVVARH  536
            AVVARH
Sbjct  608  AVVARH  613



>ref|XP_009149936.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
isoform X2 [Brassica rapa]
Length=805

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ASNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  416  AKKEAPSIIFIDEIDAVAKSRDGKFRIASNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  475

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH  KKELPL  DV+LG IASMTTGF
Sbjct  476  RADVLDPALRRPGRFDRVVTVETPDKVGRESILRVHVLKKELPLGNDVNLGSIASMTTGF  535

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K  V+KIDFIQAVERSIAGIEKK A+L+G+EK VVARH
Sbjct  536  TGADLANLVNEAALLAGRMSKTTVDKIDFIQAVERSIAGIEKKTARLKGSEKGVVARH  593



>ref|XP_009149935.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic 
isoform X1 [Brassica rapa]
Length=812

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ASNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  423  AKKEAPSIIFIDEIDAVAKSRDGKFRIASNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  482

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH  KKELPL  DV+LG IASMTTGF
Sbjct  483  RADVLDPALRRPGRFDRVVTVETPDKVGRESILRVHVLKKELPLGNDVNLGSIASMTTGF  542

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +K  V+KIDFIQAVERSIAGIEKK A+L+G+EK VVARH
Sbjct  543  TGADLANLVNEAALLAGRMSKTTVDKIDFIQAVERSIAGIEKKTARLKGSEKGVVARH  600



>emb|CDX80331.1| BnaC09g34110D [Brassica napus]
Length=768

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRD +FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  379  AKKEAPSIIFIDEIDAVAKSRDNKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  438

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE P++ GRESILKVH SKKELPL  DV+LG IASMTTGF
Sbjct  439  RADVLDPALRRPGRFDRVVAVETPNKVGRESILKVHVSKKELPLGDDVNLGSIASMTTGF  498

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K  V+KIDFIQAVERSIAGIEKK A+L+G+EKAVVARH
Sbjct  499  TGADLANLVNEAALLAGRKSKTTVDKIDFIQAVERSIAGIEKKTARLKGSEKAVVARH  556



>emb|CDY54177.1| BnaA10g29130D [Brassica napus]
Length=779

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRD +FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  390  AKKEAPSIIFIDEIDAVAKSRDNKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  449

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE P++ GRESILKVH SKKELPL  DV+LG IASMTTGF
Sbjct  450  RADVLDPALRRPGRFDRVVTVETPNKVGRESILKVHVSKKELPLGDDVNLGSIASMTTGF  509

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K  V+KIDFIQAVERSIAGIEKK A+L+G EKAVVARH
Sbjct  510  TGADLANLVNEAALLAGRKSKTTVDKIDFIQAVERSIAGIEKKTARLKGCEKAVVARH  567



>gb|KFK27417.1| hypothetical protein AALP_AA8G380000 [Arabis alpina]
Length=801

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRD +FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  412  AKKEAPSIIFIDEIDAVAKSRDNKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  471

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PD+ GRESILKVH SKKELPL  DV+L  IA+MTTGF
Sbjct  472  RADVLDPALRRPGRFDRVVMVETPDKVGRESILKVHVSKKELPLGDDVNLSSIATMTTGF  531

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++KL V+KIDFI AVERSIAGIEKK A+L+G+EK VVARH
Sbjct  532  TGADLANLVNEAALLAGRKSKLTVDKIDFIHAVERSIAGIEKKTARLKGSEKGVVARH  589



>ref|XP_009120396.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic 
isoform X2 [Brassica rapa]
Length=765

 Score =   274 bits (701),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRD +FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  376  AKKEAPSIIFIDEIDAVAKSRDNKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  435

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE P++ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  436  RADVLDPALRRPGRFDRVVTVETPNKVGRESILKVHVSKKELPLGDDVNLDSIASMTTGF  495

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K  V+KIDFIQAVERSIAGIEKK A+L+G EKAVVARH
Sbjct  496  TGADLANLVNEAALLAGRKSKTTVDKIDFIQAVERSIAGIEKKTARLKGCEKAVVARH  553



>ref|XP_009120395.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic 
isoform X1 [Brassica rapa]
Length=779

 Score =   274 bits (701),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRD +FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  390  AKKEAPSIIFIDEIDAVAKSRDNKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  449

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE P++ GRESILKVH SKKELPL  DV+L  IASMTTGF
Sbjct  450  RADVLDPALRRPGRFDRVVTVETPNKVGRESILKVHVSKKELPLGDDVNLDSIASMTTGF  509

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR++K  V+KIDFIQAVERSIAGIEKK A+L+G EKAVVARH
Sbjct  510  TGADLANLVNEAALLAGRKSKTTVDKIDFIQAVERSIAGIEKKTARLKGCEKAVVARH  567



>ref|XP_002883545.1| hypothetical protein ARALYDRAFT_479981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59804.1| hypothetical protein ARALYDRAFT_479981 [Arabidopsis lyrata subsp. 
lyrata]
Length=787

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  417  AKKEAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  476

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE+PD+ GRESILKVH SKKELPL  DV+L   ASMTTGF
Sbjct  477  RADVLDPALRRPGRFDRVVTVESPDKVGRESILKVHVSKKELPLGNDVNLASSASMTTGF  536

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVV  527
            TGADLANLVNEAALLAGR++K+ VEKIDFIQAVERSIAGIEKK A+L+G+EKAV+
Sbjct  537  TGADLANLVNEAALLAGRKSKMTVEKIDFIQAVERSIAGIEKKTARLKGSEKAVL  591



>gb|KFK34023.1| hypothetical protein AALP_AA5G091900 [Arabis alpina]
Length=812

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  423  AKKEAPSIIFIDEIDAVAKSRDGKFRLASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  482

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVV VE PD+ GRESIL+VH +KKELPL  DV+L  IA MTTGF
Sbjct  483  RADVLDPALRRPGRFDRVVSVETPDKIGRESILRVHVTKKELPLGDDVNLSSIALMTTGF  542

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ K  V+KIDFI AVERSIAGIEKK A+L+G+EK VVARH
Sbjct  543  TGADLANLVNEAALLAGRKNKTTVDKIDFIDAVERSIAGIEKKTARLKGSEKGVVARH  600



>gb|EAY86903.1| hypothetical protein OsI_08286 [Oryza sativa Indica Group]
Length=816

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 164/178 (92%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  434  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  493

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVM+      GRESILKVH S+KELPL +DVDL DIA+MTTGF
Sbjct  494  RADVLDPALRRPGRFDRVVMI------GRESILKVHVSRKELPLGKDVDLSDIAAMTTGF  547

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR  K +VEKIDFI AVERSIAGIEKK+AKL+GNEKAVVARH
Sbjct  548  TGADLANLVNEAALLAGRSNKEIVEKIDFICAVERSIAGIEKKHAKLKGNEKAVVARH  605



>ref|XP_006425022.1| hypothetical protein CICLE_v10027831mg [Citrus clementina]
 gb|ESR38262.1| hypothetical protein CICLE_v10027831mg [Citrus clementina]
 gb|KDO66810.1| hypothetical protein CISIN_1g003473mg [Citrus sinensis]
Length=597

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  420  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  479

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  480  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  539

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVER  467
            TGADLANLVNEAALLAGR  K++VEKIDFI AVER
Sbjct  540  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVER  574



>ref|XP_006488487.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
isoform X4 [Citrus sinensis]
Length=1224

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  421  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  480

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PD+ GRE+ILKVH SKKELPLA+D+DLGDIASMTTGF
Sbjct  481  RSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGF  540

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIA  476
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIA
Sbjct  541  TGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIA  578



>ref|XP_008457389.1| PREDICTED: phosphomethylpyrimidine synthase, chloroplastic isoform 
X2 [Cucumis melo]
Length=1067

 Score =   262 bits (669),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  263  AKKEAPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  322

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVVMVE PDRTGRE+ILKVH +KKELPLA DV+L DIASMTTGF
Sbjct  323  RSDVLDPALRRPGRFDRVVMVETPDRTGREAILKVHVTKKELPLADDVNLSDIASMTTGF  382

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIA  476
            TGADLANLVNEAALLAGRQ K++VEK DFIQAVERSIA
Sbjct  383  TGADLANLVNEAALLAGRQNKIVVEKDDFIQAVERSIA  420



>ref|XP_004500235.1| PREDICTED: phosphomethylpyrimidine synthase, chloroplastic-like 
[Cicer arietinum]
Length=1225

 Score =   262 bits (669),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 158/177 (89%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK+EAPSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  418  AKREAPSIIFIDEIDAVAKSRDGKFRMVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  477

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDRVV VEAPDR GRE+ILKVH SKKELPLA+DV LGDIASMTTGF
Sbjct  478  RSDVLDPALRRPGRFDRVVTVEAPDRIGREAILKVHVSKKELPLAKDVGLGDIASMTTGF  537

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVAR  533
            TGADLANLVNEAALLAGRQ+K +VEKIDFI AVERSIA      A +  N  +VV +
Sbjct  538  TGADLANLVNEAALLAGRQSKAVVEKIDFIHAVERSIA-----MASVHANVTSVVCK  589



>gb|AFN53660.1| ThiC family protein [Linum usitatissimum]
Length=952

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE PSIIFIDEIDAVAKSRDG+FR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  162  AKKETPSIIFIDEIDAVAKSRDGKFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  221

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            RSDVLDPALRRPGRFDR+V VEAPDR GR++ILKVHA+KKELPL +DV+L DIASMTTGF
Sbjct  222  RSDVLDPALRRPGRFDRIVTVEAPDRNGRDAILKVHATKKELPLGKDVNLSDIASMTTGF  281

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIA  476
            TGADLANLVNEAALLAGR++K +VEKIDFI+AVERSIA
Sbjct  282  TGADLANLVNEAALLAGRKSKSVVEKIDFIEAVERSIA  319



>ref|XP_010923120.1| PREDICTED: phosphomethylpyrimidine synthase, chloroplastic isoform 
X4 [Elaeis guineensis]
Length=1257

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDS+SAVIVLGATN
Sbjct  447  AKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSSSAVIVLGATN  506

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH +KKELPL  DVDL +IASMTTGF
Sbjct  507  RADVLDPALRRPGRFDRVVMVETPDRFGREAILKVHVNKKELPLGDDVDLSEIASMTTGF  566

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIA  476
            TGADLANLVNEAALLAGR +K++VEKIDFI AVERSIA
Sbjct  567  TGADLANLVNEAALLAGRTSKVVVEKIDFILAVERSIA  604



>ref|XP_009407557.1| PREDICTED: phosphomethylpyrimidine synthase, chloroplastic-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=1261

 Score =   252 bits (643),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  456  AKKEAPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  515

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVE PDR GRE+ILKVH  KKELPL  DV+L +IASMTTGF
Sbjct  516  RADVLDPALRRPGRFDRVVMVETPDRLGREAILKVHVDKKELPLGDDVNLSEIASMTTGF  575

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIA  476
            TGADLANLVNEAALLAGR  K++VEKIDFI AVERSIA
Sbjct  576  TGADLANLVNEAALLAGRANKVVVEKIDFILAVERSIA  613



>gb|EPS69421.1| hypothetical protein M569_05343, partial [Genlisea aurea]
Length=431

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDAVAKSRDGRFR+ SNDEREQTLNQLLTEMDGFDSNSAVIVLGATN
Sbjct  310  AKKEAPSIIFIDEIDAVAKSRDGRFRLVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  369

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDRVVMVEAPDR GR++IL+VH SKKELPL QDVDLGDIASMTTGF
Sbjct  370  RADVLDPALRRPGRFDRVVMVEAPDRNGRKAILQVHVSKKELPLGQDVDLGDIASMTTGF  429

Query  363  TG  368
            TG
Sbjct  430  TG  431



>ref|XP_002968084.1| hypothetical protein SELMODRAFT_440261 [Selaginella moellendorffii]
 gb|EFJ30338.1| hypothetical protein SELMODRAFT_440261 [Selaginella moellendorffii]
Length=857

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK APSI+FIDEIDAVAK RDGR R  SNDEREQTLNQLLTE+DGF+S S VIV+GATN
Sbjct  456  AKKNAPSIVFIDEIDAVAKGRDGRLRSVSNDEREQTLNQLLTELDGFESASTVIVIGATN  515

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDR+VMVE PDR GRE IL VH +KK LPL++DV+L  +A  T+GF
Sbjct  516  RADVLDPALRRPGRFDRIVMVEPPDRQGREEILNVHVTKKGLPLSKDVNLNAVAGATSGF  575

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ KL V K++F +AVER++AGIEKK + L G+EK VVARH
Sbjct  576  TGADLANLVNEAALLAGRENKLEVGKVEFSRAVERAVAGIEKKRSMLHGSEKGVVARH  633



>ref|XP_002965601.1| hypothetical protein SELMODRAFT_167789 [Selaginella moellendorffii]
 gb|EFJ33021.1| hypothetical protein SELMODRAFT_167789 [Selaginella moellendorffii]
Length=858

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK APSI+FIDEIDAVAK RDGR R  SNDEREQTLNQLLTE+DGF+S S VIV+GATN
Sbjct  457  AKKNAPSIVFIDEIDAVAKGRDGRLRSVSNDEREQTLNQLLTELDGFESASTVIVIGATN  516

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDR+VMVE PDR GRE IL VH +KK LPL++DV+L  +A  T+GF
Sbjct  517  RADVLDPALRRPGRFDRIVMVEPPDRQGREEILNVHVTKKGLPLSKDVNLNVVAGATSGF  576

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR+ KL V K++F +AVER++AGIEKK + L G+EK VVARH
Sbjct  577  TGADLANLVNEAALLAGRENKLEVGKVEFSRAVERAVAGIEKKRSMLHGSEKGVVARH  634



