BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015G07 481 bp,

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAL43558.1|  type-A response regulator                              160   9e-47   Petunia x hybrida [garden petunia]
ref|XP_010322123.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    158   9e-46   Solanum lycopersicum
gb|KEH35531.1|  two-component response regulator ARR3-like protein      157   2e-45   Medicago truncatula
ref|XP_006357298.1|  PREDICTED: two-component response regulator ...    157   2e-45   Solanum tuberosum [potatoes]
ref|XP_004240845.1|  PREDICTED: two-component response regulator ...    157   2e-45   Solanum lycopersicum
ref|XP_006358744.1|  PREDICTED: two-component response regulator ...    155   5e-45   Solanum tuberosum [potatoes]
ref|XP_011001387.1|  PREDICTED: two-component response regulator ...    154   2e-44   Populus euphratica
ref|XP_002325489.1|  hypothetical protein POPTR_0019s08690g             154   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009768329.1|  PREDICTED: two-component response regulator ...    154   2e-44   Nicotiana sylvestris
gb|KDP21642.1|  hypothetical protein JCGZ_03313                         154   2e-44   Jatropha curcas
gb|EYU35194.1|  hypothetical protein MIMGU_mgv1a015731mg                154   2e-44   Erythranthe guttata [common monkey flower]
gb|KHG06264.1|  Two-component response regulator ARR17 -like protein    154   3e-44   Gossypium arboreum [tree cotton]
emb|CBX43990.1|  putative A-type response regulator 8                   153   5e-44   Populus x canadensis [Canadian poplar]
ref|XP_002520876.1|  two-component system sensor histidine kinase...    153   7e-44   Ricinus communis
dbj|BAM74646.1|  type-A response regulator                              152   8e-44   Torenia fournieri [bluewings]
ref|XP_009590654.1|  PREDICTED: two-component response regulator ...    153   8e-44   Nicotiana tomentosiformis
emb|CBI25350.3|  unnamed protein product                                152   9e-44   Vitis vinifera
ref|XP_002280746.1|  PREDICTED: two-component response regulator ...    152   9e-44   Vitis vinifera
gb|KJB60209.1|  hypothetical protein B456_009G294000                    152   1e-43   Gossypium raimondii
ref|XP_009623473.1|  PREDICTED: two-component response regulator ...    152   2e-43   Nicotiana tomentosiformis
ref|XP_009774749.1|  PREDICTED: two-component response regulator ...    152   2e-43   Nicotiana sylvestris
ref|XP_010103657.1|  Two-component response regulator                   151   5e-43   Morus notabilis
ref|XP_010427458.1|  PREDICTED: two-component response regulator ...    150   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_007136418.1|  hypothetical protein PHAVU_009G043400g             150   5e-43   Phaseolus vulgaris [French bean]
ref|XP_010507480.1|  PREDICTED: two-component response regulator ...    150   9e-43   Camelina sativa [gold-of-pleasure]
ref|NP_567037.1|  two-component response regulator ARR17                150   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010322112.1|  PREDICTED: two-component response regulator ...    149   1e-42   Solanum lycopersicum
ref|XP_011084814.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    149   2e-42   Sesamum indicum [beniseed]
ref|XP_008233888.1|  PREDICTED: two-component response regulator ...    149   3e-42   Prunus mume [ume]
ref|XP_010658172.1|  PREDICTED: two-component response regulator ...    148   5e-42   Vitis vinifera
ref|XP_009362787.1|  PREDICTED: two-component response regulator ...    148   6e-42   Pyrus x bretschneideri [bai li]
ref|XP_008388361.1|  PREDICTED: two-component response regulator ...    148   6e-42   Malus domestica [apple tree]
ref|XP_009349081.1|  PREDICTED: two-component response regulator ...    148   6e-42   Pyrus x bretschneideri [bai li]
ref|XP_007219229.1|  hypothetical protein PRUPE_ppa017797mg             148   8e-42   Prunus persica
ref|XP_006292820.1|  hypothetical protein CARUB_v10019069mg             147   9e-42   Capsella rubella
ref|XP_002879884.1|  hypothetical protein ARALYDRAFT_483126             147   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_009363791.1|  PREDICTED: two-component response regulator ...    147   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010427456.1|  PREDICTED: two-component response regulator ...    146   3e-41   Camelina sativa [gold-of-pleasure]
emb|CAB88041.1|  response regulator-like protein                        145   3e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CAN60564.1|  hypothetical protein VITISV_013996                     146   3e-41   Vitis vinifera
ref|XP_009768330.1|  PREDICTED: two-component response regulator ...    145   3e-41   Nicotiana sylvestris
ref|XP_002876364.1|  predicted protein                                  146   4e-41   Arabidopsis lyrata subsp. lyrata
ref|NP_001236551.1|  uncharacterized protein LOC100499827               145   4e-41   Glycine max [soybeans]
ref|XP_010525415.1|  PREDICTED: two-component response regulator ...    145   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_007011279.1|  Two-component response regulator ARR17             148   5e-41   Theobroma cacao [chocolate]
ref|XP_011009512.1|  PREDICTED: two-component response regulator ...    146   5e-41   Populus euphratica
ref|XP_002326060.1|  hypothetical protein POPTR_0019s15410g             145   8e-41   Populus trichocarpa [western balsam poplar]
ref|NP_001241393.1|  uncharacterized protein LOC100778707               145   9e-41   Glycine max [soybeans]
ref|XP_009774750.1|  PREDICTED: two-component response regulator ...    144   1e-40   Nicotiana sylvestris
ref|NP_181599.1|  two-component response regulator ARR16                145   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308985.1|  PREDICTED: two-component response regulator ...    144   2e-40   Fragaria vesca subsp. vesca
ref|XP_009116343.1|  PREDICTED: two-component response regulator ...    143   2e-40   Brassica rapa
ref|XP_008369375.1|  PREDICTED: two-component response regulator ...    143   4e-40   Malus domestica [apple tree]
ref|XP_006402992.1|  hypothetical protein EUTSA_v10006466mg             143   4e-40   Eutrema salsugineum
ref|XP_008388362.1|  PREDICTED: two-component response regulator ...    142   6e-40   
ref|XP_006411334.1|  hypothetical protein EUTSA_v10017348mg             143   7e-40   Eutrema salsugineum
ref|XP_009139105.1|  PREDICTED: two-component response regulator ...    142   9e-40   Brassica rapa
gb|KFK36940.1|  hypothetical protein AALP_AA4G192000                    142   1e-39   Arabis alpina [alpine rockcress]
ref|XP_010525414.1|  PREDICTED: two-component response regulator ...    141   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_006295142.1|  hypothetical protein CARUB_v10024214mg             141   3e-39   Capsella rubella
ref|XP_010508821.1|  PREDICTED: two-component response regulator ...    141   4e-39   Camelina sativa [gold-of-pleasure]
ref|NP_001189722.1|  two-component response regulator ARR16             140   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517508.1|  PREDICTED: two-component response regulator ...    140   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010505820.1|  PREDICTED: two-component response regulator ...    140   8e-39   Camelina sativa [gold-of-pleasure]
emb|CDP04042.1|  unnamed protein product                                140   1e-38   Coffea canephora [robusta coffee]
ref|XP_009116342.1|  PREDICTED: two-component response regulator ...    139   1e-38   Brassica rapa
ref|XP_010670065.1|  PREDICTED: two-component response regulator ...    139   2e-38   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009133449.1|  PREDICTED: two-component response regulator ...    139   2e-38   Brassica rapa
gb|KJB73023.1|  hypothetical protein B456_011G210000                    139   2e-38   Gossypium raimondii
ref|XP_010067618.1|  PREDICTED: two-component response regulator ...    138   4e-38   Eucalyptus grandis [rose gum]
ref|XP_009139104.1|  PREDICTED: two-component response regulator ...    137   5e-38   Brassica rapa
ref|XP_007208910.1|  hypothetical protein PRUPE_ppa027113mg             138   5e-38   Prunus persica
gb|AAQ10676.1|  type-A response regulator                               138   6e-38   Catharanthus roseus [chatas]
ref|XP_004502823.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    138   6e-38   
gb|KFK36939.1|  hypothetical protein AALP_AA4G192000                    137   9e-38   Arabis alpina [alpine rockcress]
gb|KDO67530.1|  hypothetical protein CISIN_1g042079mg                   137   1e-37   Citrus sinensis [Valencia orange]
ref|XP_006435932.1|  hypothetical protein CICLE_v10032983mg             137   1e-37   Citrus clementina
ref|XP_002888998.1|  hypothetical protein ARALYDRAFT_316423             138   2e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006295143.1|  hypothetical protein CARUB_v10024214mg             137   2e-37   Capsella rubella
ref|XP_010508820.1|  PREDICTED: two-component response regulator ...    137   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002511471.1|  two-component sensor protein histidine prote...    138   2e-37   Ricinus communis
ref|XP_006470938.1|  PREDICTED: two-component response regulator ...    137   3e-37   Citrus sinensis [Valencia orange]
ref|XP_008239693.1|  PREDICTED: two-component response regulator ...    138   3e-37   Prunus mume [ume]
gb|KHG14174.1|  Two-component response regulator ARR6 -like protein     137   4e-37   Gossypium arboreum [tree cotton]
gb|KJB73007.1|  hypothetical protein B456_011G208900                    135   4e-37   Gossypium raimondii
gb|KDP31161.1|  hypothetical protein JCGZ_11537                         137   4e-37   Jatropha curcas
ref|XP_006420721.1|  hypothetical protein CICLE_v10005987mg             136   4e-37   Citrus clementina
gb|KDO49056.1|  hypothetical protein CISIN_1g046192mg                   136   5e-37   Citrus sinensis [Valencia orange]
ref|XP_010517507.1|  PREDICTED: two-component response regulator ...    135   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010505819.1|  PREDICTED: two-component response regulator ...    135   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_007208607.1|  hypothetical protein PRUPE_ppa021876mg             135   5e-37   Prunus persica
ref|XP_002322144.1|  hypothetical protein POPTR_0015s08130g             137   6e-37   Populus trichocarpa [western balsam poplar]
gb|KJB37033.1|  hypothetical protein B456_006G187400                    137   7e-37   Gossypium raimondii
emb|CDY22469.1|  BnaC03g22790D                                          135   8e-37   Brassica napus [oilseed rape]
ref|XP_009594904.1|  PREDICTED: two-component response regulator ...    137   8e-37   Nicotiana tomentosiformis
ref|XP_008245269.1|  PREDICTED: two-component response regulator ...    135   1e-36   Prunus mume [ume]
ref|XP_010111960.1|  Two-component response regulator                   136   1e-36   Morus notabilis
emb|CDX73122.1|  BnaC06g35700D                                          135   1e-36   Brassica napus [oilseed rape]
ref|XP_009133448.1|  PREDICTED: two-component response regulator ...    134   1e-36   Brassica rapa
ref|XP_006302845.1|  hypothetical protein CARUB_v10020975mg             135   2e-36   Capsella rubella
ref|XP_007036075.1|  Two-component response regulator ARR5              136   2e-36   Theobroma cacao [chocolate]
ref|XP_002267932.1|  PREDICTED: two-component response regulator ...    134   2e-36   Vitis vinifera
gb|ABQ95670.1|  type A response regulator                               135   2e-36   Malus domestica [apple tree]
ref|XP_011028652.1|  PREDICTED: two-component response regulator ...    135   3e-36   Populus euphratica
ref|XP_006577761.1|  PREDICTED: uncharacterized protein LOC100306...    135   3e-36   Glycine max [soybeans]
ref|XP_007138131.1|  hypothetical protein PHAVU_009G182800g             135   3e-36   Phaseolus vulgaris [French bean]
ref|XP_008374475.1|  PREDICTED: two-component response regulator ...    135   4e-36   Malus domestica [apple tree]
gb|KJB73006.1|  hypothetical protein B456_011G208900                    133   4e-36   Gossypium raimondii
ref|XP_004501966.1|  PREDICTED: two-component response regulator ...    134   4e-36   Cicer arietinum [garbanzo]
ref|NP_001238384.1|  uncharacterized protein LOC100306152               134   4e-36   Glycine max [soybeans]
ref|XP_009803217.1|  PREDICTED: two-component response regulator ...    135   5e-36   Nicotiana sylvestris
emb|CDY45402.1|  BnaA07g31820D                                          134   5e-36   Brassica napus [oilseed rape]
emb|CDY21807.1|  BnaA06g20760D                                          134   5e-36   Brassica napus [oilseed rape]
ref|XP_010444157.1|  PREDICTED: two-component response regulator ...    134   5e-36   Camelina sativa [gold-of-pleasure]
gb|KFK28019.1|  hypothetical protein AALP_AA8G460900                    134   7e-36   Arabis alpina [alpine rockcress]
ref|XP_006394337.1|  hypothetical protein EUTSA_v10004962mg             133   8e-36   Eutrema salsugineum
ref|XP_007155382.1|  hypothetical protein PHAVU_003G196500g             134   8e-36   Phaseolus vulgaris [French bean]
gb|KEH35092.1|  two-component response regulator ARR3-like protein      134   8e-36   Medicago truncatula
ref|XP_002268352.1|  PREDICTED: two-component response regulator ...    134   8e-36   Vitis vinifera
ref|XP_006390374.1|  hypothetical protein EUTSA_v10019119mg             134   9e-36   Eutrema salsugineum
ref|XP_010459459.1|  PREDICTED: two-component response regulator ...    133   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009626719.1|  PREDICTED: two-component response regulator ...    134   1e-35   Nicotiana tomentosiformis
ref|XP_011088585.1|  PREDICTED: two-component response regulator ...    133   1e-35   Sesamum indicum [beniseed]
ref|XP_007155380.1|  hypothetical protein PHAVU_003G196300g             133   1e-35   Phaseolus vulgaris [French bean]
ref|XP_009788178.1|  PREDICTED: two-component response regulator ...    133   1e-35   Nicotiana sylvestris
ref|XP_010416347.1|  PREDICTED: two-component response regulator ...    133   1e-35   Camelina sativa [gold-of-pleasure]
emb|CDX76036.1|  BnaA04g03000D                                          134   1e-35   Brassica napus [oilseed rape]
gb|ABG35779.1|  SRR200                                                  132   1e-35   Striga asiatica [witchweed]
emb|CDY59856.1|  BnaCnng35610D                                          132   1e-35   Brassica napus [oilseed rape]
ref|XP_009139049.1|  PREDICTED: two-component response regulator ...    134   1e-35   Brassica rapa
gb|AAQ10677.1|  type-A response regulator                               132   1e-35   Catharanthus roseus [chatas]
emb|CDX85860.1|  BnaC06g22740D                                          134   1e-35   Brassica napus [oilseed rape]
ref|XP_003549646.1|  PREDICTED: two-component response regulator ...    133   1e-35   Glycine max [soybeans]
ref|XP_002876392.1|  hypothetical protein ARALYDRAFT_486148             134   1e-35   Arabidopsis lyrata subsp. lyrata
emb|CDX72077.1|  BnaC08g27970D                                          134   1e-35   Brassica napus [oilseed rape]
ref|XP_009626718.1|  PREDICTED: two-component response regulator ...    134   2e-35   Nicotiana tomentosiformis
gb|ABG33766.1|  reponse regulator 6                                     131   2e-35   Musa acuminata [banana]
ref|XP_003527040.1|  PREDICTED: two-component response regulator ...    133   2e-35   Glycine max [soybeans]
ref|XP_009106145.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    133   2e-35   Brassica rapa
ref|XP_010484006.1|  PREDICTED: two-component response regulator ...    132   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010428484.1|  PREDICTED: two-component response regulator ...    132   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010471585.1|  PREDICTED: two-component response regulator ...    132   2e-35   Camelina sativa [gold-of-pleasure]
dbj|BAL43557.1|  type-A response regulator                              133   2e-35   Petunia x hybrida [garden petunia]
ref|XP_006854776.1|  hypothetical protein AMTR_s00063p00116400          132   2e-35   Amborella trichopoda
emb|CBX43986.1|  putative A-type response regulator 4                   132   3e-35   Populus x canadensis [Canadian poplar]
ref|NP_201097.1|  two-component response regulator ARR6                 132   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177627.1|  two-component response regulator ARR15                132   3e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68161.1|  BnaA07g22010D                                          132   3e-35   Brassica napus [oilseed rape]
ref|NP_173339.1|  two-component response regulator ARR7                 132   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44048.1|  hypothetical protein AALP_AA1G208700                    132   4e-35   Arabis alpina [alpine rockcress]