>ref|XP_001753685.1| predicted protein [Physcomitrella patens]
 gb|EDQ81437.1| predicted protein [Physcomitrella patens]
Length=807

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSI+FIDEIDAVAK RDGR R   NDEREQTLNQLLTE+DGF+S+S VIVLGATN
Sbjct  428  AKKEAPSIVFIDEIDAVAKGRDGRLRSVGNDEREQTLNQLLTELDGFESSSTVIVLGATN  487

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R+DVLDPALRRPGRFDR+V VE PDR GRE IL VH +KK+LPLA DV+L  IA+ T GF
Sbjct  488  RADVLDPALRRPGRFDRIVTVEPPDRQGREEILTVHVTKKQLPLAPDVNLNVIAAATAGF  547

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            TGADLANLVNEAALLAGR +KL V   +F QAVERSIAGIEKK + L G+EK VVARH
Sbjct  548  TGADLANLVNEAALLAGRASKLEVGNSEFSQAVERSIAGIEKKRSTLHGSEKGVVARH  605



>dbj|BAD25581.1| cell division protein FtsH3-like [Oryza sativa Japonica Group]
Length=305

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKE+PSIIFIDEIDAVAKSRDGR+R+ SNDEREQTLNQLLTEMDGFD+NSAVIVLGATN
Sbjct  162  AKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN  221

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQD  323
            R+DVLDPALRRPGRFDRVVMVEAPDR GRESILKVH S+KELPL +D
Sbjct  222  RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVSRKELPLGKD  268



>ref|XP_005848949.1| hypothetical protein CHLNCDRAFT_51635 [Chlorella variabilis]
 gb|EFN56847.1| hypothetical protein CHLNCDRAFT_51635 [Chlorella variabilis]
Length=694

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN--SAVIVLGA  176
            A+KEAP+I+FIDEIDAVAK RD R R   NDEREQTLNQLLTE+DGFD++  + VI + A
Sbjct  238  ARKEAPAIVFIDEIDAVAKGRDSRLRSVGNDEREQTLNQLLTELDGFDTHRDNLVICIAA  297

Query  177  TNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTT  356
            TNR DVLD AL RPGRFDR V VE PD+ GRE IL+VH +++ LPL +DV +  +A+ TT
Sbjct  298  TNRPDVLDAALLRPGRFDRRVSVERPDKQGREEILRVHINQRGLPLGEDVRVDQLAAQTT  357

Query  357  GFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            GFTGADLANLVNEAALLAGR  K LV   DF  AV R++AGIEKK + LQG EK VVARH
Sbjct  358  GFTGADLANLVNEAALLAGRGNKGLVTNADFDNAVLRAVAGIEKKRSILQGVEKTVVARH  417



>ref|XP_005645741.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21197.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
Length=573

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN---SAVIVLG  173
            A+KEAP+I+FIDEIDAVAK RD R R   NDEREQTLNQLLTE+DGF+S      VI + 
Sbjct  189  ARKEAPAIVFIDEIDAVAKGRDTRLRSVGNDEREQTLNQLLTELDGFESEKDAGPVICIA  248

Query  174  ATNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMT  353
            ATNR DVLD AL RPGRFDR V VE PDR GRE IL+VH  ++ LPLA D  + D+A  T
Sbjct  249  ATNRPDVLDSALLRPGRFDRRVSVERPDRLGREQILRVHIERRRLPLADDFSVADVAGST  308

Query  354  TGFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVAR  533
             GFTGADLANLVNEAALLAGR++K  V   DF  A+ R++AGIEKK + L G EK VVAR
Sbjct  309  VGFTGADLANLVNEAALLAGRESKGAVGSADFDHAILRAVAGIEKKRSILVGVEKEVVAR  368

Query  534  H  536
            H
Sbjct  369  H  369



>gb|KIZ06390.1| cell division protease FtsH [Monoraphidium neglectum]
Length=797

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGF--DSNSAVIVLGA  176
            A+KEAP+I+FIDEIDAVAK RD R R   NDEREQTLNQLLTE+DGF  D ++ VI + A
Sbjct  341  ARKEAPAIVFIDEIDAVAKGRDSRLRSVGNDEREQTLNQLLTELDGFETDKDNVVICIAA  400

Query  177  TNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTT  356
            TNR DVLD AL RPGRFDR V VE PDR GRE IL+VH  ++ LPL+ +V    IA+MTT
Sbjct  401  TNRPDVLDAALLRPGRFDRRVPVERPDRLGREQILRVHLQRRGLPLSPEVTPSSIAAMTT  460

Query  357  GFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            GFTGADLANLVNEAALLAGR+ K LV   +F  AV R++AGIEKK + L G EK VVARH
Sbjct  461  GFTGADLANLVNEAALLAGRRNKSLVGPEEFDVAVLRAVAGIEKKRSILAGLEKEVVARH  520



>ref|XP_001420133.1| AAA-metalloprotease FtsH, chloroplast precursor [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO98426.1| AAA-metalloprotease FtsH, chloroplast precursor [Ostreococcus 
lucimarinus CCE9901]
Length=677

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 133/179 (74%), Gaps = 1/179 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR-DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK ++PSI+FIDEIDAVAKSR DG+ R   NDEREQTLNQLLTE+DGF++ S VI + AT
Sbjct  277  AKAQSPSIVFIDEIDAVAKSRGDGKMRGMGNDEREQTLNQLLTELDGFETESMVICIAAT  336

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR+D LD ALRRPGRFDR + V+ PD+ GR  IL VH  ++ LPLA+D  L  IA MT G
Sbjct  337  NRADTLDAALRRPGRFDRTISVDRPDKQGRREILAVHTGRRALPLAEDAGLDIIAQMTAG  396

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            FTGADL NLVNEAALLAGR+ K  V   DF  AV R+IAGIEKK + L   EK  V+ H
Sbjct  397  FTGADLENLVNEAALLAGREGKSTVSYTDFEAAVLRTIAGIEKKRSLLTAGEKRTVSAH  455



>ref|WP_035907900.1| cell division protein FtsH [Lebetimonas sp. JH369]
Length=629

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR    +   NDEREQTLNQLL EMDGFDSN  VIVL ATN
Sbjct  258  AKKEAPSIIFIDEIDAIGKSRAAAGQFGGNDEREQTLNQLLAEMDGFDSNDPVIVLAATN  317

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K++ +  DV+L +IA MT G 
Sbjct  318  RPEILDPALLRPGRFDRQVLVDKPDFEGRVQILKVHV--KKIKMGSDVNLEEIARMTAGL  375

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN+VNEAALLAGR+ K  V + +F++AVER IAG+EKK+ +L  N+K  VA H
Sbjct  376  AGADLANIVNEAALLAGRKNKKEVNQSEFVEAVERQIAGLEKKSRRLNENDKKTVAYH  433



>ref|WP_024790353.1| cell division protein FtsH [Lebetimonas sp. JH292]
Length=633

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR    +   NDEREQTLNQLL EMDGFDSN  VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAAGQFGGNDEREQTLNQLLAEMDGFDSNDPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K++ +  DV+L +IA MT G 
Sbjct  322  RPEILDPALLRPGRFDRQVLVDKPDFEGRVQILKVHV--KKIKMGSDVNLEEIARMTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN+VNEAALLAGR+ K  V + +F++AVER IAG+EKK+ +L  N+K  VA H
Sbjct  380  AGADLANIVNEAALLAGRKNKKEVNQSEFVEAVERQIAGLEKKSRRLNENDKKTVAYH  437



>ref|WP_024791044.1| MULTISPECIES: cell division protein FtsH [Lebetimonas]
Length=633

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR    +   NDEREQTLNQLL EMDGFDSN  VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAAGQFGGNDEREQTLNQLLAEMDGFDSNDPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K++ +  DV+L +IA MT G 
Sbjct  322  RPEILDPALLRPGRFDRQVLVDKPDFEGRVQILKVHV--KKIKMGSDVNLEEIARMTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN+VNEAALLAGR+ K  V + +F++AVER IAG+EKK+ +L  N+K  VA H
Sbjct  380  AGADLANIVNEAALLAGRKNKKEVNQSEFVEAVERQIAGLEKKSRRLNENDKKTVAYH  437



>ref|WP_007474894.1| cell division protein FtsH [Caminibacter mediatlanticus]
 gb|EDM23388.1| ZINC METALLOPEPTIDASE [Caminibacter mediatlanticus TB-2]
Length=647

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDSN  VIVL ATN
Sbjct  260  AKKEAPSIIFIDEIDAIGKSRAAGGPMGGNDEREQTLNQLLAEMDGFDSNEPVIVLAATN  319

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K++   +DVDL +IA MT G 
Sbjct  320  RPEVLDPALLRPGRFDRQVLVDKPDFKGRVEILKVHI--KKIKAGKDVDLEEIARMTAGL  377

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN+VNEAALLAGR+ K  V + DF++AVER IAG+EKK+ +L   +K +VA H
Sbjct  378  AGADLANIVNEAALLAGRKNKKEVNQEDFVEAVERQIAGLEKKSRRLNDKDKKIVAYH  435



>ref|XP_003055580.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60832.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=570

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR-DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            A+++APSI+FIDEIDAVAK R DG+ R   NDEREQTLNQLLTE+DGFDS   VI L AT
Sbjct  194  AREQAPSIVFIDEIDAVAKGRSDGKMRGMGNDEREQTLNQLLTELDGFDSGELVICLAAT  253

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR+D LD AL+RPGRFDR V VE PD+ GR+ IL VH S + LPL     + DIA MT G
Sbjct  254  NRADTLDTALKRPGRFDRTVSVERPDKQGRKEILGVHISNRRLPLDPAFRVDDIAQMTAG  313

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            FTGA+LANLVNEAALLAGR+   +V K++F  AV R++AGIEKK + L  +EK  V+ H
Sbjct  314  FTGAELANLVNEAALLAGRKGATIVGKLEFENAVLRTVAGIEKKRSLLSPSEKVTVSAH  372



>ref|WP_036488675.1| cell division protein FtsH [Myxosarcina sp. GI1]
Length=644

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGF++N+ VI+L AT
Sbjct  268  AKQQAPCIVFIDELDALGKSRGGAGNLMGGNDEREQTLNQLLTEMDGFEANTGVIILAAT  327

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+ILKVH  K E  LA DVDLG IA+ T G
Sbjct  328  NRPEVLDPALRRPGRFDRQIVVDRPDKLGREAILKVHIQKVE--LAADVDLGAIAARTPG  385

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +AVER IAG+EKK+  L   EK  VA H
Sbjct  386  FAGADLANLVNEAALLAARQNREAVTMADFNEAVERVIAGLEKKSRVLNEMEKKTVAYH  444



>ref|WP_009457520.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC12139.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=646

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGPIMGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA+DVDLG IA+ T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLAEDVDLGIIAAKTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAAL+A RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALMAARQNRQAVTMADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  439



>ref|XP_003081603.1| putative cell division protein FtsH3 [Oryza sativa (ISS) [Ostreococcus 
tauri]
Length=749

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR-DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK ++PSI+FIDEIDAVAKSR DG+ R   NDEREQTLNQLLTE+DGF++ S VI + AT
Sbjct  348  AKAQSPSIVFIDEIDAVAKSRGDGKMRGMGNDEREQTLNQLLTELDGFETESMVICIAAT  407

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR+D LD ALRRPGRFDR V V+ PD+ GR  IL VH  ++ LPLA+D  L  IA MT G
Sbjct  408  NRADTLDAALRRPGRFDRTVSVDRPDKQGRREILAVHTGRRHLPLAEDAGLDVIAQMTAG  467

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            FTGADL NLVNEAALLAGR  K  V   DF  AV R+IAGIEKK   L  +EK  V+ H
Sbjct  468  FTGADLENLVNEAALLAGRSGKSTVGYADFEAAVLRTIAGIEKKRNLLSISEKTTVSVH  526



>emb|CEF99366.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=750

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR-DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK ++PSI+FIDEIDAVAKSR DG+ R   NDEREQTLNQLLTE+DGF++ S VI + AT
Sbjct  349  AKAQSPSIVFIDEIDAVAKSRGDGKMRGMGNDEREQTLNQLLTELDGFETESMVICIAAT  408

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR+D LD ALRRPGRFDR V V+ PD+ GR  IL VH  ++ LPLA+D  L  IA MT G
Sbjct  409  NRADTLDAALRRPGRFDRTVSVDRPDKQGRREILAVHTGRRHLPLAEDAGLDVIAQMTAG  468

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            FTGADL NLVNEAALLAGR  K  V   DF  AV R+IAGIEKK   L  +EK  V+ H
Sbjct  469  FTGADLENLVNEAALLAGRSGKSTVGYADFEAAVLRTIAGIEKKRNLLSISEKTTVSVH  527



>ref|WP_012663665.1| cell division protein FtsH [Nautilia profundicola]
 gb|ACM92293.1| HpFtsH [Nautilia profundicola AmH]
Length=640

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR    +   NDEREQTLNQLL EMDGFDSN  VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAAGQFGGNDEREQTLNQLLAEMDGFDSNEPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPAL RPGRFDR V+V+ PD  GR  IL+VH   K++   +DVDL +IA MT G 
Sbjct  322  RPEVLDPALLRPGRFDRQVLVDKPDFEGRVQILQVHV--KKIKAGKDVDLREIAKMTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN+VNEAALLAGR+ K  V + +F++AVER IAG+EKK+ +L   +K +VA H
Sbjct  380  AGADLANIVNEAALLAGRKGKKEVNQEEFVEAVERQIAGLEKKSRRLNEKDKKIVAYH  437



>ref|WP_026086128.1| cell division protein FtsH [Fischerella muscicola]
Length=646

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGPIMGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA+DVDLG IA+ T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLAEDVDLGIIAARTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAAL+A RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALMAARQNRQAVTIADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  439



>ref|WP_026943798.1| cell division protein FtsH [Helicobacter rodentium]
Length=643

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF+S+S+ VIVL AT
Sbjct  268  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFNSDSSPVIVLAAT  327

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA++VDL ++A +T G
Sbjct  328  NRPEVLDPALLRPGRFDRQVLVDKPDFEGRVEILKVHI--KNIKLARNVDLFEVAKLTAG  385

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  VE+ DF++AVER IAG+EKK+ ++   EK +VA H
Sbjct  386  LAGADLANIVNEAALLAGRGNKKEVEQSDFLEAVERGIAGLEKKSRRISPKEKKIVAYH  444



>ref|WP_016877481.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=641

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR G   V   NDEREQTLNQLLTEMDGF++N+ VI+L AT
Sbjct  266  AKKQAPCIVFIDELDALGKSRGGTGPVMGGNDEREQTLNQLLTEMDGFEANTGVIILAAT  325

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+IL+VH   K + LAQDVDLG IA+ T G
Sbjct  326  NRPEVLDPALRRPGRFDRQIVVDRPDKKGREAILQVHV--KAVKLAQDVDLGVIATRTPG  383

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER IAG++KK+  L   EK  VA H
Sbjct  384  FAGADLANLVNEAALLAARQNREAVTMADFNEAIERVIAGLQKKSRVLNEVEKRTVAYH  442



>gb|KGL36723.1| cell division protein FtsH [Helicobacter sp. MIT 05-5294]
Length=642

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF+S+S+ VIVL AT
Sbjct  268  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFNSDSSPVIVLAAT  327

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA++VDL ++A +T G
Sbjct  328  NRPEVLDPALLRPGRFDRQVLVDKPDFEGRVEILKVHI--KNIKLAKNVDLFEVAKLTAG  385

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  VE+ DF++AVER IAG+EKK+ ++   EK +VA H
Sbjct  386  LAGADLANIVNEAALLAGRGNKKEVEQGDFLEAVERGIAGLEKKSRRISPKEKKIVAYH  444



>ref|WP_015154152.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY87604.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=648

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK+++P I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  265  AKQQSPCIVFIDELDALGKSRGGANGFPGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  324

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRESILKVHA  + + LA+DVDLG IA+ T G
Sbjct  325  NRPEVLDPALRRPGRFDRQVVVDRPDKIGRESILKVHA--RSVKLAEDVDLGTIATRTPG  382

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V + DF +A+ER I G+EK++  L   EK  VA H
Sbjct  383  FAGADLANLVNEAALLAARQNRDAVTQADFNEAIERVIGGLEKRSRVLNETEKKTVAYH  441



>ref|WP_039714311.1| cell division protein FtsH [Scytonema millei]
 gb|KIF22043.1| cell division protein FtsH [Scytonema millei VB511283]
Length=648

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK+++P I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  265  AKQQSPCIVFIDELDALGKSRGGANGFPGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  324

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRESILKVHA  + + LA+DVDLG IA+ T G
Sbjct  325  NRPEVLDPALRRPGRFDRQVVVDRPDKIGRESILKVHA--RNVKLAEDVDLGTIATRTPG  382

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V + DF +A+ER I G+EK++  L   EK  VA H
Sbjct  383  FAGADLANLVNEAALLAARQNRDAVTQADFNEAIERVIGGLEKRSRVLNETEKKTVAYH  441



>ref|WP_034553264.1| cell division protein FtsH [Helicobacter apodemus]
 gb|KGL19793.1| cell division protein FtsH [Helicobacter apodemus]
Length=642

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S+S+ VIVL AT
Sbjct  268  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFSSDSSPVIVLAAT  327

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + L+++VDL +IA +T G
Sbjct  328  NRPEVLDPALLRPGRFDRQVLVDKPDFEGRVEILKVHI--KNIKLSKNVDLFEIAKLTAG  385

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  VE+ DF++AVER IAG+EKK+ ++   EK +VA H
Sbjct  386  LAGADLANIVNEAALLAGRNNKKDVEQNDFLEAVERGIAGLEKKSRRISPKEKKIVAYH  444



>ref|XP_002503552.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64810.1| predicted protein [Micromonas sp. RCC299]
Length=886

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 1/179 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR-DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            A+++AP+I+FIDEIDAVAK R DGR R   NDEREQTLNQLLTE+DGFD    VI L AT
Sbjct  476  AREQAPAIVFIDEIDAVAKGRSDGRLRGMGNDEREQTLNQLLTELDGFDDEHLVICLAAT  535

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR+D LD AL+RPGRFDR V VE PD+ GR+ IL VH   + LP+ + +D+ +IASMT G
Sbjct  536  NRADTLDSALKRPGRFDRTVSVERPDKQGRKEILGVHIGARNLPMREGLDVDEIASMTAG  595

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            FTGA+LANLVNEAALLAGR     V K DF  AV R++AGIEKK + L   EK +V+ H
Sbjct  596  FTGAELANLVNEAALLAGRTGATTVGKEDFESAVLRTVAGIEKKRSILSAAEKVIVSAH  654



>ref|WP_016859315.1| cell division protein FtsH [Fischerella muscicola]
Length=646

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGPIMGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + L+ DVDLG+IA+ T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVLLSDDVDLGNIAAKTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALLAARQNRQAVVMADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  439



>ref|WP_006802112.1| cell division protein FtsH [Helicobacter winghamensis]
 gb|EEO25627.1| cell division protease FtsH [Helicobacter winghamensis ATCC BAA-430]
Length=642

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  268  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFSSDASPVIVLAAT  327

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA+ VDL ++A +T G
Sbjct  328  NRPEVLDPALLRPGRFDRQVLVDKPDFEGRVEILKVHI--KNIKLARSVDLFEVAKLTAG  385

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  VE+ DF++AVER IAG+EKK+ ++   EK +VA H
Sbjct  386  LAGADLANIVNEAALLAGRNNKKEVEQSDFLEAVERGIAGLEKKSRRISPKEKKIVAYH  444



>ref|WP_015208959.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale]
 gb|AFZ25711.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale 
PCC 7417]
Length=645

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRGGAGPIMGGNDEREQTLNQLLTEMDGFDTNTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPALRRPGRFDR V+++ PD+ GRE+ILKVHA  + + LA+DV+LG IA+ T G
Sbjct  322  NRPEILDPALRRPGRFDRQVLLDRPDKIGREAILKVHA--RNVKLAEDVNLGTIATRTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRSSVTMADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_009555088.1| membrane protease FtsH catalytic subunit [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ70514.1| membrane protease FtsH catalytic subunit [Oscillatoriales cyanobacterium 
JSC-12]
Length=643

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK+AP I+FIDE+DA+ KSR        NDEREQTLNQLLTEMDGF++N+ VI+L ATN
Sbjct  261  AKKQAPCIVFIDELDALGKSRAQGPMFGGNDEREQTLNQLLTEMDGFEANTGVILLAATN  320

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + L+ DVDLG IA  T GF
Sbjct  321  RPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLSNDVDLGAIAIRTPGF  378

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLANLVNEAALLA R  +  V   DF +A+ER IAG+EKK+  L   EK VVA H
Sbjct  379  VGADLANLVNEAALLAARNGRQAVVMADFAEAIERVIAGLEKKSRVLNDTEKKVVAYH  436



>dbj|BAF70516.1| cell division protein FtsH [Nitratiruptor sp. SB155-2]
Length=660

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  272  AKKEAPSIIFIDEIDAIGKSRAAAGPIGGNDEREQTLNQLLAEMDGFDSSESPVIVLAAT  331

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR +ILKVH   K + L+ +VDL +IA +T G
Sbjct  332  NRPEVLDPALLRPGRFDRTVVVDKPDFEGRLAILKVHV--KHIKLSPNVDLEEIARLTAG  389

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR+ K  VE+ D ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  390  LAGADLANIVNEAALLAGRKNKEQVEQEDLLEAVERAIAGLEKKSRRISPEEKRIVAYH  448



>ref|WP_041354322.1| cell division protein FtsH, partial [Nitratiruptor sp. SB155-2]
Length=645

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  272  AKKEAPSIIFIDEIDAIGKSRAAAGPIGGNDEREQTLNQLLAEMDGFDSSESPVIVLAAT  331

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR +ILKVH   K + L+ +VDL +IA +T G
Sbjct  332  NRPEVLDPALLRPGRFDRTVVVDKPDFEGRLAILKVHV--KHIKLSPNVDLEEIARLTAG  389

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR+ K  VE+ D ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  390  LAGADLANIVNEAALLAGRKNKEQVEQEDLLEAVERAIAGLEKKSRRISPEEKRIVAYH  448



>ref|WP_016874966.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=645

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRF-RVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G    +  NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRGGAGPMMGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA DVDLG IA+ T G
Sbjct  322  NRPEILDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLADDVDLGIIAARTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRQAVAMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_006656079.1| cell division protein FtsH [Helicobacter canadensis]
 gb|EES88815.1| Cell division protein FtsH [Helicobacter canadensis MIT 98-5491]
 gb|EFR48887.1| cell division protease FtsH [Helicobacter canadensis MIT 98-5491]
Length=643

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR        NDEREQTLNQLL EMDGF+S+S+ VIVL AT
Sbjct  269  AKKEAPSIIFIDEIDAIGKSRANGMVGGGNDEREQTLNQLLAEMDGFNSDSSPVIVLAAT  328

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA++VDL +++ +T G
Sbjct  329  NRPEVLDPALLRPGRFDRQVLVDKPDFEGRVEILKVHI--KNIKLARNVDLFEVSKLTAG  386

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  VE+ DF++AVERSIAG+EKK+ ++   EK +VA H
Sbjct  387  LAGADLANIVNEAALLAGRNDKKGVEQSDFLEAVERSIAGLEKKSRRISPKEKKIVAYH  445



>ref|WP_005021552.1| cell division protein FtsH [Helicobacter pullorum]
 gb|EEQ63303.1| cell division protease FtsH [Helicobacter pullorum MIT 98-5489]
Length=642

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK APSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S+S+ VIVL AT
Sbjct  268  AKKNAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFSSDSSPVIVLAAT  327

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + L+++VDL ++A +T G
Sbjct  328  NRPEVLDPALLRPGRFDRQVLVDKPDFEGRVEILKVHI--KNIKLSKNVDLFEVAKLTAG  385

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  VE+ DF++AVER IAG+EKK+ ++   EK +VA H
Sbjct  386  LAGADLANIVNEAALLAGRNNKKEVEQSDFLEAVERGIAGLEKKSRRISPKEKKIVAYH  444



>ref|WP_024962264.1| cell division protein FtsH [Campylobacter ureolyticus]
Length=646

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSI+FIDEIDA+ KSR     +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  262  AKKEAPSIVFIDEIDAIGKSRSSA-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVMAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILK+H   K++  A D+D+ +IA +TTG
Sbjct  321  NRPEILDPALLRPGRFDRQVLVDRPDFKGRMDILKIHM--KDVKFADDIDIEEIARLTTG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N+VNEAALLAGR +K  VE+ DF++AVERSIAG+EKK+ ++   EK +VA H
Sbjct  379  LAGADLENIVNEAALLAGRGSKKAVEQEDFVEAVERSIAGLEKKSRRVNPKEKKIVAYH  437



>ref|WP_026081972.1| MULTISPECIES: cell division protein FtsH [Stigonematales]
 gb|KIY12165.1| cell division protein FtsH [Mastigocladus laminosus UU774]
Length=646

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGPIMGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + L+ +VDLG+IA+ T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVLLSDNVDLGNIAAKTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALLAARQNRQSVVMADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  439



>ref|WP_011319019.1| cell division protein FtsH [Anabaena variabilis]
 gb|ABA21852.1| membrane protease FtsH catalytic subunit [Anabaena variabilis 
ATCC 29413]
Length=645

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKKQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA DVDLG+IA  T G
Sbjct  322  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLANDVDLGNIAIKTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRQAVVMADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_015188679.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30807.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=643

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDG-RFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G    V  NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  260  AKQQAPCIVFIDELDALGKSRGGANGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  319

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA DVDL  +A  T G
Sbjct  320  NRPEVLDPALRRPGRFDRQVVVDRPDKVGREAILKVHA--RNVKLADDVDLLTVAGRTPG  377

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+E+++  L  NEK  VA H
Sbjct  378  FAGADLANLVNEAALLAARQNREAVSMSDFNEAIERVVAGLERRSRVLNENEKKTVAYH  436



>ref|WP_026720283.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=646

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGPIMGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA +VDLG IA  T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVLLADNVDLGMIAGKTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALLAARQNRQAVTMADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  439



>ref|WP_010999062.1| cell division protein FtsH [Nostoc sp. PCC 7120]
 dbj|BAB76635.1| cell division protein [Nostoc sp. PCC 7120]
Length=645

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKKQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA DVDLG+IA  T G
Sbjct  322  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLADDVDLGNIAIKTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRQAVVMADFNEAIERLVAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_034562379.1| cell division protein FtsH [Helicobacter bilis]
 gb|KGL26304.1| cell division protein FtsH [Helicobacter bilis]
 gb|KGL28974.1| cell division protein FtsH [Helicobacter bilis]
Length=635