ref|XP_002322145.2|  hypothetical protein POPTR_0015s08130g             132   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009374451.1|  PREDICTED: two-component response regulator ...    130   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_009604813.1|  PREDICTED: two-component response regulator ...    132   4e-35   Nicotiana tomentosiformis
ref|XP_010550669.1|  PREDICTED: two-component response regulator ...    132   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_009149845.1|  PREDICTED: two-component response regulator ...    131   4e-35   Brassica rapa
emb|CDY70164.1|  BnaCnng67000D                                          131   4e-35   Brassica napus [oilseed rape]
ref|XP_002304795.2|  hypothetical protein POPTR_0003s19710g             131   4e-35   Populus trichocarpa [western balsam poplar]
gb|EYU38278.1|  hypothetical protein MIMGU_mgv1a019913mg                130   5e-35   Erythranthe guttata [common monkey flower]
gb|KHN16287.1|  Two-component response regulator ARR6                   132   5e-35   Glycine soja [wild soybean]
emb|CDY06142.1|  BnaA09g36380D                                          132   5e-35   Brassica napus [oilseed rape]
emb|CBI40157.3|  unnamed protein product                                130   5e-35   Vitis vinifera
ref|XP_010426279.1|  PREDICTED: two-component response regulator ...    131   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008384995.1|  PREDICTED: two-component response regulator ...    130   5e-35   
ref|XP_004299595.1|  PREDICTED: two-component response regulator ...    132   5e-35   Fragaria vesca subsp. vesca
ref|XP_009151412.1|  PREDICTED: two-component response regulator ...    131   5e-35   Brassica rapa
gb|KJB78543.1|  hypothetical protein B456_013G004700                    130   5e-35   Gossypium raimondii
emb|CDY30966.1|  BnaC04g24580D                                          132   6e-35   Brassica napus [oilseed rape]
ref|XP_004249241.1|  PREDICTED: two-component response regulator ...    132   6e-35   Solanum lycopersicum
ref|XP_010516309.1|  PREDICTED: two-component response regulator ...    132   7e-35   Camelina sativa [gold-of-pleasure]
ref|NP_191263.1|  two-component response regulator ARR9                 132   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104741.1|  PREDICTED: two-component response regulator ...    132   7e-35   Brassica rapa
emb|CDX96681.1|  BnaA08g22240D                                          131   8e-35   Brassica napus [oilseed rape]
ref|XP_010503433.1|  PREDICTED: two-component response regulator ...    131   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002893028.1|  hypothetical protein ARALYDRAFT_889335             131   8e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_010477106.1|  PREDICTED: two-component response regulator ...    131   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006351276.1|  PREDICTED: two-component response regulator ...    132   8e-35   Solanum tuberosum [potatoes]
ref|XP_006291901.1|  hypothetical protein CARUB_v10018078mg             130   9e-35   Capsella rubella
ref|XP_008360657.1|  PREDICTED: two-component response regulator ...    130   9e-35   Malus domestica [apple tree]
emb|CDX83788.1|  BnaC08g18570D                                          131   9e-35   Brassica napus [oilseed rape]
ref|XP_006579380.1|  PREDICTED: uncharacterized protein LOC100527...    131   9e-35   Glycine max [soybeans]
ref|XP_010498312.1|  PREDICTED: two-component response regulator ...    131   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010028399.1|  PREDICTED: two-component response regulator ...    131   9e-35   Eucalyptus grandis [rose gum]
ref|XP_002283787.2|  PREDICTED: two-component response regulator ...    132   9e-35   Vitis vinifera
ref|XP_010459562.1|  PREDICTED: two-component response regulator ...    131   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009364893.1|  PREDICTED: two-component response regulator ...    130   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_010645611.1|  PREDICTED: two-component response regulator ...    129   1e-34   Vitis vinifera
ref|XP_002877596.1|  hypothetical protein ARALYDRAFT_906046             130   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_002267404.1|  PREDICTED: two-component response regulator ...    131   1e-34   Vitis vinifera
emb|CAN69259.1|  hypothetical protein VITISV_026384                     131   1e-34   Vitis vinifera
ref|XP_004140290.1|  PREDICTED: two-component response regulator ...    129   1e-34   Cucumis sativus [cucumbers]
ref|XP_010504623.1|  PREDICTED: two-component response regulator ...    131   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006304206.1|  hypothetical protein CARUB_v10010295mg             131   1e-34   Capsella rubella
gb|AFK41993.1|  unknown                                                 131   1e-34   Lotus japonicus
ref|XP_006402918.1|  hypothetical protein EUTSA_v10006209mg             132   1e-34   Eutrema salsugineum
ref|XP_010508734.1|  PREDICTED: two-component response regulator ...    131   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002866522.1|  hypothetical protein ARALYDRAFT_496477             130   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_009110302.1|  PREDICTED: two-component response regulator ...    130   1e-34   Brassica rapa
ref|XP_010515122.1|  PREDICTED: two-component response regulator ...    130   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011028649.1|  PREDICTED: two-component response regulator ...    131   1e-34   Populus euphratica
ref|XP_010652890.1|  PREDICTED: two-component response regulator ...    131   2e-34   Vitis vinifera
ref|XP_010505899.1|  PREDICTED: two-component response regulator ...    131   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006404297.1|  hypothetical protein EUTSA_v10010754mg             130   2e-34   Eutrema salsugineum
emb|CDY22518.1|  BnaC03g23280D                                          130   2e-34   Brassica napus [oilseed rape]
ref|XP_010517619.1|  PREDICTED: two-component response regulator ...    131   2e-34   Camelina sativa [gold-of-pleasure]
emb|CBI15098.3|  unnamed protein product                                132   2e-34   Vitis vinifera
ref|XP_006439725.1|  hypothetical protein CICLE_v10022334mg             130   2e-34   Citrus clementina
gb|ABG35777.1|  SRR217                                                  130   2e-34   Striga asiatica [witchweed]
emb|CDY54257.1|  BnaC01g42890D                                          129   2e-34   Brassica napus [oilseed rape]
ref|XP_006304102.1|  hypothetical protein CARUB_v10010030mg             131   3e-34   Capsella rubella
ref|XP_006476689.1|  PREDICTED: two-component response regulator ...    130   3e-34   Citrus sinensis [Valencia orange]
ref|XP_006417463.1|  hypothetical protein EUTSA_v10008575mg             131   3e-34   Eutrema salsugineum
ref|XP_006281027.1|  hypothetical protein CARUB_v10027044mg             130   3e-34   Capsella rubella
ref|XP_011020390.1|  PREDICTED: two-component response regulator ...    129   3e-34   Populus euphratica
ref|XP_010269354.1|  PREDICTED: two-component response regulator ...    130   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010272107.1|  PREDICTED: two-component response regulator ...    130   3e-34   Nelumbo nucifera [Indian lotus]
gb|KFK34102.1|  hypothetical protein AALP_AA5G102300                    129   3e-34   Arabis alpina [alpine rockcress]
ref|XP_009142738.1|  PREDICTED: two-component response regulator ...    130   3e-34   Brassica rapa
ref|XP_006294950.1|  hypothetical protein CARUB_v10024006mg             130   3e-34   Capsella rubella
gb|AFK34128.1|  unknown                                                 129   4e-34   Lotus japonicus
ref|XP_006291782.1|  hypothetical protein CARUB_v10017962mg             130   4e-34   Capsella rubella
ref|NP_001240226.1|  uncharacterized protein LOC100788079               130   4e-34   Glycine max [soybeans]
ref|XP_009606673.1|  PREDICTED: two-component response regulator ...    130   4e-34   Nicotiana tomentosiformis
ref|XP_011071752.1|  PREDICTED: two-component response regulator ...    129   4e-34   Sesamum indicum [beniseed]
ref|XP_006407515.1|  hypothetical protein EUTSA_v10021491mg             130   4e-34   Eutrema salsugineum
ref|XP_010277318.1|  PREDICTED: two-component response regulator ...    128   4e-34   Nelumbo nucifera [Indian lotus]
emb|CDX79942.1|  BnaA05g02140D                                          129   4e-34   Brassica napus [oilseed rape]
gb|EMS50922.1|  Two-component response regulator ARR8                   130   5e-34   Triticum urartu
ref|XP_009382585.1|  PREDICTED: two-component response regulator ...    129   5e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAQ10675.1|  type-A response regulator                               130   5e-34   Catharanthus roseus [chatas]
ref|NP_176202.1|  response regulator 3                                  130   5e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34510.1|  unknown                                                 128   5e-34   Medicago truncatula
gb|KEH35093.1|  two-component response regulator ARR3-like protein      129   5e-34   Medicago truncatula
emb|CDY41014.1|  BnaC05g14720D                                          129   5e-34   Brassica napus [oilseed rape]
ref|XP_008465907.1|  PREDICTED: two-component response regulator ...    127   5e-34   Cucumis melo [Oriental melon]
ref|XP_006411396.1|  hypothetical protein EUTSA_v10017200mg             130   5e-34   Eutrema salsugineum
ref|XP_009149383.1|  PREDICTED: two-component response regulator ...    129   5e-34   Brassica rapa
dbj|BAJ88185.1|  predicted protein                                      131   6e-34   Hordeum vulgare subsp. vulgare [barley]
gb|KDP21284.1|  hypothetical protein JCGZ_21755                         130   6e-34   Jatropha curcas
gb|KFK43337.1|  hypothetical protein AALP_AA1G111900                    130   6e-34   Arabis alpina [alpine rockcress]
ref|NP_181663.1|  response regulator 3                                  129   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301719.1|  hypothetical protein CARUB_v10022177mg             130   7e-34   Capsella rubella
ref|XP_004249238.1|  PREDICTED: two-component response regulator ...    129   7e-34   Solanum lycopersicum
gb|AHM24030.1|  two-component response regulator                        129   7e-34   Rosa canina [dog briar]
ref|XP_010427564.1|  PREDICTED: two-component response regulator ...    129   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010095968.1|  Two-component response regulator                   130   7e-34   Morus notabilis
ref|XP_010414625.1|  PREDICTED: two-component response regulator ...    129   7e-34   Camelina sativa [gold-of-pleasure]
gb|AAK14395.1|AF339732_1  response regulator protein                    130   7e-34   Dianthus caryophyllus [carnation]
ref|XP_002886648.1|  predicted protein                                  129   8e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_003608937.1|  Two-component response regulator ARR5              129   8e-34   
gb|KJB77154.1|  hypothetical protein B456_012G123500                    129   8e-34   Gossypium raimondii
ref|NP_172517.1|  two-component response regulator ARR4                 130   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600658.1|  PREDICTED: two-component response regulator ...    129   9e-34   Glycine max [soybeans]
emb|CDY30913.1|  BnaC09g14930D                                          129   9e-34   Brassica napus [oilseed rape]
emb|CDY45155.1|  BnaA09g14370D                                          129   9e-34   Brassica napus [oilseed rape]
emb|CBI40158.3|  unnamed protein product                                127   9e-34   Vitis vinifera
ref|XP_009118251.1|  PREDICTED: two-component response regulator ...    130   9e-34   Brassica rapa
ref|XP_010276614.1|  PREDICTED: two-component response regulator ...    128   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004303597.1|  PREDICTED: two-component response regulator ...    129   1e-33   Fragaria vesca subsp. vesca
ref|XP_004504497.1|  PREDICTED: two-component response regulator ...    129   1e-33   Cicer arietinum [garbanzo]
ref|XP_009386845.1|  PREDICTED: two-component response regulator ...    128   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553643.1|  PREDICTED: two-component response regulator ...    129   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_010458393.1|  PREDICTED: two-component response regulator ...    129   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006351272.1|  PREDICTED: two-component response regulator ...    129   1e-33   Solanum tuberosum [potatoes]
ref|XP_009150827.1|  PREDICTED: two-component response regulator ...    129   1e-33   Brassica rapa
gb|EMT09801.1|  Two-component response regulator ARR8                   129   1e-33   Aegilops tauschii
gb|KHG13999.1|  Two-component response regulator ARR4 -like protein     129   1e-33   Gossypium arboreum [tree cotton]
emb|CDP00229.1|  unnamed protein product                                129   1e-33   Coffea canephora [robusta coffee]
ref|XP_009776026.1|  PREDICTED: two-component response regulator ...    129   1e-33   Nicotiana sylvestris
emb|CDY37975.1|  BnaC05g07990D                                          129   1e-33   Brassica napus [oilseed rape]
gb|KJB74992.1|  hypothetical protein B456_012G017600                    127   1e-33   Gossypium raimondii
ref|XP_009399982.1|  PREDICTED: two-component response regulator ...    127   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY06934.1|  BnaA04g23810D                                          128   2e-33   Brassica napus [oilseed rape]
emb|CDY34890.1|  BnaA09g48160D                                          129   2e-33   Brassica napus [oilseed rape]
ref|XP_003627814.1|  Two-component response regulator ARR8              127   2e-33   Medicago truncatula
ref|XP_007044474.1|  Two-component response regulator ARR4              132   2e-33   Theobroma cacao [chocolate]
ref|XP_010554778.1|  PREDICTED: two-component response regulator ...    129   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_006856915.1|  hypothetical protein AMTR_s00055p00222350          127   2e-33   Amborella trichopoda
emb|CDP09526.1|  unnamed protein product                                128   2e-33   Coffea canephora [robusta coffee]
ref|XP_010095967.1|  Two-component response regulator                   130   2e-33   Morus notabilis
emb|CDY14761.1|  BnaC04g47580D                                          128   2e-33   
emb|CDY07801.1|  BnaC03g48210D                                          129   2e-33   
ref|XP_010668382.1|  PREDICTED: two-component response regulator ...    128   2e-33   
ref|XP_004238726.2|  PREDICTED: two-component response regulator ...    129   2e-33   
ref|XP_009113268.1|  PREDICTED: two-component response regulator ...    128   2e-33   
gb|EPS59237.1|  hypothetical protein M569_15571                         125   2e-33   
gb|KEH23599.1|  two-component response regulator ARR3-like protein      128   2e-33   
ref|XP_002892573.1|  hypothetical protein ARALYDRAFT_888316             129   2e-33   
dbj|BAL43556.1|  type-A response regulator                              129   2e-33   
ref|XP_009765982.1|  PREDICTED: two-component response regulator ...    127   2e-33   
ref|XP_009622543.1|  PREDICTED: two-component response regulator ...    127   2e-33   
emb|CDY23856.1|  BnaC04g01810D                                          127   2e-33   
emb|CBI30106.3|  unnamed protein product                                126   2e-33   
ref|XP_010475910.1|  PREDICTED: two-component response regulator ...    129   2e-33   
gb|KJB77155.1|  hypothetical protein B456_012G123500                    128   2e-33   
gb|AFK36913.1|  unknown                                                 128   2e-33   
gb|EYU18643.1|  hypothetical protein MIMGU_mgv1a012918mg                128   2e-33   
gb|AGH13202.1|  cytokinin response regulator 5                          127   3e-33   
ref|XP_004493425.1|  PREDICTED: two-component response regulator ...    127   3e-33   
ref|XP_009796867.1|  PREDICTED: two-component response regulator ...    127   3e-33   
ref|XP_010931988.1|  PREDICTED: two-component response regulator ...    127   3e-33   
gb|EYU34521.1|  hypothetical protein MIMGU_mgv1a018237mg                126   3e-33   
dbj|BAA34727.1|  response regulator 5                                   127   3e-33   
ref|XP_004297679.1|  PREDICTED: two-component response regulator ...    128   3e-33   
ref|XP_009116409.1|  PREDICTED: two-component response regulator ...    128   3e-33   
ref|XP_010525480.1|  PREDICTED: two-component response regulator ...    128   3e-33   