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAGSVVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+APD  GR  ILKVH   K + L++DVDL +IA  T G 
Sbjct  322  RPEILDPALLRPGRFDRQVLVDAPDFKGRIEILKVHI--KGVKLSKDVDLNEIAKFTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ K  V +  F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  380  AGADLANIINEAALLAGRENKKEVSQKHFKEAMERTMIGLEKKSRRLSPKEKKIVAYH  437



>ref|WP_034575614.1| cell division protein FtsH [Helicobacter bilis]
 gb|KGL24172.1| cell division protein FtsH [Helicobacter bilis]
Length=623

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  250  AKKEAPSIIFIDEIDAIGKSRAAGSVVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  309

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+APD  GR  ILKVH   K + L++DVDL +IA  T G 
Sbjct  310  RPEILDPALLRPGRFDRQVLVDAPDFKGRIEILKVHI--KGVKLSRDVDLNEIAKFTAGL  367

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ K  V +  F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  368  AGADLANIINEAALLAGRENKKEVSQKHFKEAMERTMIGLEKKSRRLSPKEKKIVAYH  425



>ref|WP_034290148.1| cell division protein FtsH [Helicobacter sp. MIT 11-5569]
 gb|KGL10835.1| cell division protein FtsH [Helicobacter sp. MIT 11-5569]
Length=641

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKK APSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  269  AKKGAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFSSDASPVIVLAAT  328

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA++VDL ++A +T G
Sbjct  329  NRPEVLDPALLRPGRFDRQVLVDKPDFEGRVEILKVHI--KNIKLARNVDLFEVAKLTAG  386

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  VE+ DF++AVER IAG+EKK+ ++   EK +VA H
Sbjct  387  LAGADLANIVNEAALLAGRNNKKEVEQSDFLEAVERGIAGLEKKSRRISPKEKKIVAYH  445



>ref|WP_034346232.1| cell division protein FtsH [Helicobacter trogontum]
 gb|KGL31368.1| cell division protein FtsH [Helicobacter trogontum]
Length=635

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAGSVVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+APD  GR  ILKVH   K + L +DVDL +IA  T G 
Sbjct  322  RPEILDPALLRPGRFDRQVLVDAPDFKGRIEILKVHI--KGVKLGKDVDLNEIAKFTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ K  V +  F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  380  AGADLANIINEAALLAGRENKKEVSQKHFKEAMERTMIGLEKKSRRLSPKEKKIVAYH  437



>ref|WP_034318612.1| cell division protein FtsH [Helicobacter trogontum]
 gb|KGL33928.1| cell division protein FtsH [Helicobacter trogontum]
Length=635

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAGSVVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+APD  GR  ILKVH   K + L +DVDL +IA  T G 
Sbjct  322  RPEILDPALLRPGRFDRQVLVDAPDFKGRIEILKVHI--KGVKLGKDVDLNEIAKFTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ K  V +  F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  380  AGADLANIINEAALLAGRENKKEVSQKHFKEAMERTMIGLEKKSRRLSPKEKKIVAYH  437



>ref|WP_017292221.1| hypothetical protein [Leptolyngbya boryana]
Length=646

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFR-VASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR      +  NDEREQTLNQLLTEMDGF++N+ VI+L AT
Sbjct  270  AKKQAPCIVFIDELDALGKSRAAAGSPLGGNDEREQTLNQLLTEMDGFEANTGVIILAAT  329

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V++  PD+ GRE+IL+VHA  K + LA+DVDL  IA+ T G
Sbjct  330  NRPEVLDPALRRPGRFDRQVVINRPDKQGREAILRVHA--KAIQLAEDVDLSVIATRTPG  387

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ ++ V   DF +A+ER IAG++KK+  L   EK  VA H
Sbjct  388  FAGADLANLVNEAALLAARQNRISVTMADFNEAIERVIAGLQKKSRVLNEVEKKTVAYH  446



>ref|WP_005219947.1| cell division protein FtsH [Helicobacter bilis]
 gb|EEO24979.1| ATP-dependent zinc metalloprotease FtsH [Helicobacter bilis ATCC 
43879]
Length=635

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAGSVVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+APD  GR  ILKVH   K + L++DVDL +IA  T G 
Sbjct  322  RPEILDPALLRPGRFDRQVLVDAPDFKGRIEILKVHI--KGVKLSRDVDLNEIAKFTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ K  V +  F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  380  AGADLANIINEAALLAGRENKKEVSQKHFKEAMERTMIGLEKKSRRLSPKEKKIVAYH  437



>ref|WP_026735191.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=645

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRD-GRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR  G   +  NDEREQTLNQLL+EMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRAAGGPIMGGNDEREQTLNQLLSEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA DVDLG IA  T G
Sbjct  322  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLANDVDLGIIAGRTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRQAVTMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_004084199.1| ATP-dependent zinc metalloprotease FtsH [Helicobacter bilis]
 gb|EMZ41221.1| ATP-dependent zinc metalloprotease FtsH [Helicobacter bilis WiWa]
 gb|KGL25206.1| cell division protein FtsH [Helicobacter bilis]
Length=635

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAGSVVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  321

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPAL RPGRFDR V+V+APD  GR  ILKVH   K + L++DVDL +IA  T G 
Sbjct  322  RPEILDPALLRPGRFDRQVLVDAPDFKGRIEILKVHI--KGVKLSRDVDLNEIAKFTAGL  379

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ K  V +  F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  380  AGADLANIINEAALLAGRENKKEVSQKHFKEAMERTMIGLEKKSRRLSPKEKKIVAYH  437



>ref|WP_018712818.1| cell division protein FtsH [Campylobacter ureolyticus]
Length=646

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSI+FIDEIDA+ KSR     +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  262  AKKEAPSIVFIDEIDAIGKSRSSA-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVMAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILK+H   K++  A D+D+ +IA +TTG
Sbjct  321  NRPEILDPALLRPGRFDRQVLVDRPDFKGRMDILKIHM--KDVKFADDIDIEEIARLTTG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N+VNEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +VA H
Sbjct  379  LAGADLENIVNEAALLAGRESKRAVEQDDLVEAVERSIAGLEKKSRRVNPKEKRIVAYH  437



>ref|WP_017320334.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=645

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 140/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G   +   NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRGGPGPIIGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPALRRPGRFDR V+V+ PD++GRE+ILKVHA  + + LA+DVDLG IA+ T G
Sbjct  322  NRPEILDPALRRPGRFDRQVVVDRPDKSGREAILKVHA--RNVKLAEDVDLGVIAARTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRQAVTMADFNEAIERVVAGLEKRSRVLNEIEKKTVAYH  438



>ref|WP_041034268.1| cell division protein FtsH [Tolypothrix campylonemoides]
 gb|KIJ78060.1| cell division protein FtsH [Tolypothrix campylonemoides VB511288]
Length=646

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA+DVDLG IA  T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLAEDVDLGTIAIRTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALLAARQNRQAVVMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  439



>ref|WP_036000502.1| cell division protein FtsH [Leptolyngbya sp. JSC-1]
Length=674

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 138/178 (78%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDE+DA+ K+R     + SNDE+EQTLNQLLTEMDGF+ N+ VI++ ATN
Sbjct  295  AKQKAPCIVFIDELDALGKARSSNSALGSNDEQEQTLNQLLTEMDGFEGNTGVIIIAATN  354

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPALRRPGRFDR+V V+ PD+ GRE+IL+VHA K +  L  DVDLG IA+ T GF
Sbjct  355  RPEVLDPALRRPGRFDRLVTVDRPDKLGREAILRVHAKKVQ--LDSDVDLGAIATRTPGF  412

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            +GADLANL+NEAALLA R+ + LV   D  +A+ER IAG+E+K+  L   E+ +V+ H
Sbjct  413  SGADLANLINEAALLAARKNQTLVRMADLNEAIERVIAGLERKSRVLNPLERKIVSYH  470



>ref|WP_027403321.1| cell division protein FtsH [Aphanizomenon flos-aquae]
Length=645

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDG-RFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G    V  NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKEQAPCIVFIDELDALGKSRGGPSGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA DVDLG IA+ T G
Sbjct  322  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLATDVDLGIIATRTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R  +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARNNRPAVIMADFNEAIERLVAGLEKRSRVLNELEKKTVAYH  438



>ref|WP_011138552.1| cell division protein FtsH [Wolinella succinogenes]
 emb|CAE09752.1| ZINC METALLOPEPTIDASE [Wolinella succinogenes]
Length=648

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKKE+PSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S+S+ VIVL AT
Sbjct  274  AKKESPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFSSDSSPVIVLAAT  333

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   + + +A+DVDL +IA +T G
Sbjct  334  NRPEVLDPALLRPGRFDRQVLVDKPDYNGRVEILKVHI--QSIKIARDVDLYEIARLTAG  391

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  K  V++ DF +AVER IAG+EKK+ ++   EK +VA H
Sbjct  392  LAGADLANIVNEAALLAGRANKKEVQQSDFREAVERGIAGLEKKSRRISPKEKRIVAYH  450



>ref|WP_016646602.1| ATP-dependent metallopeptidase HflB [Campylobacter ureolyticus]
 gb|EPH09228.1| ATP-dependent metallopeptidase HflB [Campylobacter ureolyticus 
ACS-301-V-Sch3b]
Length=646

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSI+FIDEIDA+ KSR     +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  262  AKKEAPSIVFIDEIDAIGKSRSSA-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVMAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILK+H   K++  A D+D+ +IA +TTG
Sbjct  321  NRPEILDPALLRPGRFDRQVLVDRPDFKGRIDILKIHM--KDVKFADDIDIEEIARLTTG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N+VNEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +VA H
Sbjct  379  LAGADLENIVNEAALLAGRESKRAVEQEDLVEAVERSIAGLEKKSRRVNPKEKRIVAYH  437



>ref|WP_034587126.1| cell division protein FtsH, partial [Helicobacter magdeburgensis]
 gb|KGL16091.1| cell division protein FtsH, partial [Helicobacter magdeburgensis]
Length=436

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK+APSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF S SA VIVL AT
Sbjct  64   AKKDAPSIIFIDEIDAIGKSRAAGSMVGGNDEREQTLNQLLAEMDGFGSESAPVIVLAAT  123

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA+DVDL +IA  T G
Sbjct  124  NRPEILDPALLRPGRFDRQVLVDKPDFEGRLEILKVHI--KNVSLARDVDLHEIAKFTAG  181

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR+ K  V +    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  182  LAGADLANIINEAALLAGRENKKEVSQKHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  240



>ref|WP_015139746.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
 gb|AFY49317.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
Length=645

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKKQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+IL VHA  + + LA DVDLG+IA  T G
Sbjct  322  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILNVHA--RNVKLADDVDLGNIAIKTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRQAVVMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_034571832.1| cell division protein FtsH [Helicobacter sanguini]
 gb|KGI51762.1| cell division protein FtsH [Helicobacter sanguini]
Length=631

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKK+APSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  259  AKKDAPSIIFIDEIDAIGKSRAAGSVVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  318

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPAL RPGRFDR V+V+APD  GR  ILKVH   K + LA+DVDL +IA  T G 
Sbjct  319  RPEVLDPALLRPGRFDRQVLVDAPDFKGRIEILKVHI--KGVKLAKDVDLNEIAKFTAGL  376

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ +  V +  F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  377  AGADLANIINEAALLAGRENQKEVSQKHFKEAMERTMIGLEKKSRRLSLKEKRIVAYH  434



>ref|WP_009294674.1| cell division protein FtsH [Campylobacter sp. 10_1_50]
 gb|EHL89724.1| ATP-dependent metallopeptidase HflB [Campylobacter sp. 10_1_50]
Length=641

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSI+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPSIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKKIVTYH  439



>gb|KIE07254.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=645

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G    +  NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRGGASPFSGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD ALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + L++DVDLG+IA  T G
Sbjct  322  NRPEVLDAALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLSEDVDLGNIAIKTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNRQAVIMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_034557617.1| cell division protein FtsH [Helicobacter muridarum]
 gb|KGL13150.1| cell division protein FtsH [Helicobacter muridarum]
Length=633

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF SN+ VIVL ATN
Sbjct  261  AKKEAPSIIFIDEIDAIGKSRAAGSMVGGNDEREQTLNQLLAEMDGFGSNAPVIVLAATN  320

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPAL RPGRFDR V+V+APD  GR  ILKVH   K + L++DVDL ++A  T G 
Sbjct  321  RPEVLDPALLRPGRFDRQVLVDAPDFKGRIDILKVHI--KGVKLSKDVDLTEVAKFTAGL  378

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGR+ +  V    F +A+ER++ G+EKK+ +L   EK +VA H
Sbjct  379  AGADLANIINEAALLAGRENQKEVSHRHFKEAMERTMIGLEKKSRRLSPKEKKIVAYH  436



>ref|WP_034963332.1| cell division protein FtsH [Campylobacter hyointestinalis]
 gb|KEA43969.1| cell division protein FtsH [Campylobacter hyointestinalis subsp. 
hyointestinalis]
Length=645

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  263  AKKEAPAIVFIDEIDAIGKSRAAGAMMGGNDEREQTLNQLLAEMDGFDSDKSPVIVLAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH+  KE+ LA++V++ DI  +T G
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRVDILKVHS--KEVKLAKNVNMDDIGRLTAG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  +E+ D ++AVER+IAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLANIINEAALLAGRASKKFIEQQDLVEAVERAIAGLEKKSRRINPKEKKIVTYH  439



>ref|WP_038453951.1| cell division protein FtsH [Campylobacter fetus]
 gb|AIR79238.1| integral membrane ATP-dependent zinc metallopeptidase [Campylobacter 
fetus subsp. fetus 04/554]
Length=643