ref|XP_007202538.1|  hypothetical protein PRUPE_ppa011054mg             127   3e-33   
gb|KFK36982.1|  hypothetical protein AALP_AA4G197100                    128   3e-33   
ref|XP_010475909.1|  PREDICTED: two-component response regulator ...    129   3e-33   
ref|NP_190393.1|  two-component response regulator ARR5                 126   3e-33   
ref|XP_010044664.1|  PREDICTED: two-component response regulator ...    129   3e-33   
ref|XP_007028513.1|  Type-a response regulator                          127   3e-33   
gb|AAC26635.1|  two-component response regulator homolog                126   3e-33   
ref|XP_007157523.1|  hypothetical protein PHAVU_002G076900g             127   4e-33   
ref|XP_011091843.1|  PREDICTED: two-component response regulator ...    126   4e-33   
gb|KEH41351.1|  two-component response regulator ARR3-like protein      127   4e-33   
ref|XP_006357275.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...    128   4e-33   
ref|XP_006392216.1|  hypothetical protein EUTSA_v10023662mg             127   4e-33   
ref|XP_008782007.1|  PREDICTED: two-component response regulator ...    127   4e-33   
ref|XP_010548083.1|  PREDICTED: two-component response regulator ...    128   4e-33   
ref|XP_010926969.1|  PREDICTED: two-component response regulator ...    127   4e-33   
ref|XP_010044665.1|  PREDICTED: two-component response regulator ...    128   5e-33   
emb|CBX43983.1|  putative A-type response regulator 1b                  128   5e-33   
ref|XP_009391546.1|  PREDICTED: two-component response regulator ...    126   5e-33   
ref|XP_009148373.1|  PREDICTED: two-component response regulator ...    128   5e-33   
gb|ABG35780.1|  SRR198                                                  127   5e-33   
emb|CDX93424.1|  BnaA06g06240D                                          128   5e-33   
ref|XP_010491281.1|  PREDICTED: two-component response regulator ...    128   5e-33   
ref|NP_001237197.1|  uncharacterized protein LOC100527518               127   5e-33   
emb|CBI40159.3|  unnamed protein product                                125   5e-33   
emb|CBI40161.3|  unnamed protein product                                125   6e-33   
gb|KFK34943.1|  hypothetical protein AALP_AA5G214000                    127   6e-33   
ref|XP_002879919.1|  hypothetical protein ARALYDRAFT_483202             127   6e-33   
ref|XP_008799106.1|  PREDICTED: two-component response regulator ...    126   6e-33   
ref|XP_004511028.1|  PREDICTED: two-component response regulator ...    125   6e-33   
ref|XP_010036352.1|  PREDICTED: two-component response regulator ...    127   7e-33   
gb|KHN48630.1|  Two-component response regulator ARR5                   126   7e-33   
ref|XP_010938571.1|  PREDICTED: two-component response regulator ...    126   7e-33   
ref|XP_008228315.1|  PREDICTED: two-component response regulator ...    125   8e-33   
emb|CDY20630.1|  BnaC08g14280D                                          127   8e-33   
emb|CBI40160.3|  unnamed protein product                                124   8e-33   
ref|XP_009133480.1|  PREDICTED: two-component response regulator ...    126   8e-33   
ref|XP_010670481.1|  PREDICTED: two-component response regulator ...    125   8e-33   
emb|CBX43982.1|  putative A-type response regulator 1a                  127   9e-33   
gb|EPS57603.1|  hypothetical protein M569_17215                         124   9e-33   
ref|XP_003519320.1|  PREDICTED: two-component response regulator ...    127   1e-32   
ref|XP_004236156.1|  PREDICTED: two-component response regulator ...    125   1e-32   
ref|XP_006663809.1|  PREDICTED: two-component response regulator ...    126   1e-32   
ref|XP_010269353.1|  PREDICTED: two-component response regulator ...    126   1e-32   
ref|XP_006378200.1|  hypothetical protein POPTR_0010s04740g             127   1e-32   
ref|XP_010940310.1|  PREDICTED: two-component response regulator ...    124   1e-32   
ref|XP_002273990.1|  PREDICTED: two-component response regulator ...    126   1e-32   
ref|XP_010095706.1|  Two-component response regulator                   125   2e-32   
emb|CDY66046.1|  BnaCnng49440D                                          126   2e-32   
ref|XP_009631742.1|  PREDICTED: two-component response regulator ...    125   2e-32   
ref|XP_003517746.1|  PREDICTED: two-component response regulator ...    126   2e-32   
ref|XP_009339985.1|  PREDICTED: two-component response regulator ...    125   2e-32   
gb|AFK35812.1|  unknown                                                 126   2e-32   
ref|XP_010095966.1|  Two-component response regulator                   125   2e-32   
ref|XP_010670482.1|  PREDICTED: two-component response regulator ...    124   2e-32   
ref|XP_008808788.1|  PREDICTED: two-component response regulator ...    125   2e-32   
ref|XP_011027272.1|  PREDICTED: two-component response regulator ...    126   2e-32   
emb|CDY20948.1|  BnaA08g25770D                                          126   2e-32   
ref|XP_008387409.1|  PREDICTED: two-component response regulator ...    125   2e-32   
gb|ABQ95669.1|  response regulator                                      125   2e-32   
ref|XP_008339984.1|  PREDICTED: two-component response regulator ...    126   2e-32   
ref|XP_010100530.1|  Two-component response regulator                   126   2e-32   
ref|XP_011078970.1|  PREDICTED: two-component response regulator ...    125   2e-32   
ref|XP_011006898.1|  PREDICTED: two-component response regulator ...    126   2e-32   
emb|CBX25288.1|  hypothetical_protein                                   125   2e-32   
ref|XP_006662727.1|  PREDICTED: two-component response regulator ...    125   2e-32   
ref|XP_006344995.1|  PREDICTED: two-component response regulator ...    125   2e-32   
gb|KDO39649.1|  hypothetical protein CISIN_1g026239mg                   126   2e-32   
dbj|BAM74645.1|  type-A response regulator                              125   2e-32   
ref|XP_006492506.1|  PREDICTED: two-component response regulator ...    125   2e-32   
ref|XP_006442056.1|  hypothetical protein CICLE_v10021937mg             125   2e-32   
ref|XP_004138134.1|  PREDICTED: two-component response regulator ...    125   2e-32   
ref|XP_002297741.2|  hypothetical protein POPTR_0001s06430g             123   2e-32   
ref|XP_010539939.1|  PREDICTED: two-component response regulator ...    124   2e-32   
ref|XP_009361964.1|  PREDICTED: two-component response regulator ...    124   3e-32   
ref|XP_008389572.1|  PREDICTED: two-component response regulator ...    125   3e-32   
gb|ABQ95668.1|  response regulator                                      125   3e-32   
ref|XP_009144440.1|  PREDICTED: two-component response regulator ...    126   3e-32   
ref|XP_008244835.1|  PREDICTED: two-component response regulator ...    125   3e-32   
ref|XP_007011051.1|  Two-component response regulator ARR8              124   3e-32   
gb|KHN14915.1|  Two-component response regulator ARR9                   125   3e-32   
ref|XP_010922156.1|  PREDICTED: two-component response regulator ...    124   3e-32   
ref|XP_007223876.1|  hypothetical protein PRUPE_ppa010863mg             125   3e-32   
ref|XP_002520201.1|  two-component sensor protein histidine prote...    126   3e-32   
gb|AFK44366.1|  unknown                                                 125   3e-32   
emb|CDY27219.1|  BnaA09g35830D                                          123   4e-32   
gb|KDO82646.1|  hypothetical protein CISIN_1g023816mg                   125   4e-32   
ref|XP_008244969.1|  PREDICTED: two-component response regulator ...    125   4e-32   
gb|AES91134.2|  two-component response regulator ARR3-like protein      124   4e-32   
ref|XP_010683320.1|  PREDICTED: two-component response regulator ...    126   4e-32   
ref|XP_003613423.1|  Two-component response regulator ARR3              125   4e-32   
ref|XP_002307983.2|  Two-component response regulator ARR8 family...    125   4e-32   
ref|XP_010276615.1|  PREDICTED: two-component response regulator ...    122   5e-32   
ref|XP_007148939.1|  hypothetical protein PHAVU_005G027100g             123   5e-32   
ref|XP_009350930.1|  PREDICTED: two-component response regulator ...    124   5e-32   
ref|XP_009768331.1|  PREDICTED: two-component response regulator ...    121   5e-32   
emb|CBX43988.1|  putative A-type response regulator 6                   124   5e-32   
ref|XP_006838392.1|  hypothetical protein AMTR_s00002p00074510          124   5e-32   
ref|XP_009339571.1|  PREDICTED: two-component response regulator ...    124   6e-32   
ref|XP_004135221.1|  PREDICTED: two-component response regulator ...    124   6e-32   
ref|XP_009420845.1|  PREDICTED: two-component response regulator ...    122   6e-32   
ref|XP_004504496.1|  PREDICTED: two-component response regulator ...    124   6e-32   
ref|NP_001241095.1|  uncharacterized protein LOC100814494               125   6e-32   
ref|XP_008813274.1|  PREDICTED: two-component response regulator ...    122   7e-32   
ref|XP_003578944.1|  PREDICTED: two-component response regulator ...    124   7e-32   
ref|XP_008446266.1|  PREDICTED: two-component response regulator ...    124   7e-32   
ref|XP_009420847.1|  PREDICTED: two-component response regulator ...    121   9e-32   
emb|CDX67674.1|  BnaA07g17140D                                          124   1e-31   
ref|XP_010668381.1|  PREDICTED: two-component response regulator ...    123   1e-31   
ref|XP_010238744.1|  PREDICTED: two-component response regulator ...    124   1e-31   
gb|ABG35781.1|  SRR197                                                  123   1e-31   
gb|ACU24220.1|  unknown                                                 122   2e-31   
ref|XP_010547354.1|  PREDICTED: two-component response regulator ...    122   2e-31   
ref|XP_002532588.1|  two-component system sensor histidine kinase...    123   2e-31   
ref|XP_004977508.1|  PREDICTED: two-component response regulator ...    122   2e-31   
ref|XP_011000562.1|  PREDICTED: two-component response regulator ...    122   2e-31   
emb|CDY65526.1|  BnaCnng47460D                                          121   2e-31   
ref|XP_009104039.1|  PREDICTED: two-component response regulator ...    123   2e-31   
ref|XP_002322625.1|  hypothetical protein POPTR_0016s03750g             123   2e-31   
gb|EYU20798.1|  hypothetical protein MIMGU_mgv1a013608mg                123   2e-31   
emb|CBX43989.1|  putative A-type response regulator 7                   123   2e-31   
ref|XP_002513063.1|  Two-component response regulator ARR8, putative    122   2e-31   
ref|XP_004978644.1|  PREDICTED: two-component response regulator ...    122   2e-31   
ref|XP_006483757.1|  PREDICTED: two-component response regulator ...    123   2e-31   
emb|CBX25471.1|  hypothetical_protein                                   122   2e-31   
ref|XP_003545839.1|  PREDICTED: two-component response regulator ...    121   2e-31   
emb|CBX43987.1|  putative A-type response regulator 5                   122   2e-31   
ref|XP_008453146.1|  PREDICTED: two-component response regulator ...    123   3e-31   
ref|NP_001065722.1|  Os11g0143300                                       122   3e-31   
ref|NP_001066118.2|  Os12g0139400                                       122   3e-31   
gb|EYU28654.1|  hypothetical protein MIMGU_mgv1a012764mg                123   3e-31   
ref|XP_009383882.1|  PREDICTED: two-component response regulator ...    121   3e-31   
gb|KHN37666.1|  Two-component response regulator ARR8                   121   3e-31   
ref|XP_009104038.1|  PREDICTED: two-component response regulator ...    123   3e-31   
dbj|BAM10424.1|  Type-a response regulator protein                      118   4e-31   
ref|XP_009763111.1|  PREDICTED: two-component response regulator ...    123   4e-31   
ref|XP_006653015.1|  PREDICTED: two-component response regulator ...    120   4e-31   
ref|XP_011075407.1|  PREDICTED: two-component response regulator ...    122   4e-31   
gb|ACG32848.1|  RR10 - Corn type-A response regulator                   121   5e-31   
ref|XP_004508816.1|  PREDICTED: two-component response regulator ...    122   5e-31   
gb|KDP37824.1|  hypothetical protein JCGZ_06726                         122   5e-31   
ref|XP_008392405.1|  PREDICTED: two-component response regulator ...    122   5e-31   
ref|XP_009626245.1|  PREDICTED: two-component response regulator ...    121   5e-31   
ref|NP_001104857.1|  LOC541632                                          122   6e-31   
ref|XP_006438504.1|  hypothetical protein CICLE_v10032281mg             122   6e-31   
ref|XP_003541594.1|  PREDICTED: two-component response regulator ...    120   6e-31   
gb|AFK41171.1|  unknown                                                 120   6e-31   
gb|ACN35670.1|  unknown                                                 122   6e-31   
ref|XP_010067733.1|  PREDICTED: two-component response regulator ...    120   6e-31   
ref|XP_008245632.1|  PREDICTED: two-component response regulator ...    120   7e-31   
ref|XP_002312699.2|  hypothetical protein POPTR_0008s19730g             122   7e-31   
emb|CAH67773.1|  H0322F07.10                                            120   7e-31   
gb|ACF81303.1|  unknown                                                 122   7e-31   
ref|XP_004136644.1|  PREDICTED: two-component response regulator ...    121   7e-31   
ref|NP_001054231.1|  Os04g0673300                                       120   8e-31   
ref|XP_009383883.1|  PREDICTED: two-component response regulator ...    120   9e-31   
ref|XP_010672986.1|  PREDICTED: two-component response regulator ...    122   1e-30   
gb|KDP40526.1|  hypothetical protein JCGZ_24525                         120   1e-30   
ref|XP_009777129.1|  PREDICTED: two-component response regulator ...    120   1e-30   
ref|XP_011000439.1|  PREDICTED: two-component response regulator ...    121   1e-30   
ref|XP_007220067.1|  hypothetical protein PRUPE_ppa025335mg             120   1e-30   
ref|XP_011086463.1|  PREDICTED: two-component response regulator ...    121   1e-30   
ref|XP_009776023.1|  PREDICTED: two-component response regulator ...    121   1e-30   
emb|CBG76250.1|  OO_Ba0005L10-OO_Ba0081K17.1                            119   1e-30   
ref|XP_007133766.1|  hypothetical protein PHAVU_011G207200g             121   1e-30   
ref|XP_009763112.1|  PREDICTED: two-component response regulator ...    119   1e-30   
ref|XP_010525479.1|  PREDICTED: two-component response regulator ...    121   1e-30   
ref|XP_003579464.2|  PREDICTED: two-component response regulator ...    119   2e-30   
ref|XP_008231573.1|  PREDICTED: two-component response regulator ...    119   2e-30   
ref|XP_008443276.1|  PREDICTED: two-component response regulator ...    120   2e-30   
ref|XP_002442679.1|  hypothetical protein SORBIDRAFT_08g001140          120   2e-30   
gb|KJB59265.1|  hypothetical protein B456_009G246600                    119   2e-30   
ref|XP_008443275.1|  PREDICTED: two-component response regulator ...    120   2e-30   
ref|XP_009360508.1|  PREDICTED: two-component response regulator ...    122   2e-30   
ref|XP_010683319.1|  PREDICTED: two-component response regulator ...    121   2e-30   
ref|XP_009763113.1|  PREDICTED: two-component response regulator ...    118   2e-30   
ref|XP_011071285.1|  PREDICTED: two-component response regulator ...    120   3e-30   
ref|XP_010095404.1|  Two-component response regulator                   120   3e-30   
ref|XP_006340119.1|  PREDICTED: two-component response regulator ...    121   3e-30   
ref|NP_001242179.1|  uncharacterized protein LOC100818762               118   4e-30   
ref|XP_008446956.1|  PREDICTED: two-component response regulator ...    118   4e-30   
gb|AFW59856.1|  cytokinin response regulator2                           117   5e-30   
ref|XP_006847932.1|  hypothetical protein AMTR_s00029p00125630          117   5e-30   
emb|CDX72141.1|  BnaC08g27330D                                          116   6e-30   
gb|ABK25022.1|  unknown                                                 119   6e-30   
ref|XP_006591196.1|  PREDICTED: two-component response regulator ...    118   6e-30   
gb|KJB59264.1|  hypothetical protein B456_009G246600                    117   6e-30   
gb|ABG35778.1|  SRR201                                                  119   7e-30   
emb|CBX25376.1|  hypothetical_protein                                   119   7e-30   
ref|XP_004308594.1|  PREDICTED: two-component response regulator ...    118   7e-30   
ref|XP_009606674.1|  PREDICTED: two-component response regulator ...    119   7e-30   
ref|XP_009398196.1|  PREDICTED: two-component response regulator ...    116   7e-30   
gb|ACJ86005.1|  unknown                                                 119   8e-30   
ref|XP_010935473.1|  PREDICTED: two-component response regulator ...    116   9e-30   
gb|AFK44001.1|  unknown                                                 119   9e-30   
ref|XP_004144338.1|  PREDICTED: two-component response regulator ...    119   1e-29   