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  261  AKKEAPAIVFIDEIDAIGKSRAAGAMMGGNDEREQTLNQLLAEMDGFDSDKSPVIVLAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH+  KE+ LA +V++ DI  +T G
Sbjct  321  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRVDILKVHS--KEVKLANNVNMDDIGRLTAG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  +E+ D I+AVER+IAG+EKK+ ++   EK +V  H
Sbjct  379  LAGADLANIINEAALLAGRASKEYIEQQDLIEAVERAIAGLEKKSRRINPKEKKIVTYH  437



>ref|WP_017286499.1| cell division protein FtsH [Leptolyngbya boryana]
Length=637

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDE+DA+ KSR     +  NDEREQTLNQLLTEMDGFD+N+ VI+L ATN
Sbjct  259  AKQQAPCIVFIDELDALGKSRSAGNIMGGNDEREQTLNQLLTEMDGFDANTGVILLAATN  318

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPALRRPGRFDR V+V+ PD+ GRE+IL VHA  + + L+ DVDL  IA  T GF
Sbjct  319  RPEVLDPALRRPGRFDRQVVVDRPDKIGREAILNVHA--RAVKLSDDVDLAKIAVRTPGF  376

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLANLVNEAALLA R  +  V   DF +A+ER IAG+EK++  L   EK +VA H
Sbjct  377  AGADLANLVNEAALLAARNNRDAVVMADFNEAIERVIAGLEKRSRVLNETEKKIVAHH  434



>ref|WP_023929095.1| ATP-dependent zinc metalloprotease FtsH [Helicobacter canis]
 gb|ETD27287.1| ATP-dependent zinc metalloprotease FtsH [Helicobacter canis NCTC 
12740]
Length=636

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA+DVDL +IA +T G
Sbjct  322  NRPEVLDPALLRPGRFDRQVLVDKPDFNGRVQILKVHI--KSVKLARDVDLEEIAKLTAG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V + +  +AVER IAG+EKK+ ++   EK +VA H
Sbjct  380  LAGADLANIINEAALLAGRNNQKQVSQANLKEAVERGIAGLEKKSRRISPKEKKIVAYH  438



>ref|WP_042204380.1| cell division protein FtsH, partial [Nitratifractor salsuginis]
Length=646

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S++ VIVL ATN
Sbjct  271  AKKEAPSIIFIDEIDAIGKSRTAGGPMGGNDEREQTLNQLLAEMDGFGSDTPVIVLAATN  330

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPAL R GRFDR V+V+ PD  GR +ILK+H+  +++ LA DVDL ++A  T G 
Sbjct  331  RPEVLDPALLRAGRFDRQVLVDKPDFEGRLAILKIHS--RDVKLAPDVDLEEVAKATAGL  388

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGRQ K  +E+ D ++A+ER+  G+EKKN K+   EK +V+ H
Sbjct  389  AGADLANIINEAALLAGRQNKKQIEQSDLMEAIERAFVGLEKKNRKINDLEKRIVSYH  446



>ref|WP_024954334.1| cell division protein FtsH [Sulfurospirillum arcachonense]
Length=660

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR    ++  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  273  AKKEAPAIVFIDEIDAIGKSRAANGQMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  332

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH +   + L++D+DL +IA +T G
Sbjct  333  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRRDILKVHVNG--IKLSKDIDLEEIARLTAG  390

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALL GR+ K  VE++D ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  391  LAGADLANIINEAALLGGRKNKSHVEQVDMVEAVERAIAGLEKKSRRINPEEKRIVAYH  449



>ref|WP_002850165.1| cell division protein FtsH [Campylobacter fetus]
 gb|ABK81864.1| putative Cell division protein FtsH homolog [Campylobacter fetus 
subsp. fetus 82-40]
 gb|EGU24409.1| Putative Cell division protein FtsH [Campylobacter fetus subsp. 
venerealis NCTC 10354]
 gb|AHE94676.1| integral membrane ATP-dependent zinc metallopeptidase [Campylobacter 
fetus subsp. venerealis cfvi03/293]
 emb|CDF65398.1| cell division protein FtsH [Campylobacter fetus subsp. venerealis 
str. 84-112]
 gb|AIR81090.1| integral membrane ATP-dependent zinc metallopeptidase [Campylobacter 
fetus subsp. venerealis 97/608]
Length=643

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  261  AKKEAPAIVFIDEIDAIGKSRAAGAMMGGNDEREQTLNQLLAEMDGFDSDKSPVIVLAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH+  KE+ LA +V++ DI  +T G
Sbjct  321  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRVDILKVHS--KEVKLANNVNMDDIGRLTAG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  +E+ D I+AVER+IAG+EKK+ ++   EK +V  H
Sbjct  379  LAGADLANIINEAALLAGRASKEYIEQQDLIEAVERAIAGLEKKSRRINPKEKKIVTYH  437



>ref|WP_017318012.1| cell division protein FtsH [Mastigocladopsis repens]
Length=646

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA+DVDLG I   T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLAEDVDLGMIGIRTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALLAARQNQQAVTMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  439



>ref|WP_039674317.1| cell division protein FtsH, partial [Sulfurospirillum sp. MES]
Length=640

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  270  AKKEAPAIVFIDEIDAIGKSRAASGMMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  329

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR+ ILKVH    ++ L +D++L +IA +T G
Sbjct  330  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRKDILKVHVV--DIKLGKDINLEEIARLTAG  387

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR+TK  VE+ D ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  388  LAGADLANIINEAALLAGRKTKTYVEQQDLVEAVERAIAGLEKKSRRINPEEKRIVAYH  446



>ref|WP_042960456.1| cell division protein FtsH [Campylobacter fetus]
 gb|KGT36216.1| cell division protein FtsH [Campylobacter fetus]
Length=646

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  261  AKKEAPAIVFIDEIDAIGKSRAAGAMMGGNDEREQTLNQLLAEMDGFDSDKSPVIVLAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH+  KE+ LA +V++ DI  +T G
Sbjct  321  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRVDILKVHS--KEVKLANNVNMDDIGRLTAG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  +E+ D I+AVER+IAG+EKK+ ++   EK +V  H
Sbjct  379  LAGADLANIINEAALLAGRASKEYIEQQDLIEAVERAIAGLEKKSRRINPKEKKIVTYH  437



>ref|WP_021085972.1| Cell division protein FtsH [Campylobacter concisus]
 gb|ERJ23044.1| Cell division protein FtsH [Campylobacter concisus UNSW1]
Length=641

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPAIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKKIVTYH  439



>ref|WP_014770003.1| cell division protein FtsH [Sulfurospirillum barnesii]
 gb|AFL69127.1| membrane protease FtsH catalytic subunit [Sulfurospirillum barnesii 
SES-3]
Length=652

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  272  AKKEAPAIVFIDEIDAIGKSRAANGMMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  331

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR+ ILKVH++  ++ L +++DL +IA +T G
Sbjct  332  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRKDILKVHSA--DIKLDKNIDLEEIARLTAG  389

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALL GR+ K  VE+ID ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  390  LAGADLANIINEAALLGGRKNKSHVEQIDLVEAVERAIAGLEKKSRRINPKEKRIVAYH  448



>ref|WP_021087314.1| Cell division protein FtsH [Campylobacter concisus]
 gb|ERJ30052.1| Cell division protein FtsH [Campylobacter concisus UNSWCS]
Length=641

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPAIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKKIVTYH  439



>ref|WP_002939560.1| cell division protein FtsH [Campylobacter concisus]
 ref|YP_001467283.1| cell division protease FtsH-like protein [Campylobacter concisus 
13826]
 gb|EAT99191.1| putative Cell division protease FtsH homolog [Campylobacter concisus 
13826]
 gb|EIF07330.1| Cell division protein FtsH [Campylobacter concisus UNSWCD]
Length=641

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPAIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKKIVTYH  439



>ref|WP_041962243.1| cell division protein FtsH [Sulfurospirillum cavolei]
Length=653

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  270  AKKEAPAIVFIDEIDAIGKSRAASGMMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  329

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR+ ILKVH    ++ L +D++L +IA +T G
Sbjct  330  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRKDILKVHVV--DIKLGKDINLEEIARLTAG  387

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR+TK  VE+ D ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  388  LAGADLANIINEAALLAGRKTKTYVEQQDLVEAVERAIAGLEKKSRRINPEEKRIVAYH  446



>ref|WP_011056378.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_681318.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC08080.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=619

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR        NDEREQTLNQLLTEMDGFD+  A VIVL AT
Sbjct  257  AKKQAPCIVFIDELDAIGKSRSSAGFYGGNDEREQTLNQLLTEMDGFDATGATVIVLAAT  316

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR + LDPAL RPGRFDR V+V+ PD +GRE+ILK+HA  K++ LA +VDL  IA+ T G
Sbjct  317  NRPETLDPALLRPGRFDRQVLVDRPDLSGREAILKIHA--KKVKLAPEVDLHAIAARTPG  374

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R  + +V + DF +A+ER +AG+EKK+  L   EK +VA H
Sbjct  375  FAGADLANLVNEAALLAARHQREMVTQQDFAEAIERIVAGLEKKSRVLNDKEKKIVAYH  433



>gb|ADV46934.1| membrane protease FtsH catalytic subunit [Nitratifractor salsuginis 
DSM 16511]
Length=696

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S++ VIVL ATN
Sbjct  271  AKKEAPSIIFIDEIDAIGKSRTAGGPMGGNDEREQTLNQLLAEMDGFGSDTPVIVLAATN  330

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPAL R GRFDR V+V+ PD  GR +ILK+H+  +++ LA DVDL ++A  T G 
Sbjct  331  RPEVLDPALLRAGRFDRQVLVDKPDFEGRLAILKIHS--RDVKLAPDVDLEEVAKATAGL  388

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGRQ K  +E+ D ++A+ER+  G+EKKN K+   EK +V+ H
Sbjct  389  AGADLANIINEAALLAGRQNKKQIEQSDLMEAIERAFVGLEKKNRKINDLEKRIVSYH  446



>ref|WP_021093258.1| Cell division protein FtsH [Campylobacter concisus]
 gb|ERJ31227.1| Cell division protein FtsH [Campylobacter concisus UNSW2]
Length=641

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPAIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKKIVTYH  439



>ref|WP_021083679.1| Cell division protein FtsH [Campylobacter concisus]
 gb|ERJ23994.1| Cell division protein FtsH [Campylobacter concisus UNSW3]
Length=641

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPAIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKKIVTYH  439



>ref|WP_021088663.1| Cell division protein FtsH [Campylobacter concisus]
 gb|ERJ29971.1| Cell division protein FtsH [Campylobacter concisus ATCC 51561]
Length=641

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPAIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKKIVTYH  439



>ref|WP_012857526.1| cell division protein FtsH [Sulfurospirillum deleyianum]
 gb|ACZ12776.1| ATP-dependent metalloprotease FtsH [Sulfurospirillum deleyianum 
DSM 6946]
Length=643

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  273  AKKEAPAIVFIDEIDAIGKSRAANGMMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  332

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR+ ILKVH++  ++ L +++DL +IA +T G
Sbjct  333  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRKDILKVHSA--DIKLDKNIDLEEIARLTAG  390

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALL GR++K  VE+ D I+AVER+IAG+EKK+ ++   EK +VA H
Sbjct  391  LAGADLANIINEAALLGGRKSKAYVEQQDLIEAVERAIAGLEKKSRRINPKEKRIVAYH  449



>ref|WP_026098162.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=649

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDE+DA+ KSR     +  NDEREQTLNQLLTEMDGFD N+ VI++ ATN
Sbjct  267  AKQQAPCIVFIDELDALGKSRGAGPLLGGNDEREQTLNQLLTEMDGFDGNTGVIIIAATN  326

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R +VLDPAL RPGRFDR V+V+ PD+ GRE+IL VHA  + + LA DVDLG +A+ T GF
Sbjct  327  RPEVLDPALLRPGRFDRRVLVDRPDKIGREAILNVHA--RNVKLAADVDLGALAARTPGF  384

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLANLVNEAAL+A R+ +  V   DF +A+ER +AG+EKK+  L   EK  VA H
Sbjct  385  AGADLANLVNEAALMAARKNQDAVRMADFNEAIERVVAGLEKKSRVLNEVEKKTVAYH  442



>ref|WP_023948357.1| cell division protein FtsH [Helicobacter fennelliae]
 dbj|GAD19169.1| cell division protein FtsH [Helicobacter fennelliae MRY12-0050]
Length=639

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  264  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  323

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA+DVDL +IA +T G
Sbjct  324  NRPEVLDPALLRPGRFDRQVLVDKPDFNGRVEILKVHI--KSVKLARDVDLEEIAKLTAG  381

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V + +  +AVER IAG+EKK  ++   EK +VA H
Sbjct  382  LAGADLANIINEAALLAGRSNQKQVSQANLKEAVERGIAGLEKKTRRISPKEKKIVAYH  440



>ref|WP_009756749.1| cell division protein FtsH [Fischerella sp. JSC-11]
 gb|EHC14988.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=656

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR--DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGA  176
            AK++AP I+FIDE+DA+ KSR   G F V  NDEREQTLNQLLTEMDGFD+N+ VI+L A
Sbjct  261  AKQQAPCIVFIDELDALGKSRAAGGPF-VGGNDEREQTLNQLLTEMDGFDANTGVIILAA  319

Query  177  TNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTT  356
            TNR +VLDPALRRPGRFDR ++V+ PD+ GR++IL+VHA  + + LA DVDL  IA+ T 
Sbjct  320  TNRPEVLDPALRRPGRFDRQIVVDRPDKIGRKAILEVHA--RRVKLASDVDLDKIAARTP  377

Query  357  GFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            GF GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  378  GFVGADLANLVNEAALLAARQNRDAVTMADFNEAIERVVAGLEKRSRVLNDLEKKTVAYH  437



>ref|WP_036001999.1| cell division protein FtsH [Leptolyngbya sp. JSC-1]
Length=605

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP IIFIDE+DA+ K+R G      NDEREQTLNQLLTEMDGFD N  VI+L ATN
Sbjct  239  AKRQAPCIIFIDELDAIGKTRGGGIPNGGNDEREQTLNQLLTEMDGFDGNEGVILLAATN  298

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R ++LDPALRRPGRFDR V+V+ PD++GR  IL+VHA  + + L +DVDL  IAS T GF
Sbjct  299  RPEILDPALRRPGRFDRQVLVDRPDKSGRAEILRVHA--QGVILGEDVDLDAIASQTAGF  356

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLANLVNEAAL+A R  +  V   DF +A+ER +AG+EK++  L   E+  VA H
Sbjct  357  AGADLANLVNEAALMAARNNRQAVLMADFKEAIERVVAGLEKRSRILTPLERQTVAYH  414



>ref|WP_013191669.1| cell division protein FtsH [Trichormus azollae]
 gb|ADI64653.1| ATP-dependent metalloprotease FtsH ['Nostoc azollae' 0708]
Length=645

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+ILKVHA  + + LA+DVDLG IA+ T G
Sbjct  322  NRPEVLDPALRRPGRFDRQIVVDRPDKIGREAILKVHA--RNVKLAEDVDLGIIATRTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R  +  V   DF +A+ER IAG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARNNRQAVLMADFNEAIERLIAGLEKRSRVLNEIEKKTVAYH  438



>ref|WP_026803284.1| cell division protein FtsH [Arcobacter sp. AF1581]
Length=688

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK AP+IIFIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S SA VIVL AT
Sbjct  280  AKKVAPAIIFIDEIDAIGKSRASGGPMGGNDEREQTLNQLLAEMDGFSSESAPVIVLAAT  339

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  IL VH   K++ LA+DVDL ++A MT G
Sbjct  340  NRPEVLDPALLRPGRFDRQVLVDKPDYEGRIEILNVHI--KDVKLAKDVDLKEVAKMTAG  397

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  VE  DF +AVER IAG+EKK+ ++   E+ +VA H
Sbjct  398  LAGADLANIINEAALLAGRASKNQVEASDFKEAVERQIAGLEKKSRRISPKERKIVAYH  456



>ref|WP_021091790.1| Cell division protein FtsH [Campylobacter concisus]
 gb|ERJ25318.1| Cell division protein FtsH [Campylobacter concisus ATCC 51562]
Length=641

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR+    +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  264  AKKEAPAIVFIDEIDAIGKSRNSG-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH   K++ + +DV++ DIA +TTG
Sbjct  323  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRCDILKVHM--KDVKIGKDVNIEDIARLTTG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N++NEAALLAGR++K  VE+ D ++AVERSIAG+EKK+ ++   EK +V  H
Sbjct  381  LAGADLENIINEAALLAGRKSKTFVEQADLVEAVERSIAGLEKKSRRVNPKEKRIVTYH  439



>ref|WP_026807393.1| MULTISPECIES: cell division protein FtsH [Arcobacter]
Length=688

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK AP+IIFIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S SA VIVL AT
Sbjct  280  AKKVAPAIIFIDEIDAIGKSRASGGPMGGNDEREQTLNQLLAEMDGFSSESAPVIVLAAT  339

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  IL VH   K++ LA+DVDL ++A MT G
Sbjct  340  NRPEVLDPALLRPGRFDRQVLVDKPDYEGRIEILNVHI--KDVKLAKDVDLKEVAKMTAG  397

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  VE  DF +AVER IAG+EKK+ ++   E+ +VA H
Sbjct  398  LAGADLANIINEAALLAGRASKNQVEASDFKEAVERQIAGLEKKSRRISPKERKIVAYH  456



>ref|WP_016872112.1| cell division protein FtsH [Fischerella thermalis]
Length=656

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR--DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGA  176
            AK++AP I+FIDE+DA+ KSR   G F V  NDEREQTLNQLLTEMDGFD+N+ VI+L A
Sbjct  261  AKQQAPCIVFIDELDALGKSRAAGGPF-VGGNDEREQTLNQLLTEMDGFDANTGVIILAA  319

Query  177  TNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTT  356
            TNR +VLDPALRRPGRFDR ++V+ PD+ GR++IL+VHA  + + LA DVDL  IA+ T 
Sbjct  320  TNRPEVLDPALRRPGRFDRQIVVDRPDKIGRKAILEVHA--RRVKLASDVDLDKIAARTP  377

Query  357  GFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            GF GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  378  GFVGADLANLVNEAALLAARQNRDAVTMADFNEAIERVVAGLEKRSRVLNDLEKKTVAYH  437



>ref|WP_024125932.1| ATP-dependent metalloprotease FtsH [Thermosynechococcus sp. NK55a]
 gb|AHB89565.1| ATP-dependent metalloprotease FtsH [Thermosynechococcus sp. NK55a]
Length=619

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR        NDEREQTLNQLLTEMDGFD+  A VIVL AT
Sbjct  257  AKKQAPCIVFIDELDAIGKSRSSAGFYGGNDEREQTLNQLLTEMDGFDATGATVIVLAAT  316

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR + LDPAL RPGRFDR V+V+ PD +GRE+ILK+HA  K++ LA +VDL  IA+ T G
Sbjct  317  NRPETLDPALLRPGRFDRQVLVDRPDLSGREAILKIHA--KKVKLAPEVDLHAIAARTPG  374

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R  + +V + DF +A+ER +AG+EKK+  L   EK +VA H
Sbjct  375  FAGADLANLVNEAALLAARNQREMVTQQDFAEAIERIVAGLEKKSRVLNDKEKKIVAYH  433



>ref|WP_015214840.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica]
 gb|AFZ58205.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica 
PCC 7122]
Length=644

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  261  AKQQAPCIVFIDELDALGKSRGGPGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+ILKVHA  + + LA+DVDLG IA+ T G
Sbjct  321  NRPEVLDPALRRPGRFDRQIVVDRPDKIGREAILKVHA--RNVKLAEDVDLGIIATRTPG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R  +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  379  FAGADLANLVNEAALLAARNNRQAVLMADFNEAIERLVAGLEKRSRVLNEIEKKTVAYH  437



>ref|WP_025345545.1| cell division protein FtsH [Sulfurospirillum multivorans]
 gb|AHJ13703.1| ATP-dependent zinc metalloprotease FtsH [Sulfurospirillum multivorans 
DSM 12446]
Length=655

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  271  AKKEAPAIVFIDEIDAIGKSRAANGMMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  330

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR+ ILKVH++  ++ L +++DL +IA +T G
Sbjct  331  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRKDILKVHSA--DIKLGKNIDLEEIARLTAG  388

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALL GR+ K  VE+ID + AVER+IAG+EKK+ ++   EK +VA H
Sbjct  389  LAGADLANIINEAALLGGRKNKDHVEQIDLVDAVERAIAGLEKKSRRINPEEKRIVAYH  447



>ref|WP_006276244.1| cell division protein FtsH [Cylindrospermopsis raciborskii]
 gb|EFA70797.1| Peptidase M41, FtsH [Cylindrospermopsis raciborskii CS-505]
Length=645

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDG-RFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G    V  NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRGGASGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+ILKVHA  + + LA+DV+L  IA+ T G
Sbjct  322  NRPEVLDPALRRPGRFDRQIVVDRPDKIGREAILKVHA--RNVKLAEDVNLEIIATRTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R  +  V   DF +A+ER IAG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARNNRQAVLMADFNEAIERLIAGLEKRSRVLNELEKKTVAYH  438



>ref|WP_022176679.1| aTP-dependent zinc metalloprotease FtsH 1 [Oscillibacter sp. 
CAG:241]
 emb|CDB26068.1| aTP-dependent zinc metalloprotease FtsH 1 [Oscillibacter sp. 
CAG:241]
Length=462

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDEIDA+ + R G  +   NDEREQTLNQLLTEMDGFD NS VI+L ATN
Sbjct  111  AKEKAPCIVFIDEIDAIGQKRSGG-QYGGNDEREQTLNQLLTEMDGFDDNSGVIILAATN  169

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LDPAL RPGRFDR V VE PD  GRE ILKVHA  K++ LA++VD G +A M +G 
Sbjct  170  RPESLDPALTRPGRFDRRVPVELPDLKGREEILKVHA--KKIKLAENVDFGTVARMASGA  227

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            +GA+LAN+VNEAAL A R  + LV + D  +++E  IAG +KKNA L   EK +V+ H
Sbjct  228  SGAELANIVNEAALRAVRDGRRLVTQADLEESIETVIAGYQKKNAILTDKEKWIVSYH  285



>ref|WP_034370032.1| cell division protein FtsH [Helicobacter sp. MIT 05-5293]
 gb|KGL08199.1| cell division protein FtsH [Helicobacter sp. MIT 05-5293]
Length=633

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK+APSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF S SA VIVL AT
Sbjct  260  AKKDAPSIIFIDEIDAIGKSRAAGSMVGGNDEREQTLNQLLAEMDGFGSESAPVIVLAAT  319

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+APD  GR  ILKVH   K + LA+DVDL +IA  T G
Sbjct  320  NRPEVLDPALLRPGRFDRQVLVDAPDFNGRVEILKVHI--KNVNLARDVDLHEIAKFTAG  377

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR+ K  V +  F +A+ER++ G+EKK  ++   EK +VA H
Sbjct  378  LAGADLANIINEAALLAGRENKKEVSQKHFKEAMERTMIGLEKKTRRIPPKEKKIVAYH  436



>ref|WP_041960193.1| cell division protein FtsH [Sulfurospirillum arsenophilum]
Length=654

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  270  AKKEAPAIVFIDEIDAIGKSRAANGMMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  329

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR+ ILKVH++  ++ L +++DL +IA +T G
Sbjct  330  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRKDILKVHSA--DIKLGKNIDLEEIARLTAG  387

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALL GR+ K  VE+ID + AVER+IAG+EKK+ ++   EK +VA H
Sbjct  388  LAGADLANIINEAALLGGRKNKDHVEQIDLVDAVERAIAGLEKKSRRINPAEKRIVAYH  446



>ref|WP_026731936.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=650

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR-DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK +AP I+FIDE+DA+ KSR +    +  NDEREQTLNQLL+EMDGF++N+ VI+L AT
Sbjct  265  AKHQAPCIVFIDELDALGKSRGNASLHLGGNDEREQTLNQLLSEMDGFNANTGVILLAAT  324

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+ILK+HA  K + LA DVDL  +A+ T G
Sbjct  325  NRPEVLDPALRRPGRFDRQIVVDRPDKIGREAILKIHA--KNVKLAPDVDLSKLAARTPG  382

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R+    V   DF +A+ER + G+EKK+  L  +EK  VA H
Sbjct  383  FAGADLANLVNEAALLAARRNNETVTMADFQEAIERVLTGLEKKSRVLNESEKKTVAYH  441



>ref|WP_016870296.1| cell division protein FtsH [Fischerella muscicola]
Length=656

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR--DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGA  176
            AK++AP I+FIDE+DA+ KSR   G F V  NDEREQTLNQLLTEMDGFD+N+ VI+L A
Sbjct  261  AKQQAPCIVFIDELDALGKSRAAGGPF-VGGNDEREQTLNQLLTEMDGFDANTGVIILAA  319

Query  177  TNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTT  356
            TNR +VLDPALRRPGRFDR + V+ PD+ GR++IL+VHA  + + LA DVDL  IA+ T 
Sbjct  320  TNRPEVLDPALRRPGRFDRQIAVDRPDKIGRKAILEVHA--RRVKLAADVDLDKIAARTP  377

Query  357  GFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            GF GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  378  GFVGADLANLVNEAALLAARQNRDAVTMADFNEAIERVVAGLEKRSRVLNDLEKKTVAYH  437



>ref|WP_034561122.1| cell division protein FtsH [Helicobacter macacae]
Length=625

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  250  AKKEAPSIIFIDEIDAIGKSRAAGGMVGGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  309

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD +GR  ILKVH   K + L++DVDL +IA +T G
Sbjct  310  NRPEVLDPALLRPGRFDRQVLVDKPDFSGRLEILKVHI--KAVKLSRDVDLEEIAKLTAG  367

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V + +  +AVER IAG+EKK+ ++   EK +VA H
Sbjct  368  LAGADLANIINEAALLAGRNNQKEVSQSNLKEAVERGIAGLEKKSRRISPKEKKIVAYH  426



>ref|WP_022188277.1| aTP-dependent zinc metalloprotease FtsH 3 [Ruminococcus sp. CAG:177]
 emb|CDB42183.1| aTP-dependent zinc metalloprotease FtsH 3 [Ruminococcus sp. CAG:177]
Length=609

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDEIDA+ K RDG+F  +SNDEREQTLNQLLTEMDGF  N  VI+L ATN
Sbjct  254  AKEKAPCIVFIDEIDAIGKKRDGQF--SSNDEREQTLNQLLTEMDGFQENIGVIILAATN  311

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LDPAL RPGRFDR V VE PD  GRE+ILKVHA  K++  A DV+   IA M +G 
Sbjct  312  RPETLDPALTRPGRFDRRVPVELPDLAGREAILKVHA--KKIKTADDVNFHTIARMASGA  369