>dbj|BAL43558.1| type-A response regulator [Petunia x hybrida]
Length=158

 Score =   160 bits (406),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 3/120 (3%)
 Frame = +1

Query  94   SMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQ  273
            S  MGE   DE  HVLAVDD+ ++  ++E+LLK SSCKVTTAENG+RALEYLGL  GD +
Sbjct  12   SRGMGETTADEP-HVLAVDDNLVDRKLVERLLKKSSCKVTTAENGLRALEYLGL-GGDQE  69

Query  274  HNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            H S N N  KVN+IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QCME
Sbjct  70   H-STNGNGSKVNMIITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCME  128



>ref|XP_010322123.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR17 [Solanum lycopersicum]
Length=161

 Score =   158 bits (399),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  ++EKLLK SSCKVTTAENG+RALEYLGL  G  Q NS N N  KVN+
Sbjct  18   HVLAVDDNLIDRKLVEKLLKKSSCKVTTAENGLRALEYLGL--GANQENSTNNNGSKVNM  75

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QCME
Sbjct  76   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCME  122



>gb|KEH35531.1| two-component response regulator ARR3-like protein [Medicago 
truncatula]
Length=156

 Score =   157 bits (397),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 3/122 (2%)
 Frame = +1

Query  88   SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  267
            SSS  + ENG+  + HVLAVDD+ I+  ++EKLLK+SSCKVTTAENG++ALEYLGL +G 
Sbjct  6    SSSKWVMENGD--IPHVLAVDDNIIDRTLVEKLLKNSSCKVTTAENGLKALEYLGLASGA  63

Query  268  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
             Q N+     PKVNLIITDY MPGM GYELLKK+K S+M K+VPVV+MSS+NIP+RIN+C
Sbjct  64   EQKNTLENGGPKVNLIITDYCMPGMTGYELLKKIKQSSM-KEVPVVIMSSDNIPTRINKC  122

Query  448  ME  453
            ME
Sbjct  123  ME  124



>ref|XP_006357298.1| PREDICTED: two-component response regulator ARR17-like [Solanum 
tuberosum]
Length=156

 Score =   157 bits (397),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  88   SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  267
            S S  MGE    +  HVLAVDD+ ++  ++E LLK SSCKVTTAE+G+RALEYLGL A  
Sbjct  9    SISKGMGEVVASDEPHVLAVDDNLVDRKLVEILLKKSSCKVTTAEDGLRALEYLGLAAH-  67

Query  268  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
             Q +S N+N  KVN+IITDY MPGM GYELLKK+K+S+M KDVPVV+MSSENIP+RINQC
Sbjct  68   -QDSSANSNGSKVNMIITDYCMPGMTGYELLKKIKESSMMKDVPVVIMSSENIPTRINQC  126

Query  448  ME  453
            ME
Sbjct  127  ME  128



>ref|XP_004240845.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Solanum lycopersicum]
Length=156

 Score =   157 bits (397),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  88   SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  267
            S S  MGE    E  HVLAVDD+ ++  ++E LLK SSCKVTTAE+G+RALEYLGL A  
Sbjct  9    SISKGMGEVVASEEPHVLAVDDNLVDRKLVEILLKKSSCKVTTAEDGLRALEYLGLAAH-  67

Query  268  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
             Q +S N+N  KVN+IITDY MPGM GYELLKK+K+S+M KDVPVV+MSSENIP+RI+QC
Sbjct  68   -QDSSKNSNGSKVNMIITDYCMPGMTGYELLKKIKESSMMKDVPVVIMSSENIPTRIHQC  126

Query  448  ME  453
            ME
Sbjct  127  ME  128



>ref|XP_006358744.1| PREDICTED: two-component response regulator ARR17-like [Solanum 
tuberosum]
Length=148

 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  ++EKLLK SSCKVTTAENG+RALEYLGL  G  Q +S N N  KVN+
Sbjct  17   HVLAVDDNLIDRKLVEKLLKKSSCKVTTAENGLRALEYLGL--GADQEHSTNNNGSKVNM  74

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QCME
Sbjct  75   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCME  121



>ref|XP_011001387.1| PREDICTED: two-component response regulator ARR17 [Populus euphratica]
 ref|XP_011001388.1| PREDICTED: two-component response regulator ARR17 [Populus euphratica]
Length=154

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD  ++  ++E+LLK+SSCKVTTAENG+RALEYLGL  GD +  S   NV KVNL
Sbjct  22   HVLAVDDSLVDRKLVERLLKNSSCKVTTAENGLRALEYLGL--GDEKRTSLEDNVSKVNL  79

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S+M K++PVV+MSSENIP+RIN+C+E
Sbjct  80   IITDYCMPGMTGYELLKKIKESSMLKEIPVVIMSSENIPTRINKCLE  126



>ref|XP_002325489.1| hypothetical protein POPTR_0019s08690g [Populus trichocarpa]
 gb|EEE99870.1| hypothetical protein POPTR_0019s08690g [Populus trichocarpa]
Length=154

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD  ++  ++E+LLK+SSCKVTTAENG+RALEYLGL  GD +  S   NV KVNL
Sbjct  22   HVLAVDDSLVDRKLVERLLKNSSCKVTTAENGLRALEYLGL--GDEKRTSLEDNVSKVNL  79

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S+M K++PVV+MSSENIP+RIN+C+E
Sbjct  80   IITDYCMPGMTGYELLKKIKESSMLKEIPVVIMSSENIPTRINKCLE  126



>ref|XP_009768329.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Nicotiana sylvestris]
Length=145

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  ++E+LLK SSCKVTTAENG+RALEYLGL  G  Q +S N N  KVN+
Sbjct  13   HVLAVDDNLVDRKLVERLLKKSSCKVTTAENGLRALEYLGL--GAEQEHSTNGNGSKVNM  70

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+QC+E
Sbjct  71   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDQCLE  117



>gb|KDP21642.1| hypothetical protein JCGZ_03313 [Jatropha curcas]
Length=158

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +1

Query  82   CPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLA  261
            C S    +G+ G D   HVLAVDD+ I+  ++EKLLK+SSC+VTTAENG+RALEYLGL  
Sbjct  10   CSSMDKILGDYG-DHQPHVLAVDDNLIDRKLVEKLLKNSSCRVTTAENGLRALEYLGL--  66

Query  262  GDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRIN  441
            GD +  +   NV KVNLIITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RI 
Sbjct  67   GDDERKTLEKNVSKVNLIITDYCMPGMTGYELLKKIKESSILKEVPVVIMSSENIPTRIK  126

Query  442  QCME  453
            +C+E
Sbjct  127  KCLE  130



>gb|EYU35194.1| hypothetical protein MIMGU_mgv1a015731mg [Erythranthe guttata]
Length=148

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = +1

Query  106  GENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP  285
            G  G  E  HVLAVDD+ I+ I++EKLLK+SSCKVTTAENG RALEYLGL+  +    S 
Sbjct  3    GAVGFVEEPHVLAVDDNLIDRILVEKLLKNSSCKVTTAENGQRALEYLGLVENN--QTSS  60

Query  286  NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            N N  KVN+IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSEN+P+RIN+C+E
Sbjct  61   NDNASKVNMIITDYCMPGMTGYELLKKIKESSVMKDVPVVIMSSENVPTRINKCLE  116



>gb|KHG06264.1| Two-component response regulator ARR17 -like protein [Gossypium 
arboreum]
Length=157

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  ++EKLLK+SSCKVTTAENG+RALE+LGL  G  Q NS    V KVNL
Sbjct  25   HVLAVDDNLIDRTLVEKLLKNSSCKVTTAENGLRALEFLGL--GSDQRNSLEGTVSKVNL  82

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RINQC+E
Sbjct  83   VITDYCMPGMTGYELLKKIKESSVLKEVPVVIMSSENIPTRINQCLE  129



>emb|CBX43990.1| putative A-type response regulator 8 [Populus x canadensis]
Length=154

 Score =   153 bits (387),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD  ++  ++E+LLK+SSCKVTTAENG+RALEYLGL  GD +  S   NV KVNL
Sbjct  22   HVLAVDDSLVDRKLVERLLKNSSCKVTTAENGLRALEYLGL--GDEKRTSLEDNVSKVNL  79

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S+M K +PVV+MSSENIP+RIN+C+E
Sbjct  80   IITDYCMPGMTGYELLKKIKESSMLKKIPVVIMSSENIPTRINKCLE  126



>ref|XP_002520876.1| two-component system sensor histidine kinase/response regulator, 
putative [Ricinus communis]
 gb|EEF41585.1| two-component system sensor histidine kinase/response regulator, 
putative [Ricinus communis]
Length=155

 Score =   153 bits (386),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
             C S    +G+ G+    HVLAVDD+ I+  ++EKLLK+S CKVTTAENG+RALEYLGL 
Sbjct  7    TCSSMEKVLGDYGDQP--HVLAVDDNLIDRKLVEKLLKNSCCKVTTAENGLRALEYLGL-  63

Query  259  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
             GD   N    NV KVNLIITDY MPGM GYELLKK+K+S++ K+VPVV++SSENIP+RI
Sbjct  64   -GDDDRNCLENNVSKVNLIITDYCMPGMTGYELLKKIKESSIMKEVPVVIVSSENIPTRI  122

Query  439  NQCME  453
            N+C+E
Sbjct  123  NKCLE  127



>dbj|BAM74646.1| type-A response regulator [Torenia fournieri]
Length=141

 Score =   152 bits (385),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 4/116 (3%)
 Frame = +1

Query  112  NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT  291
            + ++E +HVLAVDD+ I+  I+EKLLK+SSCKVTT ENG RALEYLGL  GD Q+ S + 
Sbjct  2    DAKEEQVHVLAVDDNLIDRTIVEKLLKNSSCKVTTVENGRRALEYLGL--GDDQNISSDD  59

Query  292  NVP--KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            N    KVN+IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSEN+P+RIN+C+E
Sbjct  60   NAAASKVNMIITDYCMPGMTGYELLKKIKESSVMKDVPVVIMSSENVPTRINKCLE  115



>ref|XP_009590654.1| PREDICTED: two-component response regulator ARR17-like [Nicotiana 
tomentosiformis]
Length=154

 Score =   153 bits (386),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  ++EKLLK SSCKVTTAE+G+RALEYLGL  G    +S N N  KVN+
Sbjct  24   HVLAVDDNLVDRKLVEKLLKKSSCKVTTAEDGLRALEYLGL--GAHHDSSTNCNGSKVNM  81

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RINQCME
Sbjct  82   IITDYCMPGMTGYELLKKIKESSIMKDVPVVIMSSENIPTRINQCME  128



>emb|CBI25350.3| unnamed protein product [Vitis vinifera]
Length=141

 Score =   152 bits (384),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  10   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  67

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLK+VK S++ K+VPVV+MSSENIP+RIN+C+E
Sbjct  68   IITDYCMPGMTGYELLKRVKQSSILKEVPVVIMSSENIPTRINKCLE  114



>ref|XP_002280746.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Vitis vinifera]
Length=153

 Score =   152 bits (385),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  22   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  79

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLK+VK S++ K+VPVV+MSSENIP+RIN+C+E
Sbjct  80   IITDYCMPGMTGYELLKRVKQSSILKEVPVVIMSSENIPTRINKCLE  126



>gb|KJB60209.1| hypothetical protein B456_009G294000 [Gossypium raimondii]
Length=162

 Score =   152 bits (385),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  ++EKLLK+SSCKVTTAENG+RALE+LGL  G  + NS    V KVNL
Sbjct  30   HVLAVDDNLIDRTLVEKLLKNSSCKVTTAENGLRALEFLGL--GSDERNSLEGTVSKVNL  87

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RINQC+E
Sbjct  88   VITDYCMPGMTGYELLKKIKESSVLKEVPVVIMSSENIPTRINQCLE  134



>ref|XP_009623473.1| PREDICTED: two-component response regulator ARR17 [Nicotiana 
tomentosiformis]
Length=148

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  ++E+LLK SSCKVTTAENG+RALEYLGL  G  Q +S N N  KVN+
Sbjct  16   HVLAVDDNLVDRKLVERLLKKSSCKVTTAENGLRALEYLGL--GADQEHSTNGNGSKVNM  73

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI++C+E
Sbjct  74   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDECLE  120



>ref|XP_009774749.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Nicotiana sylvestris]
Length=148

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  ++EKLLK SSCKVTTAE+G+RALEYLGL  G    +S N+N  KVN+
Sbjct  18   HVLAVDDNLVDRKLVEKLLKKSSCKVTTAEDGLRALEYLGL--GAHHDSSTNSNGSKVNM  75

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ KDVPVV++SSENIP+RINQCME
Sbjct  76   IITDYCMPGMTGYELLKKIKESSIMKDVPVVIVSSENIPTRINQCME  122



>ref|XP_010103657.1| Two-component response regulator [Morus notabilis]
 gb|EXB96540.1| Two-component response regulator [Morus notabilis]
Length=154

 Score =   151 bits (381),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  ++EKLL++SSC+VTTAENG RALE+LGL  GD +HN+   NV KVNL
Sbjct  22   HVLAVDDNVIDRKLVEKLLQNSSCRVTTAENGPRALEFLGL--GDHRHNALEGNVSKVNL  79

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GY+LLKK+K+S++ K+VPVV+MSSEN+P+RIN+C+E
Sbjct  80   IITDYCMPGMTGYDLLKKIKESSVMKEVPVVIMSSENVPTRINKCLE  126



>ref|XP_010427458.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Camelina sativa]
Length=151

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  294
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q + P  +TN
Sbjct  12   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-GGDPQQSDPVTSTN  70

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RIN+C+
Sbjct  71   VMKVNLIITDYCMPGMTGFELLKKVKESSKLKEVPVVILSSENIPTRINKCL  122



>ref|XP_007136418.1| hypothetical protein PHAVU_009G043400g [Phaseolus vulgaris]
 gb|ESW08412.1| hypothetical protein PHAVU_009G043400g [Phaseolus vulgaris]
Length=147

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 4/126 (3%)
 Frame = +1

Query  76   MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  255
            MA PSSS  + E+  D V HVLAVDD+ I+  ++EKLL++SSCKVTTAENG RALE LGL
Sbjct  1    MAAPSSSNWVMESAHD-VPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALELLGL  59

Query  256  LAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  435
             +G    NS N    KVNL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+R
Sbjct  60   TSGG--QNSMNGR-SKVNLVITDYCMPGMTGYELLKKIKESSVMKEVPVVIMSSENIPTR  116

Query  436  INQCME  453
            IN+C+E
Sbjct  117  INKCLE  122



>ref|XP_010507480.1| PREDICTED: two-component response regulator ARR17 [Camelina sativa]
Length=151

 Score =   150 bits (379),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  294
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q + P  +TN
Sbjct  12   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-GGDPQQSDPVTSTN  70

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RIN+C+
Sbjct  71   VMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRINKCL  122



>ref|NP_567037.1| two-component response regulator ARR17 [Arabidopsis thaliana]
 sp|Q9FPR6.1|ARR17_ARATH RecName: Full=Two-component response regulator ARR17 [Arabidopsis 
thaliana]
 gb|AAG40613.1|AF305722_1 response regulator 17 [Arabidopsis thaliana]
 gb|AEE79515.1| two-component response regulator ARR17 [Arabidopsis thaliana]
Length=153

 Score =   150 bits (379),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
             C S S +   + E+E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL 
Sbjct  4    GCGSGSDSCLSSMEEE-LHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-  61

Query  259  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
             GD Q     TNV KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RI
Sbjct  62   -GDPQQTDSLTNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRI  120

Query  439  NQCM  450
            N+C+
Sbjct  121  NKCL  124



>ref|XP_010322112.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Solanum lycopersicum]
Length=129

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  88   SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  267
            S S  MGE    E  HVLAVDD+ ++  ++E LLK SSCKVTTAE+G+RALEYLGL A  
Sbjct  9    SISKGMGEVVASEEPHVLAVDDNLVDRKLVEILLKKSSCKVTTAEDGLRALEYLGLAAH-  67

Query  268  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
             Q +S N+N  KVN+IITDY MPGM GYELLKK+K+S+M KDVPVV+MSSENIP+RI+Q
Sbjct  68   -QDSSKNSNGSKVNMIITDYCMPGMTGYELLKKIKESSMMKDVPVVIMSSENIPTRIHQ  125



>ref|XP_011084814.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR17 [Sesamum indicum]
Length=137

 Score =   149 bits (375),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  I+EKLLK+SSCKVTTAEN  RALEYLGL+ G+  HNS   N  KV++
Sbjct  9    HVLAVDDNSLDRKIVEKLLKNSSCKVTTAENAQRALEYLGLVDGN--HNSTTHNASKVSM  66

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+ IN+C+E
Sbjct  67   IITDYCMPGMTGYELLKKIKESSIMKNVPVVIMSSENVPTXINECLE  113



>ref|XP_008233888.1| PREDICTED: two-component response regulator ARR17 [Prunus mume]
Length=157

 Score =   149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E  HVLAVDD  I+  +IEKLLK+ SCKVTTAENG+RALE+LGL  GD Q++S   N+ K
Sbjct  21   EQAHVLAVDDSIIDRKLIEKLLKNLSCKVTTAENGLRALEFLGL--GDHQNSSLEGNISK  78

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            VNL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSE +P+RIN+C+E
Sbjct  79   VNLVITDYCMPGMTGYELLKKIKESSLMKEVPVVIMSSEYVPNRINKCLE  128



>ref|XP_010658172.1| PREDICTED: two-component response regulator ARR17 isoform X2 
[Vitis vinifera]
Length=152

 Score =   148 bits (374),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 3/107 (3%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  22   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  79

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLK+VK S++ K+VPVV+MSSENIP+RIN+C+E
Sbjct  80   IITDYCMPGMTGYELLKRVK-SSILKEVPVVIMSSENIPTRINKCLE  125



>ref|XP_009362787.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=155

 Score =   148 bits (373),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  306
            HVLAVDD  I+  +IEKLL + SCKVTTAENG RALE+LGL  GD QHNS  +NV   KV
Sbjct  21   HVLAVDDSLIDRKLIEKLLTNLSCKVTTAENGARALEFLGL--GDQQHNSLESNVSNSKV  78

Query  307  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RI++C+E
Sbjct  79   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPNRIDKCLE  127



>ref|XP_008388361.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Malus domestica]
Length=156

 Score =   148 bits (373),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  306
            HVLAVDD  I+  +IEKLL + SCKVTTAENG RALE+LGL  GD QHNS  +NV   KV
Sbjct  22   HVLAVDDSLIDRKLIEKLLTNLSCKVTTAENGARALEFLGL--GDQQHNSLESNVSNSKV  79

Query  307  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RI++C+E
Sbjct  80   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPNRIDKCLE  128



>ref|XP_009349081.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=156

 Score =   148 bits (373),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  306
            HVLAVDD  I+  +IEKLL + SCKVTTAENG RALE+LGL  GD QHNS  +NV   KV
Sbjct  22   HVLAVDDSLIDRKLIEKLLTNLSCKVTTAENGARALEFLGL--GDQQHNSLESNVSNSKV  79

Query  307  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RI++C+E
Sbjct  80   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPNRIDKCLE  128



>ref|XP_007219229.1| hypothetical protein PRUPE_ppa017797mg [Prunus persica]
 gb|EMJ20428.1| hypothetical protein PRUPE_ppa017797mg [Prunus persica]
Length=159

 Score =   148 bits (373),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD  I+  +IEKLLK+ SCKVTTAENG+RALE+LGL  GD Q++S   N+ KVNL
Sbjct  26   HVLAVDDSIIDRKLIEKLLKNLSCKVTTAENGLRALEFLGL--GDHQNSSLEGNISKVNL  83

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSE +P+RIN+C+E
Sbjct  84   VITDYCMPGMTGYELLKKIKESSLMKEVPVVIMSSEYVPNRINKCLE  130



>ref|XP_006292820.1| hypothetical protein CARUB_v10019069mg, partial [Capsella rubella]
 gb|EOA25718.1| hypothetical protein CARUB_v10019069mg, partial [Capsella rubella]
Length=148

 Score =   147 bits (372),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 93/112 (83%), Gaps = 4/112 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  294
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   P  +TN
Sbjct  10   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQTDPVTSTN  67

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELL+KVK+S+  K VPVV++SSENIP+RIN+C+
Sbjct  68   VMKVNLIITDYCMPGMTGFELLQKVKESSNLKGVPVVILSSENIPTRINKCL  119



>ref|XP_002879884.1| hypothetical protein ARALYDRAFT_483126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56143.1| hypothetical protein ARALYDRAFT_483126 [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  109  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN  288
             +G DE +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL   +   ++  
Sbjct  21   HHGHDEELHVLAVDDNLIDRKLVERLLKISSCKVTTAENAIRALEYLGLGDQNQHIDALT  80

Query  289  TNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
             NV KVNLIITDY MPGM G+ELLKKVK+S+  +++PVV+MSSENIP+RIN+C+
Sbjct  81   CNVMKVNLIITDYCMPGMTGFELLKKVKESSNLRELPVVIMSSENIPTRINKCL  134



>ref|XP_009363791.1| PREDICTED: two-component response regulator ARR17 [Pyrus x bretschneideri]
Length=153

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 97/128 (76%), Gaps = 5/128 (4%)
 Frame = +1

Query  76   MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  255
            M   SSS + G     E  HVLAVDD  ++  +IEKLL + SCKVTTAENG  ALE+LGL
Sbjct  1    MEAASSSSSKGFMANVEQPHVLAVDDSLVDRKLIEKLLTNLSCKVTTAENGASALEFLGL  60

Query  256  LAGDVQHNSPNTNVP--KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIP  429
              GD QHNS  +NV   KVNL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP
Sbjct  61   --GD-QHNSLESNVSNSKVNLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENIP  117

Query  430  SRINQCME  453
            +RIN+C+E
Sbjct  118  NRINKCLE  125



>ref|XP_010427456.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Camelina sativa]
Length=152

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP--NTN  294
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLG L GD Q + P  +TN
Sbjct  12   EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLG-LGGDPQQSDPVTSTN  70

Query  295  VPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLKKVK +S+  K+VPVV++SSENIP+RIN+C+
Sbjct  71   VMKVNLIITDYCMPGMTGFELLKKVKQESSKLKEVPVVILSSENIPTRINKCL  123



>emb|CAB88041.1| response regulator-like protein [Arabidopsis thaliana]
Length=122

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 3/122 (2%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
             C S S +   + E+E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL 
Sbjct  4    GCGSGSDSCLSSMEEE-LHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL-  61

Query  259  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
             GD Q     TNV KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RI
Sbjct  62   -GDPQQTDSLTNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRI  120

Query  439  NQ  444
            N+
Sbjct  121  NK  122



>emb|CAN60564.1| hypothetical protein VITISV_013996 [Vitis vinifera]
Length=154

 Score =   146 bits (369),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 3/108 (3%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  +IEKLLK+ SC+VTTAENG+RALEYLGL  GD Q  S   +V KVNL
Sbjct  22   HVLAVDDNLIDRKLIEKLLKNFSCRVTTAENGLRALEYLGL--GDNQQTSHKASVSKVNL  79

Query  313  IITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLK+ K  S++ K+VPVV+MSSENIP+RIN+C+E
Sbjct  80   IITDYCMPGMTGYELLKRXKQQSSILKEVPVVIMSSENIPTRINKCLE  127



>ref|XP_009768330.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Nicotiana sylvestris]
Length=121

 Score =   145 bits (366),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  ++E+LLK SSCKVTTAENG+RALEYLGL  G  Q +S N N  KVN+
Sbjct  13   HVLAVDDNLVDRKLVERLLKKSSCKVTTAENGLRALEYLGL--GAEQEHSTNGNGSKVNM  70

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
            IITDY MPGM GYELLKK+K+S++ KDVPVV+MSSENIP+RI+ 
Sbjct  71   IITDYCMPGMTGYELLKKIKESSILKDVPVVIMSSENIPTRIDH  114



>ref|XP_002876364.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52623.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=149

 Score =   146 bits (368),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 97/124 (78%), Gaps = 7/124 (6%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
             C S S +   + E+E +HVLAVDD+ I+   +E++LK SSCKVTTAENG+RALEYLGL 
Sbjct  4    GCGSGSESCLSSMEEE-LHVLAVDDNLIDRKFLERILKISSCKVTTAENGLRALEYLGL-  61

Query  259  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
             GD Q     TNV KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV++SSENIP+RI
Sbjct  62   -GDPQQ----TNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRI  116

Query  439  NQCM  450
            N+C+
Sbjct  117  NKCL  120



>ref|NP_001236551.1| uncharacterized protein LOC100499827 [Glycine max]
 gb|ACU13822.1| unknown [Glycine max]
Length=146

 Score =   145 bits (367),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 100/126 (79%), Gaps = 5/126 (4%)
 Frame = +1

Query  76   MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  255
            MA  SSS  + E+G+  V HVLAVDD+ I+  ++EKLL++SSCKVTTAENG RALE LGL
Sbjct  1    MAASSSSNWVMESGD--VPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALELLGL  58

Query  256  LAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  435
             +G    N+ N    KVN+IITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+R
Sbjct  59   TSGG--QNNMNGR-SKVNMIITDYCMPGMTGYELLKKIKESSVMKEVPVVIMSSENIPTR  115

Query  436  INQCME  453
            IN+C+E
Sbjct  116  INKCLE  121



>ref|XP_010525415.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Tarenaya hassleriana]
Length=155

 Score =   145 bits (367),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 98/124 (79%), Gaps = 7/124 (6%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
            +CPS  +   ENG  E +HVLAVDD+ ++  ++EKLLK SSCKVTTAENG+RALEYLGL 
Sbjct  10   SCPSMEVPY-ENGNGE-LHVLAVDDNLVDRKLVEKLLKISSCKVTTAENGLRALEYLGL-  66

Query  259  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
             GD +      N+ KVNLIITDY MPGM G+ELLK+VK+S+  ++VPVV+MSSENIP+RI
Sbjct  67   -GDQEQTK---NISKVNLIITDYCMPGMTGFELLKRVKESSGLREVPVVIMSSENIPTRI  122

Query  439  NQCM  450
            ++C+
Sbjct  123  DKCL  126



>ref|XP_007011279.1| Two-component response regulator ARR17 [Theobroma cacao]
 gb|EOY20089.1| Two-component response regulator ARR17 [Theobroma cacao]
Length=237

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 102/142 (72%), Gaps = 17/142 (12%)
 Frame = +1

Query  73   IMACPSS---------SMAMGENGEDEVI------HVLAVDDDPINLIIIEKLLKSSSCK  207
            I+ C SS          MA G   +D  +      HVLAVDD+ I+  ++EKLLK+SSCK
Sbjct  70   ILPCSSSDYCLARRFQRMAGGGCSKDTAVDFGDQPHVLAVDDNLIDRKLVEKLLKNSSCK  129

Query  208  VTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMF  387
            VTTAENG+RALEYLGL  G+ Q ++    V KVNLIITDY MPGM GYELLKK+K+S++ 
Sbjct  130  VTTAENGLRALEYLGL--GNDQRSAMEGTVSKVNLIITDYCMPGMTGYELLKKIKESSVL  187

Query  388  KDVPVVVMSSENIPSRINQCME  453
            K+VPVV+MSSEN P+RI+QC+E
Sbjct  188  KEVPVVIMSSENSPTRISQCLE  209



>ref|XP_011009512.1| PREDICTED: two-component response regulator ARR17-like [Populus 
euphratica]
Length=163

 Score =   146 bits (368),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 4/111 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            DE  HVLAVDD  I+  +IE+LL +S+C+VTTAENG RALEYLGL   D QH  PN +  
Sbjct  16   DEKPHVLAVDDSFIDRKVIERLLINSTCRVTTAENGKRALEYLGL--ADGQH--PNHSDL  71

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            KVN+IITDYSMPGM GYELLK++K+S   K++PVVV+SSENIP+RINQCME
Sbjct  72   KVNMIITDYSMPGMTGYELLKRIKESPTMKEIPVVVVSSENIPTRINQCME  122