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            +GA+LAN++NEAAL A R  + +V + D  +++E  IAG +KKNA L  +EK VVA H
Sbjct  370  SGAELANIINEAALRAVRNNRTVVNESDLEESIETVIAGYQKKNAVLSDSEKKVVAYH  427



>ref|WP_010474225.1| ATP-dependent metalloprotease FtsH-like protein, partial [Acaryochloris 
sp. CCMEE 5410]
Length=232

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR-DGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGA  176
            AKK+AP IIFIDE+DA+ KSR  G   V  NDEREQTLNQLLTEMDGF +  A VIVL A
Sbjct  45   AKKKAPCIIFIDELDAIGKSRAGGNGFVGGNDEREQTLNQLLTEMDGFGAGDATVIVLAA  104

Query  177  TNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTT  356
            TNR + LDPAL RPGRFDR V+V+ PD TGR +IL+++A  K++ L ++VDL  +A+ T 
Sbjct  105  TNRPETLDPALLRPGRFDRQVLVDRPDLTGRLAILEIYA--KKVKLGENVDLKAMATRTP  162

Query  357  GFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            GF GADLANLVNEAALLA R+   +VE  DF +A+ER +AG+EKK+  L   EK +VA H
Sbjct  163  GFAGADLANLVNEAALLAARRGSKVVETQDFAEAIERVVAGLEKKSRVLNDKEKKIVAYH  222



>gb|ETD24210.1| ATP-dependent zinc metalloprotease FtsH [Helicobacter macacae 
MIT 99-5501]
Length=646

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  271  AKKEAPSIIFIDEIDAIGKSRAAGGMVGGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  330

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD +GR  ILKVH   K + L++DVDL +IA +T G
Sbjct  331  NRPEVLDPALLRPGRFDRQVLVDKPDFSGRLEILKVHI--KAVKLSRDVDLEEIAKLTAG  388

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V + +  +AVER IAG+EKK+ ++   EK +VA H
Sbjct  389  LAGADLANIINEAALLAGRNNQKEVSQSNLKEAVERGIAGLEKKSRRISPKEKKIVAYH  447



>ref|WP_038454863.1| cell division protein FtsH [Campylobacter iguaniorum]
 gb|AII15183.1| integral membrane ATP-dependent zinc metallopeptidase [Campylobacter 
iguaniorum]
Length=642

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  260  AKKEAPAIVFIDEIDAIGKSRSAGAMMGGNDEREQTLNQLLAEMDGFDSDKSPVIVLAAT  319

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  IL VH+  KE+ LA++VD+ +I  +T G
Sbjct  320  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRVEILNVHS--KEVKLAKNVDMDEIGRLTAG  377

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  +E+ D ++AVER+IAG+EKK+ ++   EK +V  H
Sbjct  378  LAGADLANIINEAALLAGRASKSNIEQQDLVEAVERAIAGLEKKSRRINPKEKKIVTYH  436



>ref|WP_034418645.1| cell division protein FtsH [Candidatus Entotheonella sp. TSY1]
 gb|ETW98729.1| cell division protein FtsH [Candidatus Entotheonella sp. TSY1]
Length=644

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRV-ASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ K+R G   V   NDEREQTLNQLLTEMDGF++N+ V++L AT
Sbjct  268  AKQKAPCIVFIDELDAIGKTRGGTGPVQGGNDEREQTLNQLLTEMDGFEANAGVVILSAT  327

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+++ PD+ GRE+IL+VH   K++ LA DVD G +A  T+G
Sbjct  328  NRPEVLDPALRRPGRFDRQVVIDRPDKMGREAILRVHV--KKVKLADDVDFGAMAGFTSG  385

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F+GADLANLVNEAALLA R+ +  V   +F +A ER +AG+E+K   L   EK +VA H
Sbjct  386  FSGADLANLVNEAALLAARREQNEVSMAEFNEAFERVVAGLERKTRVLNPEEKQIVAYH  444



>ref|WP_037959274.1| cell division protein FtsH [Sulfurospirillum sp. SCADC]
 gb|KFL34054.1| cell division protein FtsH [Sulfurospirillum sp. SCADC]
Length=655

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  271  AKKEAPAIVFIDEIDAIGKSRAANGMMGGNDEREQTLNQLLAEMDGFSSDKSPVIVLAAT  330

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH++  ++ L ++++L +IA +T G
Sbjct  331  NRPEVLDAALLRPGRFDRQVLVDKPDFQGRRDILKVHSA--DIKLDKNINLEEIARLTAG  388

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALL GR+ K  VE+ID ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  389  LAGADLANIINEAALLGGRKKKEYVEQIDLVEAVERAIAGLEKKSRRINPEEKRIVAYH  447



>ref|WP_021998469.1| aTP-dependent zinc metalloprotease FtsH 2 [Ruminococcus sp. CAG:724]
 emb|CCZ20225.1| aTP-dependent zinc metalloprotease FtsH 2 [Ruminococcus sp. CAG:724]
Length=609

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDEIDA+ K RDG+F    NDEREQTLNQLLTEMDGFD N+ VI+L ATN
Sbjct  253  AKEKAPCIVFIDEIDAIGKKRDGQF--GGNDEREQTLNQLLTEMDGFDGNNGVIILAATN  310

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LDPAL RPGRFDR V VE PD  GRE+ILKVHA  K++  A +VD   IA M +G 
Sbjct  311  RPESLDPALTRPGRFDRRVPVELPDLAGREAILKVHA--KKIKTAPNVDFHAIARMASGT  368

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            +GA+LAN++NEAAL A R  + +VE+ D  +++E  IAG +KKNA +   EK VVA H
Sbjct  369  SGAELANIINEAALRAVRSGRSVVEQADLEESIEVVIAGYQKKNAIMTDAEKKVVAYH  426



>ref|WP_035989179.1| cell division protein FtsH, partial [Leptolyngbya sp. KIOST-1]
Length=581

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDE+DAV K+R G      NDEREQTLNQLLTEMDGFD N  VIV+ ATN
Sbjct  218  AKRQAPCIVFIDELDAVGKTRGGNPN-GGNDEREQTLNQLLTEMDGFDGNDGVIVIAATN  276

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LDPALRRPGRFDR V+V+ PDR+GR  IL+VH   + + L +DV+L DIA+ T GF
Sbjct  277  RPETLDPALRRPGRFDRQVLVDRPDRSGRLEILQVHG--RGVALGEDVNLADIAAQTAGF  334

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLANLVNEAAL+A R  +  V   DF +A+ER IAG+EK++  L   E+  VA H
Sbjct  335  AGADLANLVNEAALMAARNHRKAVLMADFGEAIERVIAGLEKRSRVLTATERQTVAYH  392



>ref|WP_002957163.1| cell division protein FtsH [Helicobacter cinaedi]
 gb|EFR47278.1| cell division protease FtsH [Helicobacter cinaedi CCUG 18818]
 dbj|BAM11654.1| cell division protease FtsH [Helicobacter cinaedi PAGU611]
 dbj|BAM31608.1| cell division protease [Helicobacter cinaedi ATCC BAA-847]
Length=631

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK+APSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF S SA VIVL AT
Sbjct  259  AKKDAPSIIFIDEIDAIGKSRAAGSMVGGNDEREQTLNQLLAEMDGFGSESAPVIVLAAT  318

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA+DVDL +IA  T G
Sbjct  319  NRPEILDPALLRPGRFDRQVLVDKPDFEGRLEILKVHI--KNVSLARDVDLHEIAKFTAG  376

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR+ K  V +    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  377  LAGADLANIINEAALLAGRENKKEVSQKHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  435



>ref|WP_022221351.1| aTP-dependent zinc metalloprotease FtsH 2 [Firmicutes bacterium 
CAG:170]
 emb|CDB87898.1| aTP-dependent zinc metalloprotease FtsH 2 [Firmicutes bacterium 
CAG:170]
Length=609

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 135/178 (76%), Gaps = 4/178 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDEIDA+ K RD +F  ++NDEREQTLNQLLTEMDGFDSN+ VI+L ATN
Sbjct  253  AKEKAPCIVFIDEIDAIGKKRDNQF--SNNDEREQTLNQLLTEMDGFDSNNGVIILAATN  310

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LDPAL RPGRFDR V VE PD  GRE+ILKVHA  K++  A +VD   IA M +G 
Sbjct  311  RPESLDPALTRPGRFDRRVPVELPDLKGREAILKVHA--KKIKAADNVDYHVIARMASGA  368

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            +GA+LAN++NEAAL A R  + +VE+ D  +++E  IAG +KKNA +  +EK VVA H
Sbjct  369  SGAELANIINEAALRAVRSGRSVVEQADLEESIEVVIAGYQKKNAVMTDHEKHVVAYH  426



>ref|WP_023385675.1| integral membrane ATP-dependent zinc metallopeptidase [Campylobacter 
fetus]
 gb|AGZ82159.1| integral membrane ATP-dependent zinc metallopeptidase [Campylobacter 
fetus subsp. testudinum 03-427]
Length=643

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  261  AKKEAPAIVFIDEIDAIGKSRAAGAMMGGNDEREQTLNQLLAEMDGFDSDKSPVIVLAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH+  KE+ LA +V++ +I  +T G
Sbjct  321  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRVDILKVHS--KEVKLANNVNMDEIGRLTAG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  +E+ D ++AVER+IAG+EKK+ ++   EK +V  H
Sbjct  379  LAGADLANIINEAALLAGRASKEYIEQQDLVEAVERAIAGLEKKSRRINPKEKKIVTYH  437



>ref|WP_013022576.1| cell division protein FtsH [Helicobacter mustelae]
 emb|CBG39481.1| membrane bound zinc metallopeptidase [Helicobacter mustelae 12198]
Length=631

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPS+IFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  259  AKKEAPSMIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  318

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA+DVDL +IA +T G
Sbjct  319  NRPEVLDPALLRPGRFDRQVLVDKPDFNGRIEILKVHI--KSVKLAKDVDLQEIAKLTAG  376

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V + +  +AVER IAG+EKK+ ++   EK +VA H
Sbjct  377  LAGADLANIINEAALLAGRANQKEVSQKNLKEAVERGIAGLEKKSRRISPQEKKIVAYH  435



>ref|WP_039362711.1| cell division protein FtsH [Campylobacter fetus]
 gb|AJB45887.1| cell division protein FtsH [Campylobacter fetus subsp. testudinum]
Length=643

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGFDS+ S VIVL AT
Sbjct  261  AKKEAPAIVFIDEIDAIGKSRAAGAMMGGNDEREQTLNQLLAEMDGFDSDKSPVIVLAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  ILKVH+  KE+ LA +V++ +I  +T G
Sbjct  321  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRVDILKVHS--KEVKLANNVNMDEIGRLTAG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR +K  +E+ D ++AVER+IAG+EKK+ ++   EK +V  H
Sbjct  379  LAGADLANIINEAALLAGRASKEYIEQQDLVEAVERAIAGLEKKSRRINPKEKKIVTYH  437



>ref|WP_006017260.1| Cell division protein FtsH [Helicobacter bizzozeronii]
 emb|CCF80647.1| Cell division protein FtsH [Helicobacter bizzozeronii CCUG 35545]
Length=638

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  264  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  323

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA DVDL +IA +T G
Sbjct  324  NRPEILDPALLRPGRFDRQVLVDKPDFNGRVEILKVHI--KPVKLANDVDLQEIAKLTAG  381

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V++    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  382  LAGADLANIINEAALLAGRNNQKEVKQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  440



>ref|WP_035157439.1| cell division protein FtsH [Calothrix sp. 336/3]
 gb|KFB85762.1| cell division protein FtsH [Calothrix sp. 336/3]
Length=646

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSR--DGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGA  176
            AK++AP I+FIDE+DA+ KSR   G F    NDEREQTLNQLLTEMDGFD+N+ VI++ A
Sbjct  263  AKQQAPCIVFIDELDALGKSRAGSGGF-YGGNDEREQTLNQLLTEMDGFDANTGVIIIAA  321

Query  177  TNRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTT  356
            TNR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + L  DVDL  I + T 
Sbjct  322  TNRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLDTDVDLAVIGARTP  379

Query  357  GFTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            GF GADLANLVNEAAL+A R  +  V+  DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  GFAGADLANLVNEAALMAARNNRTAVKMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  439



>gb|AFY47588.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
Length=635

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRF-RVASNDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G    + SNDEREQTLNQLL+EMDGF+ N+ VI+L AT
Sbjct  264  AKQQAPCIVFIDELDALGKSRAGSGPMIGSNDEREQTLNQLLSEMDGFNPNTGVILLAAT  323

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR +MV+ PD++GRE+ILK+HA  +++ L  +VDL  +A+ T G
Sbjct  324  NRPEVLDPALRRPGRFDRQIMVDRPDKSGREAILKIHA--QQVKLGDNVDLSKLAARTPG  381

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R+    V   DF +A+ER + G+EKK+  L   EK  VA H
Sbjct  382  FAGADLANLVNEAALLAARRNHETVVMADFHEAIERVLTGLEKKSRVLNDTEKKTVAYH  440



>ref|WP_013890273.1| cell division protein FtsH [Helicobacter bizzozeronii]
 emb|CCB79814.1| cell division protein FtsH [Helicobacter bizzozeronii CIII-1]
Length=638

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  264  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  323

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA DVDL +IA +T G
Sbjct  324  NRPEILDPALLRPGRFDRQVLVDKPDFNGRVEILKVHI--KPVKLANDVDLQEIAKLTAG  381

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V++    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  382  LAGADLANIINEAALLAGRNNQKEVKQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  440



>ref|WP_025803181.1| cell division protein FtsH [Campylobacter sp. CIT045]
Length=647