>ref|XP_002326060.1| hypothetical protein POPTR_0019s15410g [Populus trichocarpa]
 gb|EEF00442.1| hypothetical protein POPTR_0019s15410g [Populus trichocarpa]
Length=151

 Score =   145 bits (365),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 3/111 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            DE  HVLAVDD  I+  +IE+LL +S+C+VTTAENG RALEYLGL   D QH S + ++ 
Sbjct  16   DEKPHVLAVDDSLIDRKVIERLLINSTCRVTTAENGKRALEYLGL--ADGQHPSHSQDL-  72

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            KVN+IITDYSMPGM GYELLK++K+S   K++PVVV+SSENIP+RINQCME
Sbjct  73   KVNMIITDYSMPGMTGYELLKRIKESPTMKEIPVVVVSSENIPTRINQCME  123



>ref|NP_001241393.1| uncharacterized protein LOC100778707 [Glycine max]
 gb|ACU18991.1| unknown [Glycine max]
 gb|KHN25805.1| Two-component response regulator ARR17 [Glycine soja]
Length=146

 Score =   145 bits (365),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 100/126 (79%), Gaps = 5/126 (4%)
 Frame = +1

Query  76   MACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGL  255
            MA  SSS  + E+G+  V HVLAVDD+ I+  ++EKLL++SSCKVTTAENG RALE LGL
Sbjct  1    MAAGSSSNWVMESGD--VPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPRALELLGL  58

Query  256  LAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  435
             +G    N+ N    KVN++ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+R
Sbjct  59   TSGG--QNTMNGR-SKVNMVITDYCMPGMTGYELLKKIKESSVTKEVPVVIMSSENIPTR  115

Query  436  INQCME  453
            IN+C+E
Sbjct  116  INKCLE  121



>ref|XP_009774750.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Nicotiana sylvestris]
Length=119

 Score =   144 bits (362),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 88/104 (85%), Gaps = 2/104 (2%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  ++EKLLK SSCKVTTAE+G+RALEYLGL  G    +S N+N  KVN+
Sbjct  18   HVLAVDDNLVDRKLVEKLLKKSSCKVTTAEDGLRALEYLGL--GAHHDSSTNSNGSKVNM  75

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
            IITDY MPGM GYELLKK+K+S++ KDVPVV++SSENIP+RINQ
Sbjct  76   IITDYCMPGMTGYELLKKIKESSIMKDVPVVIVSSENIPTRINQ  119



>ref|NP_181599.1| two-component response regulator ARR16 [Arabidopsis thaliana]
 sp|Q9SHC2.1|ARR16_ARATH RecName: Full=Two-component response regulator ARR16 [Arabidopsis 
thaliana]
 gb|AAG40612.1|AF305721_1 response regulator 16 [Arabidopsis thaliana]
 emb|CAC10396.1| putative type A response regulator [Arabidopsis thaliana]
 gb|ACF88487.1| At2g40670 [Arabidopsis thaliana]
 gb|AEC09862.1| two-component response regulator ARR16 [Arabidopsis thaliana]
Length=164

 Score =   145 bits (365),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = +1

Query  109  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NS  282
             +G DE +HVLAVDD+ I+  ++E+LLK S CKVTTAEN +RALEYLGL  GD  QH ++
Sbjct  22   HHGHDEELHVLAVDDNLIDRKLVERLLKISCCKVTTAENALRALEYLGL--GDQNQHIDA  79

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
               NV KV+LIITDY MPGM G+ELLKKVK+S+  ++VPVV+MSSENIP+RIN+C+
Sbjct  80   LTCNVMKVSLIITDYCMPGMTGFELLKKVKESSNLREVPVVIMSSENIPTRINKCL  135



>ref|XP_004308985.1| PREDICTED: two-component response regulator ARR17 [Fragaria vesca 
subsp. vesca]
Length=149

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 7/108 (6%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN-TNVPKVN  309
            HVLAVDD  I+  +IEKLLK+ SCKVTTAENG RALE+LGL  GD     PN  NV KVN
Sbjct  20   HVLAVDDSDIDRKLIEKLLKNFSCKVTTAENGARALEFLGL--GD----HPNHCNVSKVN  73

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            L+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RIN+C+E
Sbjct  74   LVITDYCMPGMTGYELLKKIKESSVMKEVPVVIMSSENIPNRINKCLE  121



>ref|XP_009116343.1| PREDICTED: two-component response regulator ARR17 isoform X2 
[Brassica rapa]
Length=140

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 92/112 (82%), Gaps = 4/112 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH--NSPNTN  294
            +E +HVLAVDD+ ++  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   +S   N
Sbjct  2    EEELHVLAVDDNLMDRKLVERILKISSCKVTTAENGIRALEYLGL--GDSQQADSSSTNN  59

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLK VK+S+  K+VPVV++SSENIP+RIN+C+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKESSNLKEVPVVILSSENIPTRINKCL  111



>ref|XP_008369375.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Malus domestica]
Length=152

 Score =   143 bits (361),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 90/109 (83%), Gaps = 5/109 (5%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  306
            HVLAVDD  ++  +IEKLL + SCKVTTAENG  ALE+LGL  GD QHNS  +NV   KV
Sbjct  19   HVLAVDDSLVDRKLIEKLLTNLSCKVTTAENGASALEFLGL--GD-QHNSLESNVSNSKV  75

Query  307  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RIN+C+E
Sbjct  76   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPTRINKCLE  124



>ref|XP_006402992.1| hypothetical protein EUTSA_v10006466mg [Eutrema salsugineum]
 gb|ESQ44445.1| hypothetical protein EUTSA_v10006466mg [Eutrema salsugineum]
Length=140

 Score =   143 bits (360),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 4/112 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH--NSPNTN  294
            +E +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   +   TN
Sbjct  2    EEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQIDSLTTTN  59

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLK VK+S+  K+VPVV++SSENIP+RIN+C+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKESSNLKEVPVVILSSENIPTRINKCL  111



>ref|XP_008388362.1| PREDICTED: two-component response regulator ARR17-like isoform 
X2 [Malus domestica]
Length=139

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 4/106 (4%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--KV  306
            HVLAVDD  I+  +IEKLL + SCKVTTAENG RALE+LGL  GD QHNS  +NV   KV
Sbjct  22   HVLAVDDSLIDRKLIEKLLTNLSCKVTTAENGARALEFLGL--GDQQHNSLESNVSNSKV  79

Query  307  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
            NL+ITDY MPGM GYELLKK+K+S++ K+VPVV+MSSEN+P+RI++
Sbjct  80   NLVITDYCMPGMTGYELLKKIKESSIMKEVPVVIMSSENVPNRIDK  125



>ref|XP_006411334.1| hypothetical protein EUTSA_v10017348mg [Eutrema salsugineum]
 gb|ESQ52787.1| hypothetical protein EUTSA_v10017348mg [Eutrema salsugineum]
Length=160

 Score =   143 bits (360),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +1

Query  109  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN  288
            ++G +E +HVLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL   +   ++  
Sbjct  19   DHGHEE-LHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQNQHIDALT  77

Query  289  TNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
             NV KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSE+IP+RIN+C+
Sbjct  78   NNVMKVNLIITDYCMPGMTGFELLKKVKESSDLKEVPVVIMSSESIPTRINKCL  131



>ref|XP_009139105.1| PREDICTED: two-component response regulator ARR17 isoform X2 
[Brassica rapa]
Length=140

 Score =   142 bits (358),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 92/112 (82%), Gaps = 4/112 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN-SPNTN-  294
            DE +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   S  TN 
Sbjct  2    DEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQTESLTTNS  59

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLK VK+S+  K+VPVV++SSENIP+RIN+C+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKESSNLKEVPVVILSSENIPTRINKCL  111



>gb|KFK36940.1| hypothetical protein AALP_AA4G192000 [Arabis alpina]
Length=154

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
            +C S      ++   E  HVLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL 
Sbjct  6    SCSSLMEVDYDHHSHEEFHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGL-  64

Query  259  AGDV-QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPS  432
             GD  QH    TN   KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+
Sbjct  65   -GDQNQHIDALTNHDLKVNLIITDYCMPGMTGFELLKKVKESSYLKEVPVVIMSSENIPT  123

Query  433  RINQCM  450
            R+N+C+
Sbjct  124  RVNKCL  129



>ref|XP_010525414.1| PREDICTED: two-component response regulator ARR17-like isoform 
X1 [Tarenaya hassleriana]
Length=156

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 8/125 (6%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
            +CPS  +   ENG  E +HVLAVDD+ ++  ++EKLLK SSCKVTTAENG+RALEYLGL 
Sbjct  10   SCPSMEVPY-ENGNGE-LHVLAVDDNLVDRKLVEKLLKISSCKVTTAENGLRALEYLGL-  66

Query  259  AGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSR  435
             GD +      N+ KVNLIITDY MPGM G+ELLK+VK +S+  ++VPVV+MSSENIP+R
Sbjct  67   -GDQEQTK---NISKVNLIITDYCMPGMTGFELLKRVKQESSGLREVPVVIMSSENIPTR  122

Query  436  INQCM  450
            I++C+
Sbjct  123  IDKCL  127



>ref|XP_006295142.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
 gb|EOA28040.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
Length=161

 Score =   141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 92/117 (79%), Gaps = 5/117 (4%)
 Frame = +1

Query  109  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHNSP  285
            ++   E IHVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH   
Sbjct  18   DDDHHEEIHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDA  75

Query  286  NT--NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
             T  N  KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  76   LTTNNDLKVNLIITDYCMPGMTGFELLKKVKESSYLKEVPVVIMSSENIPTRINKCL  132



>ref|XP_010508821.1| PREDICTED: two-component response regulator ARR16 isoform X2 
[Camelina sativa]
Length=164

 Score =   141 bits (355),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 4/111 (4%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NSPNTNV  297
            E +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH ++   N 
Sbjct  27   EELHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDALTNND  84

Query  298  PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
             KVNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  85   LKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCL  135



>ref|NP_001189722.1| two-component response regulator ARR16 [Arabidopsis thaliana]
 gb|AEC09863.1| two-component response regulator ARR16 [Arabidopsis thaliana]
Length=165

 Score =   140 bits (354),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = +1

Query  109  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NS  282
             +G DE +HVLAVDD+ I+  ++E+LLK S CKVTTAEN +RALEYLGL  GD  QH ++
Sbjct  22   HHGHDEELHVLAVDDNLIDRKLVERLLKISCCKVTTAENALRALEYLGL--GDQNQHIDA  79

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
               NV KV+LIITDY MPGM G+ELLKKVK +S+  ++VPVV+MSSENIP+RIN+C+
Sbjct  80   LTCNVMKVSLIITDYCMPGMTGFELLKKVKQESSNLREVPVVIMSSENIPTRINKCL  136



>ref|XP_010517508.1| PREDICTED: two-component response regulator ARR16-like isoform 
X2 [Camelina sativa]
Length=165

 Score =   140 bits (353),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NSPNTNVPK  303
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH ++   N  K
Sbjct  30   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDALTNNDLK  87

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            VNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  88   VNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCL  136



>ref|XP_010505820.1| PREDICTED: two-component response regulator ARR16-like isoform 
X2 [Camelina sativa]
Length=164

 Score =   140 bits (353),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NSPNTNVPK  303
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH ++   N  K
Sbjct  29   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDALTNNDLK  86

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            VNLIITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  87   VNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCL  135



>emb|CDP04042.1| unnamed protein product [Coffea canephora]
Length=155

 Score =   140 bits (352),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 6/121 (5%)
 Frame = +1

Query  97   MAMGENGE--DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  270
            MA    G   DE  HVLAVDD  ++  +IEKL  SS+CKVTTAENG RALE LGL  GD 
Sbjct  1    MASSSRGRESDERPHVLAVDDSLVDRRLIEKLFTSSACKVTTAENGQRALEVLGL--GDG  58

Query  271  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            QH S    V ++NLIITDY MPGM GYELLKKVK+S+  +++PVV++SSEN+P+RI +C+
Sbjct  59   QHAS--NCVSEINLIITDYCMPGMTGYELLKKVKESSRLREIPVVIVSSENVPTRIKECL  116

Query  451  E  453
            E
Sbjct  117  E  117



>ref|XP_009116342.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Brassica rapa]
Length=141

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH--NSPNTN  294
            +E +HVLAVDD+ ++  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   +S   N
Sbjct  2    EEELHVLAVDDNLMDRKLVERILKISSCKVTTAENGIRALEYLGL--GDSQQADSSSTNN  59

Query  295  VPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLK VK +S+  K+VPVV++SSENIP+RIN+C+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKQESSNLKEVPVVILSSENIPTRINKCL  112



>ref|XP_010670065.1| PREDICTED: two-component response regulator ARR17 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 92/113 (81%), Gaps = 4/113 (4%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G ++  HVLAVDD+ I+  +IE+LLKSSSCKVTTAEN + ALEYLG+  G+ Q N+  + 
Sbjct  23   GYEDQPHVLAVDDNVIDRKLIERLLKSSSCKVTTAENAMSALEYLGI--GEDQQNT--SK  78

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDY MPGM GY+LLKK+K+S+  ++VPVV+MSSEN+P+RI++C+E
Sbjct  79   AAKVNLILTDYCMPGMTGYDLLKKIKESSKLREVPVVIMSSENVPTRISKCLE  131



>ref|XP_009133449.1| PREDICTED: two-component response regulator ARR16 isoform X2 
[Brassica rapa]
 emb|CDY35445.1| BnaA03g19150D [Brassica napus]
Length=161

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  136  VLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNLI  315
            VLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL   D   ++   N  KVNLI
Sbjct  28   VLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQDQHIDALTNNDLKVNLI  87

Query  316  ITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            ITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  88   ITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSENIPTRINKCL  132



>gb|KJB73023.1| hypothetical protein B456_011G210000 [Gossypium raimondii]
Length=153

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ I+  ++E+LLK+SSCKVTTAEN +RAL+YLGL      +++    V +VN+
Sbjct  24   HVLAVDDNLIDRKLVERLLKNSSCKVTTAENALRALDYLGL-----GNDTLEGTVSEVNM  78

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RI+QC+E
Sbjct  79   IITDYCMPGMTGYELLKKIKESSVLKEVPVVIMSSENIPTRISQCLE  125



>ref|XP_010067618.1| PREDICTED: two-component response regulator ARR17-like [Eucalyptus 
grandis]
 gb|KCW65786.1| hypothetical protein EUGRSUZ_G03141 [Eucalyptus grandis]
Length=143

 Score =   138 bits (347),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD+ ++  +IE LLK+SSC+VTTAENG+RALEYLG+       +S +    KVNL
Sbjct  9    HVLAVDDNLVDRKMIEALLKNSSCRVTTAENGMRALEYLGIRDDQPGESSVSATTSKVNL  68

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            IITDY MPGM G+ELLKKVK S++ K+VPVV++SSEN+P+RIN+C+
Sbjct  69   IITDYCMPGMTGFELLKKVKGSSILKEVPVVIVSSENVPTRINKCL  114



>ref|XP_009139104.1| PREDICTED: two-component response regulator ARR17 isoform X1 
[Brassica rapa]
Length=141

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN-SPNTN-  294
            DE +HVLAVDD+ I+  ++E++LK SSCKVTTAENG+RALEYLGL  GD Q   S  TN 
Sbjct  2    DEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGL--GDPQQTESLTTNS  59

Query  295  VPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
            V KVNLIITDY MPGM G+ELLK VK +S+  K+VPVV++SSENIP+RIN+C+
Sbjct  60   VMKVNLIITDYCMPGMTGFELLKIVKQESSNLKEVPVVILSSENIPTRINKCL  112



>ref|XP_007208910.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica]
 gb|EMJ10109.1| hypothetical protein PRUPE_ppa027113mg, partial [Prunus persica]
Length=164

 Score =   138 bits (348),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 9/121 (7%)
 Frame = +1

Query  91   SSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  270
            S M  GE      +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D 
Sbjct  22   SQMGSGE------LHVLAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DG  72

Query  271  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            + +S   +  KVNLIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+
Sbjct  73   EKSSVGFDAMKVNLIITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILTRIDRCL  132

Query  451  E  453
            E
Sbjct  133  E  133



>gb|AAQ10676.1| type-A response regulator [Catharanthus roseus]
Length=154

 Score =   138 bits (347),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 11/127 (9%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            M ++   E +HVLAVDD+ I+  I+EKLL SSSCKVTTAENG+RALEYLG L    +  +
Sbjct  1    MADDDRKE-LHVLAVDDNIIDRKIVEKLLISSSCKVTTAENGIRALEYLGNLGVHSESQT  59

Query  283  P----NTNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPS  432
            P    +  +P      KVNLIITDY  P M GYELLKK+K+S++ KD+PV+VMSSENIP+
Sbjct  60   PALHQDDAIPTAAGDLKVNLIITDYCKPEMTGYELLKKIKESSILKDIPVIVMSSENIPT  119

Query  433  RINQCME  453
            RI++C+E
Sbjct  120  RIHKCLE  126



>ref|XP_004502823.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR17-like [Cicer arietinum]
Length=174

 Score =   138 bits (348),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            ++ HVLAVDD+ I+  ++EKLL++SSCKVTTAENG  ALE LGL +G+    S      K
Sbjct  19   DIPHVLAVDDNLIDRKLVEKLLRNSSCKVTTAENGPMALELLGLTSGE---QSTLNGESK  75

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            VNL+ITDY MPGM+GYELLKK+K S++ K+VPVV+MSSENIP+RIN+C+E
Sbjct  76   VNLVITDYCMPGMSGYELLKKIKQSSIMKEVPVVIMSSENIPTRINKCLE  125



>gb|KFK36939.1| hypothetical protein AALP_AA4G192000 [Arabis alpina]
Length=155

 Score =   137 bits (346),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +1

Query  79   ACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLL  258
            +C S      ++   E  HVLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL 
Sbjct  6    SCSSLMEVDYDHHSHEEFHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGL-  64

Query  259  AGDV-QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIP  429
             GD  QH    TN   KVNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP
Sbjct  65   -GDQNQHIDALTNHDLKVNLIITDYCMPGMTGFELLKKVKQESSYLKEVPVVIMSSENIP  123

Query  430  SRINQCM  450
            +R+N+C+
Sbjct  124  TRVNKCL  130



>gb|KDO67530.1| hypothetical protein CISIN_1g042079mg [Citrus sinensis]
Length=153

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD  ++  I+E LLK+S+CKVTTAENG+RALE+LGL+    Q N+ N+N  KVNL
Sbjct  22   HVLAVDDSIVDRKIVENLLKNSACKVTTAENGMRALEFLGLVDEQEQQNNLNSNGTKVNL  81

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +ITDY MPGM GYELLKK+K+S++ K+VPVVV+SSENIP+RIN+C+E
Sbjct  82   VITDYCMPGMTGYELLKKIKESSVMKEVPVVVVSSENIPTRINECLE  128



>ref|XP_006435932.1| hypothetical protein CICLE_v10032983mg [Citrus clementina]
 ref|XP_006486159.1| PREDICTED: two-component response regulator ARR17-like [Citrus 
sinensis]
 gb|ESR49172.1| hypothetical protein CICLE_v10032983mg [Citrus clementina]
Length=152

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD  ++  I+E LLK+S+CKVTTAENG+RALE+LGL+    Q N+ N+N  KVNL
Sbjct  21   HVLAVDDSIVDRKIVENLLKNSACKVTTAENGMRALEFLGLVDEQEQQNNLNSNGTKVNL  80

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +ITDY MPGM GYELLKK+K+S++ K+VPVVV+SSENIP+RIN+C+E
Sbjct  81   VITDYCMPGMTGYELLKKIKESSVMKEVPVVVVSSENIPTRINECLE  127



>ref|XP_002888998.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65257.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL   D  H S      KVN
Sbjct  18   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGL---DGDHGSSGLKDLKVN  74

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  75   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  121



>ref|XP_006295143.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
 gb|EOA28041.1| hypothetical protein CARUB_v10024214mg [Capsella rubella]
Length=162

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 6/118 (5%)
 Frame = +1

Query  109  ENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHNSP  285
            ++   E IHVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH   
Sbjct  18   DDDHHEEIHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDA  75

Query  286  NT--NVPKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
             T  N  KVNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  76   LTTNNDLKVNLIITDYCMPGMTGFELLKKVKQESSYLKEVPVVIMSSENIPTRINKCL  133



>ref|XP_010508820.1| PREDICTED: two-component response regulator ARR16 isoform X1 
[Camelina sativa]
Length=165

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NSPNTNV  297
            E +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH ++   N 
Sbjct  27   EELHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDALTNND  84

Query  298  PKVNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
             KVNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  85   LKVNLIITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCL  136



>ref|XP_002511471.1| two-component sensor protein histidine protein kinase, putative 
[Ricinus communis]
 gb|EEF52073.1| two-component sensor protein histidine protein kinase, putative 
[Ricinus communis]
Length=221

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 91/114 (80%), Gaps = 4/114 (4%)
 Frame = +1

Query  112  NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT  291
            NG +E +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D + +S   
Sbjct  22   NGSEE-LHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DGEKSSVGF  77

Query  292  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            N  KVNLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E
Sbjct  78   NDLKVNLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILTRIDRCLE  131



>ref|XP_006470938.1| PREDICTED: two-component response regulator ARR9-like [Citrus 
sinensis]
Length=187

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGLL  D Q NS    V 
Sbjct  6    DSQFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGNKALEFLGLLNEDEQTNS---QVI  62

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +VNLIITDY MPGM GY+LL+K+K+SA  KD+PVV+MSSENIPSRIN+C+E
Sbjct  63   QVNLIITDYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLE  113



>ref|XP_008239693.1| PREDICTED: two-component response regulator ARR5-like [Prunus 
mume]
Length=227

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 9/121 (7%)
 Frame = +1

Query  91   SSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  270
            S M  GE      +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D 
Sbjct  22   SQMGSGE------LHVLAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DG  72

Query  271  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            + +S   +  KVNLIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+
Sbjct  73   EKSSVGFDAMKVNLIITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILTRIDRCL  132

Query  451  E  453
            E
Sbjct  133  E  133



>gb|KHG14174.1| Two-component response regulator ARR6 -like protein [Gossypium 
arboreum]
Length=210

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IEKLLK SSCKVTT E+G RAL++LGL   D +  S   N  KVN
Sbjct  14   LHVLAVDDSHVDRKVIEKLLKISSCKVTTVESGARALQFLGL---DEEKGSLGFNGLKVN  70

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K S+ F+++PVV+MSSENI +RI+ C+E
Sbjct  71   LIMTDYSMPGMTGYELLKKIKRSSTFREIPVVIMSSENILTRIDSCLE  118



>gb|KJB73007.1| hypothetical protein B456_011G208900 [Gossypium raimondii]
Length=153

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 86/107 (80%), Gaps = 5/107 (5%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVL VDD  I+  ++E+LLK+SSCKVTTAEN +RA+EYL L      +++    V +VN+
Sbjct  24   HVLVVDDSLIDRKLVERLLKNSSCKVTTAENALRAVEYLRL-----GNDTLEGTVSEVNM  78

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ K+VPVV+MSSENIP+RINQC+E
Sbjct  79   IITDYCMPGMTGYELLKKIKESSVLKEVPVVIMSSENIPTRINQCLE  125



>gb|KDP31161.1| hypothetical protein JCGZ_11537 [Jatropha curcas]
Length=212

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 90/116 (78%), Gaps = 3/116 (3%)
 Frame = +1

Query  106  GENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP  285
            G +   E +HVLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL   D + +S 
Sbjct  21   GSSSCSEELHVLAVDDSFVDRKVIERLLRISSCKVTAVESGTRALQYLGL---DGEKSSV  77

Query  286  NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              N  KVNLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E
Sbjct  78   GFNDLKVNLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILTRIDRCLE  133



>ref|XP_006420721.1| hypothetical protein CICLE_v10005987mg [Citrus clementina]
 gb|ESR33961.1| hypothetical protein CICLE_v10005987mg [Citrus clementina]
Length=187

 Score =   136 bits (343),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGLL  D Q NS    V 
Sbjct  6    DSQFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGNKALEFLGLLNEDEQTNS---QVI  62

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +VNLIITDY MPGM GY+LL+K+K+SA  KD+PVV+MSSENIPSRIN+C+E
Sbjct  63   QVNLIITDYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLE  113



>gb|KDO49056.1| hypothetical protein CISIN_1g046192mg [Citrus sinensis]
Length=187

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            D   HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGLL  D Q NS    V 
Sbjct  6    DSQFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGNKALEFLGLLNEDEQTNS---QVI  62

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +VNLIITDY MPGM GY+LL+K+K+SA  KD+PVV+MSSENIPSRIN+C+E
Sbjct  63   QVNLIITDYCMPGMTGYDLLRKIKESASLKDIPVVIMSSENIPSRINRCLE  113



>ref|XP_010517507.1| PREDICTED: two-component response regulator ARR16-like isoform 
X1 [Camelina sativa]
Length=166

 Score =   135 bits (341),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 5/110 (5%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NSPNTNVPK  303
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH ++   N  K
Sbjct  30   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDALTNNDLK  87

Query  304  VNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
            VNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  88   VNLIITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCL  137



>ref|XP_010505819.1| PREDICTED: two-component response regulator ARR16-like isoform 
X1 [Camelina sativa]
Length=165

 Score =   135 bits (341),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 5/110 (5%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QH-NSPNTNVPK  303
            +HVLAVDD+ I+  ++E+LLK SSCKVTTAEN +RALEYLGL  GD  QH ++   N  K
Sbjct  29   LHVLAVDDNLIDRKLVERLLKISSCKVTTAENALRALEYLGL--GDQNQHIDALTNNDLK  86

Query  304  VNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
            VNLIITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  87   VNLIITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCL  136



>ref|XP_007208607.1| hypothetical protein PRUPE_ppa021876mg [Prunus persica]
 gb|EMJ09806.1| hypothetical protein PRUPE_ppa021876mg [Prunus persica]
Length=170

 Score =   135 bits (341),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG +G DE  HVLAVDD  ++  IIEKLL +S+CKVTTAEN   ALE LGL   D Q N 
Sbjct  19   MGWDG-DEKPHVLAVDDSFVDRRIIEKLLTNSACKVTTAENAQGALELLGL--ADGQQNF  75

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             NT V KVNLIITDYSMPGM GYELLKK+K+S   K++PVVV+SSE+IP+RI +C+E
Sbjct  76   GNT-VSKVNLIITDYSMPGMTGYELLKKIKESPTGKEIPVVVVSSEHIPTRIEKCLE  131



>ref|XP_002322144.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 gb|EEF06271.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 emb|CBX43991.1| putative A-type response regulator 10 [Populus x canadensis]
Length=223

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   N  K
Sbjct  27   EELHVLAVDDSFVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSVGFNDLK  83

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E
Sbjct  84   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILARIDRCLE  133



>gb|KJB37033.1| hypothetical protein B456_006G187400 [Gossypium raimondii]
Length=209

 Score =   137 bits (344),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IEKLLK SSCKVTT E+G RAL++LGL   D +  S   N  KVN
Sbjct  14   LHVLAVDDSHVDRKVIEKLLKISSCKVTTVESGARALQFLGL---DEEKGSLGFNGLKVN  70

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K S+ F+++PVV+MSSENI +RI+ C+E
Sbjct  71   LIMTDYSMPGMTGYELLKKIKRSSAFREIPVVIMSSENILTRIDSCLE  118



>emb|CDY22469.1| BnaC03g22790D [Brassica napus]
Length=158

 Score =   135 bits (340),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = +1

Query  136  VLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHNSPNTNVPKVNL  312
            VLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL  GD  QH +   N  KVNL
Sbjct  26   VLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGL--GDHNQHMALTNNNLKVNL  83

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            IITDY MPGM G+ELLKKVK+S+  K+VPVV+MSSE IP+RI++C+
Sbjct  84   IITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSEYIPTRISKCL  129



>ref|XP_009594904.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=225

 Score =   137 bits (345),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD  I+  +IE+LLK+SSC+VTT ++G +ALE+LGL   D  H++
Sbjct  1    MGMAAAESQFHVLAVDDSIIDRKLIERLLKTSSCQVTTVDSGSKALEFLGLQEDDKNHST  60

Query  283  P------NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
                   N    ++NLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRIN+
Sbjct  61   QPCVSLDNHQEAEINLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRINR  120

Query  445  CME  453
            C+E
Sbjct  121  CLE  123



>ref|XP_008245269.1| PREDICTED: two-component response regulator ARR17-like [Prunus 
mume]
Length=172

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG +G DE  HVLAVDD  ++  +IEKLL +S+CKVTTAEN   ALE LGL   D Q N 
Sbjct  21   MGWDG-DEKPHVLAVDDSFVDRRVIEKLLTNSACKVTTAENAQGALELLGL--ADGQQNF  77

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             NT V KVNLIITDYSMPGM GYELLKK+K+S   K++PVV++SSE+IP+RI +C+E
Sbjct  78   GNT-VSKVNLIITDYSMPGMTGYELLKKIKESPTGKEIPVVIVSSEHIPTRIEKCLE  133



>ref|XP_010111960.1| Two-component response regulator [Morus notabilis]
 gb|EXC32234.1| Two-component response regulator [Morus notabilis]
Length=226

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL++LGL   D + NS   N  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTAVESGTRALQFLGL---DGEKNSVGFNGLKVN  82

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLK++K+SA F++VPVV+MSSENI +RI++C+E
Sbjct  83   LIMTDYSMPGMTGYELLKRIKESAAFREVPVVIMSSENILTRIDRCLE  130



>emb|CDX73122.1| BnaC06g35700D [Brassica napus]
Length=177

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +1

Query  97   MAMGE--NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  270
            MA+G+  +     +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D 
Sbjct  1    MALGDLSSSSTSELHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGL---DG  57

Query  271  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
               S      KVNLI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  58   DKGSSGLKDLKVNLIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  117



>ref|XP_009133448.1| PREDICTED: two-component response regulator ARR16 isoform X1 
[Brassica rapa]
Length=162

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  136  VLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNLI  315
            VLAVDD+ I+  ++EKLLK SSCKVTTAEN +RALEYLGL   D   ++   N  KVNLI
Sbjct  28   VLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDQDQHIDALTNNDLKVNLI  87

Query  316  ITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCM  450
            ITDY MPGM G+ELLKKVK +S+  K+VPVV+MSSENIP+RIN+C+
Sbjct  88   ITDYCMPGMTGFELLKKVKQESSNLKEVPVVIMSSENIPTRINKCL  133



>ref|XP_006302845.1| hypothetical protein CARUB_v10020975mg [Capsella rubella]
 gb|EOA35743.1| hypothetical protein CARUB_v10020975mg [Capsella rubella]
Length=198

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 4/118 (3%)
 Frame = +1

Query  97   MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  276
            MA+G  G    +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G    
Sbjct  1    MALG--GFSSELHVLAVDDSFVDRKVIERLLKISACKVTTVESGARALQYLGL-DGPNGS  57