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 4/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAPSI+FIDEIDA+ KSR     +  NDEREQTLNQLL+EMDGFD++ S VIV+ AT
Sbjct  266  AKKEAPSIVFIDEIDAIGKSRSSS-PMGGNDEREQTLNQLLSEMDGFDADKSPVIVMAAT  324

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LD AL RPGRFDR V+V+ PD  GR  ILK+H   K++  A D+D+ +IA +TTG
Sbjct  325  NRPEILDAALLRPGRFDRQVLVDKPDFKGRMDILKIHM--KDVKFADDIDIEEIARLTTG  382

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADL N+VNEAALLAGR++K  V + D ++AVERSIAG+EKK+ ++   EK +VA H
Sbjct  383  LAGADLENVVNEAALLAGRESKKAVTQADMVEAVERSIAGLEKKSRRVNPKEKRIVAYH  441



>ref|WP_016950143.1| cell division protein FtsH [Anabaena sp. PCC 7108]
Length=645

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G    A  NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKQQAPCIVFIDELDALGKSRGGPGGFAGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+ILKVHA  + + LA+DVDLG IA  T G
Sbjct  322  NRPEVLDPALRRPGRFDRQIVVDRPDKIGREAILKVHA--RNVKLAEDVDLGIIAVRTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R  +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARNNRQAVLMADFNEAIERLVAGLEKRSRVLNEIEKKTVAYH  438



>gb|EEC55736.1| ATP-dependent metallopeptidase HflB [[Bacteroides] pectinophilus 
ATCC 43243]
Length=476

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDEIDA+ K RDG+  +  NDEREQTLNQLLTEMDGF+ N+ VI+L ATN
Sbjct  125  AKEKAPCIVFIDEIDAIGKKRDGQ--MGGNDEREQTLNQLLTEMDGFEGNNGVIILAATN  182

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LDPAL RPGRFDR V VE PD  GRE+ILKVHA  K++  + DVDL  IA M +G 
Sbjct  183  RPESLDPALTRPGRFDRRVPVELPDLAGREAILKVHA--KKIKASDDVDLHTIARMASGA  240

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            +GA+LAN++NEAAL A R  + +V + D  +++E  IAG +KKNA L   EK VVA H
Sbjct  241  SGAELANIINEAALRAVRSGRTVVNESDLEESIEVVIAGYQKKNAVLSDQEKKVVAYH  298



>emb|CCM11394.1| Cell division protein FtsH [Helicobacter heilmannii ASB1.4]
Length=637

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  263  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA DVDL +IA +T G
Sbjct  323  NRPEILDPALLRPGRFDRQVLVDKPDFNGRVEILKVHI--KPVKLANDVDLQEIAKLTAG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V++    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  381  LAGADLANIINEAALLAGRNNQKEVKQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  439



>ref|WP_039741395.1| cell division protein FtsH [Hassallia byssoidea]
 gb|KIF36338.1| cell division protein FtsH [Hassallia byssoidea VB512170]
Length=644

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  261  AKKQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  320

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+IL VHA  + + LA+DV+L  IA  T G
Sbjct  321  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILNVHA--RNVKLAEDVNLATIAIRTPG  378

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER IAG+EK++  L   EK  VA H
Sbjct  379  FAGADLANLVNEAALLAARQNREAVIMADFNEAIERLIAGLEKRSRVLNETEKKTVAYH  437



>ref|WP_013469705.1| cell division protein FtsH [Helicobacter felis]
 sp|O32617.1|FTSH_HELFC RecName: Full=ATP-dependent zinc metalloprotease FtsH [Helicobacter 
felis ATCC 49179]
 emb|CAA05102.1| cell cycle protein [Helicobacter felis ATCC 49179]
 emb|CBY83341.1| membrane bound zinc metallopeptidase [Helicobacter felis ATCC 
49179]
Length=638

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  264  AKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  323

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA DVDL +IA +T G
Sbjct  324  NRPEILDPALLRPGRFDRQVLVDKPDFKGRVEILKVHI--KPVKLANDVDLQEIAKLTAG  381

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V++    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  382  LAGADLANIINEAALLAGRNNQKEVKQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  440



>gb|KIJ83876.1| cell division protein FtsH [Scytonema tolypothrichoides VB-61278]
Length=646

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AK++AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  263  AKQQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  322

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR V+V+ PD+ GRE+ILKVHA  + + LA+DV+L  IA  T G
Sbjct  323  NRPEVLDPALRRPGRFDRQVVVDRPDKIGREAILKVHA--RNVKLAEDVNLATIAIRTPG  380

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER +AG+EK++  L   EK  VA H
Sbjct  381  FAGADLANLVNEAALLAARQNREAVIMADFNEAIERVVAGLEKRSRVLNETEKKTVAYH  439



>ref|WP_014660828.1| cell division protein FtsH [Helicobacter cetorum]
 gb|AFI03957.1| cell division protein [Helicobacter cetorum MIT 00-7128]
Length=633

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     V+ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  259  AKKEAPSIIFIDEIDAIGKSRAAGGMVSGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  318

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA DVDL ++A +T G
Sbjct  319  NRPEILDPALLRPGRFDRQVLVDKPDFNGRVEILKVHI--KGVKLANDVDLQEVAKLTAG  376

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN+VNEAALLAGR  +  V++    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  377  LAGADLANIVNEAALLAGRNNQKEVKQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  435



>ref|WP_012083718.1| cell division protein FtsH [Sulfurovum sp. NBC37-1]
 sp|A6QBN8.1|FTSH_SULNB RecName: Full=ATP-dependent zinc metalloprotease FtsH [Sulfurovum 
sp. NBC37-1]
 dbj|BAF72897.1| cell division protein FtsH [Sulfurovum sp. NBC37-1]
Length=671

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AKKEAPSIIFIDEIDA+ KSR    ++  NDEREQTLNQLL EMDGF +++ VIVL ATN
Sbjct  272  AKKEAPSIIFIDEIDAIGKSRASGGQMGGNDEREQTLNQLLAEMDGFGTDTPVIVLAATN  331

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LD AL R GRFDR V+V+ PD  GR +ILKVH+  K++ LA +VDL  +A  T G 
Sbjct  332  RPETLDAALLRAGRFDRQVLVDKPDFEGRLAILKVHS--KDVKLAPNVDLEIVAKQTAGL  389

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
             GADLAN++NEAALLAGRQ K  +E+ D ++A+ERS  G+EKKN K+   EK +VA H
Sbjct  390  AGADLANIINEAALLAGRQNKKQIEQSDLLEAIERSFVGLEKKNRKINETEKKIVAYH  447



>ref|WP_027326950.1| cell division protein FtsH [Helicobacter pametensis]
Length=632

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     V+ NDEREQTLNQLL EMDGF S SA VIVL AT
Sbjct  258  AKKEAPSIIFIDEIDAIGKSRAAGGIVSGNDEREQTLNQLLAEMDGFGSESAPVIVLAAT  317

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  IL+VH   K +  ++DVDL +IA MT G
Sbjct  318  NRPEILDPALLRPGRFDRQVLVDKPDYKGRLDILRVHI--KGIKPSRDVDLQEIAKMTAG  375

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  K  V   D  +AVER IAG+EKK+ ++   EK +VA H
Sbjct  376  LAGADLANIINEAALLAGRANKKEVTHADLKEAVERGIAGLEKKSRRISKKEKKIVAYH  434



>ref|WP_034375414.1| cell division protein FtsH [Helicobacter suis]
Length=636

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDS-NSAVIVLGAT  179
            AKKEAPSIIFIDEIDA+ KSR     ++ NDEREQTLNQLL EMDGF S N+ VIVL AT
Sbjct  262  AKKEAPSIIFIDEIDAIGKSRAAGGVISGNDEREQTLNQLLAEMDGFGSENAPVIVLAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA DVDL +IA +T G
Sbjct  322  NRPEILDPALLRPGRFDRQVLVDKPDFNGRVEILKVHI--KPVKLANDVDLQEIAKLTAG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR  +  V++    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  380  LAGADLANIINEAALLAGRNNQKEVKQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  438



>ref|WP_002951763.1| cell division protein FtsH, partial [Campylobacter showae]
 gb|EMG30834.1| cell division protein FtsH, partial [Campylobacter showae CC57C]
Length=455

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSN-SAVIVLGAT  179
            AKKEAP+I+FIDEIDA+ KSR     +  NDEREQTLNQLL EMDGF S+ S VIVL AT
Sbjct  79   AKKEAPAIVFIDEIDAIGKSRAASGMIGGNDEREQTLNQLLAEMDGFSSDASPVIVLAAT  138

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLD AL RPGRFDR V+V+ PD  GR  IL+VH   K++ L   V + DIA MT G
Sbjct  139  NRPEVLDAALLRPGRFDRQVLVDKPDFKGRIEILRVHM--KDIKLDHSVSIEDIARMTAG  196

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR+ K  VE+ D ++AVER+IAG+EKK+ ++   EK +VA H
Sbjct  197  LAGADLANIINEAALLAGRKEKGKVEQADLLEAVERAIAGLEKKSRRINPKEKRIVAYH  255



>ref|WP_029636553.1| cell division protein FtsH [[Scytonema hofmanni] UTEX B 1581]
Length=645

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVAS-NDEREQTLNQLLTEMDGFDSNSAVIVLGAT  179
            AKK+AP I+FIDE+DA+ KSR G       NDEREQTLNQLLTEMDGFD+N+ VI++ AT
Sbjct  262  AKKQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTLNQLLTEMDGFDANTGVIIIAAT  321

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR +VLDPALRRPGRFDR ++V+ PD+ GRE+IL VHA  + + LA+DV+L  IA  T G
Sbjct  322  NRPEVLDPALRRPGRFDRQIVVDRPDKIGREAILNVHA--RNVKLAEDVNLATIAIRTPG  379

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA RQ +  V   DF +A+ER IAG+EK++  L   EK  VA H
Sbjct  380  FAGADLANLVNEAALLAARQNREAVVMADFNEAIERLIAGLEKRSRVLNETEKKTVAYH  438



>ref|WP_022080378.1| aTP-dependent zinc metalloprotease FtsH 2 [Ruminococcus sp. CAG:488]
 emb|CDA19706.1| aTP-dependent zinc metalloprotease FtsH 2 [Ruminococcus sp. CAG:488]
Length=609

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSAVIVLGATN  182
            AK++AP I+FIDEIDA+ K RDG+  +  NDEREQTLNQLLTEMDGFD N+ VI+L ATN
Sbjct  253  AKEKAPCIVFIDEIDAIGKKRDGQ--IGGNDEREQTLNQLLTEMDGFDGNNGVIILAATN  310

Query  183  RSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTGF  362
            R + LDPAL RPGRFDR V VE PD  GRE+ILKVHA  K++  A +VD   IA M +G 
Sbjct  311  RPESLDPALTRPGRFDRRVPVELPDLAGREAILKVHA--KKIKTADNVDFHTIARMASGT  368

Query  363  TGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            +GA+LAN++NEAAL A R  + +VE+ D  +++E  IAG +KKNA +   EK +VA H
Sbjct  369  SGAELANIINEAALRAVRNGRTVVEQADLEESIEVVIAGYQKKNAIMTDEEKKIVAYH  426



>gb|AAP77419.1| membrane bound zinc metallopeptidase [Helicobacter hepaticus 
ATCC 51449]
Length=611

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 132/179 (74%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFDSNSA-VIVLGAT  179
            AKK+APSIIFIDEIDA+ KSR     V  NDEREQTLNQLL EMDGF S SA VIVL AT
Sbjct  238  AKKDAPSIIFIDEIDAIGKSRAAGSMVGGNDEREQTLNQLLAEMDGFGSESAPVIVLAAT  297

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR ++LDPAL RPGRFDR V+V+ PD  GR  ILKVH   K + LA+DVDL +IA  T G
Sbjct  298  NRPEILDPALLRPGRFDRQVLVDKPDFEGRLEILKVHI--KNVSLARDVDLHEIAKFTAG  355

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
              GADLAN++NEAALLAGR+ +  V +    +AVER IAG+EKK+ ++   EK +VA H
Sbjct  356  LAGADLANIINEAALLAGRENQKEVSQKHLKEAVERGIAGLEKKSRRISPKEKKIVAYH  414



>ref|WP_026072804.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=622

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 134/179 (75%), Gaps = 3/179 (2%)
 Frame = +3

Query  3    AKKEAPSIIFIDEIDAVAKSRDGRFRVASNDEREQTLNQLLTEMDGFD-SNSAVIVLGAT  179
            AKK++P IIFIDE+DA+ KSR        NDEREQTLNQLLTEMDGFD S++ VIVL AT
Sbjct  257  AKKQSPCIIFIDELDAIGKSRSSNGFYGGNDEREQTLNQLLTEMDGFDASDTTVIVLAAT  316

Query  180  NRSDVLDPALRRPGRFDRVVMVEAPDRTGRESILKVHASKKELPLAQDVDLGDIASMTTG  359
            NR + LDPAL RPGRFDR V+V+ PD  GRE+ILK+HA  K++ LA  VDL   A+ T G
Sbjct  317  NRPETLDPALLRPGRFDRQVLVDRPDVKGREAILKIHA--KDVKLADTVDLRQTATRTPG  374

Query  360  FTGadlanlvneaallaGRQTKLLVEKIDFIQAVERSIAGIEKKNAKLQGNEKAVVARH  536
            F GADLANLVNEAALLA R+   +VE+ DF +A+ER +AG+EKK+  L   EK +VA H
Sbjct  375  FAGADLANLVNEAALLAARRNSTVVEQEDFGEAIERVVAGLEKKSRVLNDKEKKIVAYH  433



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800