Query  277  NSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            +S  T++ KVNLI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  58   SSALTDL-KVNLIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  114



>ref|XP_007036075.1| Two-component response regulator ARR5 [Theobroma cacao]
 gb|EOY20576.1| Two-component response regulator ARR5 [Theobroma cacao]
Length=228

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IEKLLK SSCKVT  E+G RAL+YLGL  G     S   N  KVN
Sbjct  15   LHVLAVDDSHVDRKVIEKLLKISSCKVTAVESGTRALQYLGLDGG---KGSLGFNDLKVN  71

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K S+ F+++PVV+MSSENI +RI++C+E
Sbjct  72   LIMTDYSMPGMTGYELLKKIKQSSAFREIPVVIMSSENILTRIDRCLE  119



>ref|XP_002267932.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera]
Length=146

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD  I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + +++ 
Sbjct  1    MGIAAETQ-FHVLAVDDSLIDRKLIEKLLKTSSFQVTAVDSGSKALEFLGLQEEEQRNHH  59

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            P     +VNLIITDYSMPGM GY+LL+K+K+S+  KD+PVV+MSSENIPSRIN+C+E
Sbjct  60   PQET--EVNLIITDYSMPGMTGYDLLRKIKESSSLKDIPVVIMSSENIPSRINRCLE  114



>gb|ABQ95670.1| type A response regulator, partial [Malus domestica]
Length=194

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HV AVDD  ++  +IE+LLK SSCKVT  ++G RALEYLGL   D + +S   +  KVNL
Sbjct  1    HVFAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALEYLGL---DGEKSSVGFDNMKVNL  57

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+E
Sbjct  58   IITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILTRIDRCLE  104



>ref|XP_011028652.1| PREDICTED: two-component response regulator ARR5-like isoform 
X2 [Populus euphratica]
Length=228

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   N  K
Sbjct  32   EELHVLAVDDSFVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSVAFNDLK  88

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI +RI++C+E
Sbjct  89   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILARIDRCLE  138



>ref|XP_006577761.1| PREDICTED: uncharacterized protein LOC100306152 isoform X1 [Glycine 
max]
Length=204

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGLDSVKVN  77

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E
Sbjct  78   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLE  125



>ref|XP_007138131.1| hypothetical protein PHAVU_009G182800g [Phaseolus vulgaris]
 gb|ESW10125.1| hypothetical protein PHAVU_009G182800g [Phaseolus vulgaris]
Length=201

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  17   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGFDSVKVN  73

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E
Sbjct  74   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLE  121



>ref|XP_008374475.1| PREDICTED: two-component response regulator ARR5-like [Malus 
domestica]
Length=227

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 9/121 (7%)
 Frame = +1

Query  91   SSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV  270
            S M  GE      +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D 
Sbjct  22   SQMRSGE------LHVLAVDDSHVDRKVIERLLKISSCKVTAVDSGTRALQYLGL---DG  72

Query  271  QHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            + +S   +  KVNLIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+
Sbjct  73   EKSSVGFDNMKVNLIITDYSMPGMTGYELLKKIKESSXFREVPVVIMSSENILTRIDRCL  132

Query  451  E  453
            E
Sbjct  133  E  133



>gb|KJB73006.1| hypothetical protein B456_011G208900 [Gossypium raimondii]
Length=153

 Score =   133 bits (334),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 86/107 (80%), Gaps = 5/107 (5%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVL VDD  I+  ++E+LLK+SSCKVTTAEN +RA+EYL L      +++    V +VN+
Sbjct  24   HVLVVDDSLIDRKLVERLLKNSSCKVTTAENALRAVEYLRL-----GNDTLEGTVSEVNM  78

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S++ K+VPV++MSSENIP+RI+QC+E
Sbjct  79   IITDYCMPGMTGYELLKKIKESSVLKEVPVIIMSSENIPTRISQCLE  125



>ref|XP_004501966.1| PREDICTED: two-component response regulator ARR15-like [Cicer 
arietinum]
Length=202

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK +SCKVT  E+G RAL+YLGL   D   +S   +  KVN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKFTSCKVTVVESGTRALQYLGL---DGDTSSIGFDGVKVN  77

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +I+TDYSMPGM GYELLKK+K+S++F+++PVVVMSSENI +RI+ C+E
Sbjct  78   MIMTDYSMPGMTGYELLKKIKESSIFREIPVVVMSSENILTRIDSCLE  125



>ref|NP_001238384.1| uncharacterized protein LOC100306152 [Glycine max]
 gb|ACU14193.1| unknown [Glycine max]
Length=201

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGLDSVKVN  77

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E
Sbjct  78   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLE  125



>ref|XP_009803217.1| PREDICTED: two-component response regulator ARR9 [Nicotiana sylvestris]
Length=227

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    ++  HVLAVDD  I+  +IE+L ++S+C+VTT ++G +ALE+LG    D  H +
Sbjct  1    MGMVAAEQQFHVLAVDDSLIDRKLIERLFRTSACQVTTVDSGSKALEFLGFQENDHNHPN  60

Query  283  PNTNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
            P    P      ++NLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRIN+
Sbjct  61   PPCVSPHNHQEVEINLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRINR  120

Query  445  CME  453
            C+E
Sbjct  121  CLE  123



>emb|CDY45402.1| BnaA07g31820D [Brassica napus]
Length=184

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D    S      KVN
Sbjct  15   LHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGL---DGDKGSSGLKDLKVN  71

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  72   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  118



>emb|CDY21807.1| BnaA06g20760D [Brassica napus]
Length=184

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 94/130 (72%), Gaps = 8/130 (6%)
 Frame = +1

Query  64   EKKIMACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALE  243
            EK  M+  +SS+     G  E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+
Sbjct  8    EKLDMSNDTSSL-----GSPELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQ  62

Query  244  YLGLLAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSEN  423
            YLGL   D  H+S      K+NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSEN
Sbjct  63   YLGL---DGNHSSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSEN  119

Query  424  IPSRINQCME  453
            I  RI++C+E
Sbjct  120  ILPRIDRCLE  129



>ref|XP_010444157.1| PREDICTED: two-component response regulator ARR6-like [Camelina 
sativa]
Length=190

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEEKSVGFE  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLE  129



>gb|KFK28019.1| hypothetical protein AALP_AA8G460900 [Arabis alpina]
Length=191

 Score =   134 bits (336),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSSDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEDKSIGFE  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ F+ VPVV+MSSENI  RI++C+E
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFRQVPVVIMSSENILPRIDRCLE  129



>ref|XP_006394337.1| hypothetical protein EUTSA_v10004962mg [Eutrema salsugineum]
 dbj|BAJ34561.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31623.1| hypothetical protein EUTSA_v10004962mg [Eutrema salsugineum]
Length=190

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G   ++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV   +    
Sbjct  20   GSPHLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVDEKTVGLE  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ FKD+PVVVMSSENI  RI++C+E
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFKDIPVVVMSSENILPRIDRCLE  129



>ref|XP_007155382.1| hypothetical protein PHAVU_003G196500g [Phaseolus vulgaris]
 gb|ESW27376.1| hypothetical protein PHAVU_003G196500g [Phaseolus vulgaris]
Length=206

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTVVESGTRALQYLGL---DGETSSLGFDSVKVN  82

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI+ C+E
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDSCLE  130



>gb|KEH35092.1| two-component response regulator ARR3-like protein [Medicago 
truncatula]
Length=200

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK +SCKVT  E+G RAL+YLGL   D   +S   +  KVN
Sbjct  23   LHVLAVDDSFVDRKVIERLLKFTSCKVTVVESGTRALQYLGL---DGDTSSIGFDGVKVN  79

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +I+TDYSMPGM GYELLKK+K+S++F+++PVVVMSSENI +RI+ C+E
Sbjct  80   MIMTDYSMPGMTGYELLKKIKESSVFREIPVVVMSSENILTRIDSCLE  127



>ref|XP_002268352.1| PREDICTED: two-component response regulator ARR17 [Vitis vinifera]
 emb|CBI40163.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   134 bits (336),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
             HVLAVDD+ I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + +++ P     +VN
Sbjct  9    FHVLAVDDNLIDRKLIEKLLKTSSFQVTAVDSGSKALEFLGLQEEEQRNHHPQEM--EVN  66

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDYSMPGM GY+LL+K+K+S+  KD+PVV+MSSENIPSRIN+C+E
Sbjct  67   LIITDYSMPGMTGYDLLRKIKESSSLKDIPVVIMSSENIPSRINRCLE  114



>ref|XP_006390374.1| hypothetical protein EUTSA_v10019119mg [Eutrema salsugineum]
 gb|ESQ27660.1| hypothetical protein EUTSA_v10019119mg [Eutrema salsugineum]
Length=219

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    S      KVN
Sbjct  15   LHVLAVDDSFVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGSSGLKDLKVN  71

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  72   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIQQCM  118



>ref|XP_010459459.1| PREDICTED: two-component response regulator ARR6 [Camelina sativa]
Length=190

 Score =   133 bits (335),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEDKSVGFE  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLE  129



>ref|XP_009626719.1| PREDICTED: two-component response regulator ARR8-like isoform 
X2 [Nicotiana tomentosiformis]
Length=226

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 90/122 (74%), Gaps = 5/122 (4%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    ++  HVLAVDD  I+  +IE+L ++S+C+VTT ++G +ALE+LGL   +   N 
Sbjct  1    MGMAAAEQQFHVLAVDDSLIDRKLIERLFRTSACQVTTVDSGNKALEFLGLQEHENHPNP  60

Query  283  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
            P     N    +VNLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRIN+C
Sbjct  61   PHACPHNHQEVEVNLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRINRC  120

Query  448  ME  453
            +E
Sbjct  121  LE  122



>ref|XP_011088585.1| PREDICTED: two-component response regulator ARR9-like [Sesamum 
indicum]
Length=183

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +1

Query  97   MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  276
            M  G   E    HVLAVDD  I+  +IE+LLK+SS +VT  ++G++ALE+LGLL  D   
Sbjct  1    MGGGVATETHEFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGMKALEFLGLLDDDENT  60

Query  277  NSPNTNVPKV--NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            NS N++  KV  NLIITDY MP + GY+LL+K+K+S +FKD+PVV+MSSEN+PSRIN CM
Sbjct  61   NS-NSHHHKVEVNLIITDYCMPAITGYDLLRKIKESRLFKDIPVVIMSSENVPSRINSCM  119

Query  451  E  453
            E
Sbjct  120  E  120



>ref|XP_007155380.1| hypothetical protein PHAVU_003G196300g [Phaseolus vulgaris]
 gb|ESW27374.1| hypothetical protein PHAVU_003G196300g [Phaseolus vulgaris]
Length=206

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTVVESGTRALQYLGL---DGETSSLGFDSVKVN  82

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI+ C+E
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDSCLE  130



>ref|XP_009788178.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
sylvestris]
Length=210

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 88/117 (75%), Gaps = 5/117 (4%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD  I+  ++E+LLK+SSC+VTT ++G +ALE+LGL     Q + 
Sbjct  1    MGMAEAESQFHVLAVDDSIIDRKLVERLLKTSSCQVTTVDSGSKALEFLGL-----QEDG  55

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             N    ++NLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRIN+C+E
Sbjct  56   NNHQEAEINLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRINRCLE  112



>ref|XP_010416347.1| PREDICTED: two-component response regulator ARR15 [Camelina sativa]
Length=198

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 5/107 (5%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G     S      KVN
Sbjct  14   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLDKG-----SSGLKDLKVN  68

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  69   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  115



>emb|CDX76036.1| BnaA04g03000D [Brassica napus]
Length=225

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD   +  +IEKLL+ SSC+VTT ++G +ALE+LG+ + D    S
Sbjct  1    MGMAAVESQFHVLAVDDSSFDRKLIEKLLQKSSCQVTTVDSGYKALEFLGIESNDPNALS  60

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             +    +VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+RI++C+E
Sbjct  61   TSPQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPARISRCLE  117



>gb|ABG35779.1| SRR200 [Striga asiatica]
Length=158

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 90/117 (77%), Gaps = 5/117 (4%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G++   HVLAVDD  I+  +IE+LLK+SS +VT  ++GV+ALE+LGLL  D   NS + +
Sbjct  5    GQEMRFHVLAVDDSIIDRKLIERLLKTSSYQVTVVDSGVKALEFLGLLDND-DTNSKSVS  63

Query  295  VPK----VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             P+    V+LIITDYSMP + GY+LL+K+K+S + KD+PVV+MSSENIPSRIN C+E
Sbjct  64   QPRSNHIVDLIITDYSMPALTGYDLLRKIKESEILKDIPVVIMSSENIPSRINSCLE  120



>emb|CDY59856.1| BnaCnng35610D [Brassica napus]
Length=183

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 94/130 (72%), Gaps = 8/130 (6%)
 Frame = +1

Query  64   EKKIMACPSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALE  243
            EK  M+  +SS+     G  E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+
Sbjct  8    EKLDMSNDTSSL-----GSPELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQ  62

Query  244  YLGLLAGDVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSEN  423
            YLGL   D  H+S      K+NLI+TDYSMPGM GYEL+KK+K+S+ F+++PVV+MSSEN
Sbjct  63   YLGL---DGNHSSVGFEDLKINLIMTDYSMPGMTGYELMKKIKESSAFREIPVVIMSSEN  119

Query  424  IPSRINQCME  453
            I  RI++C+E
Sbjct  120  ILPRIDRCLE  129



>ref|XP_009139049.1| PREDICTED: two-component response regulator ARR9-like [Brassica 
rapa]
Length=234

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD   +  +IEKLL+ SSC+VTT ++G +ALE+LG+ + D    S
Sbjct  1    MGMAAVESQFHVLAVDDSSFDRKLIEKLLQKSSCQVTTVDSGYKALEFLGIESNDPNALS  60

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             +    +VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+RI++C+E
Sbjct  61   TSPQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPARISRCLE  117



>gb|AAQ10677.1| type-A response regulator [Catharanthus roseus]
Length=188

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN-TNVPKV  306
             HVLAVDD  ++  +IE+LLK+S+ +VT  ++G++ALE+LGLL  + + +  N   V +V
Sbjct  10   FHVLAVDDSLVDRKLIERLLKTSAYQVTVVDSGIKALEFLGLLDEEKEISGSNHQQVVEV  69

Query  307  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            NLIITDYSMPGM GY+LL+KVK+S+  KD+PVV+MSSENIPSRIN+C+E
Sbjct  70   NLIITDYSMPGMTGYDLLRKVKESSYLKDIPVVIMSSENIPSRINRCLE  118



>emb|CDX85860.1| BnaC06g22740D [Brassica napus]
Length=218

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD+ ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D  + S      KVN
Sbjct  44   LHVLAVDDNFVDRKVIERLLRISACKVTTVESGTRALQYLGL---DGDNGSSALKDLKVN  100

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  101  LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  147



>ref|XP_003549646.1| PREDICTED: two-component response regulator ARR15-like isoformX1 
[Glycine max]
Length=206

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 88/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   + ++ S   +  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTVVESGTRALQYLGL---EGENGSLGFDSVKVN  82

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI++C+E
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDRCLE  130



>ref|XP_002876392.1| hypothetical protein ARALYDRAFT_486148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52651.1| hypothetical protein ARALYDRAFT_486148 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 86/116 (74%), Gaps = 9/116 (8%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT------  291
             HVLAVDD   +   IE+LL+ SSC+VTT ++G +ALE+LGL  G +  N PN       
Sbjct  7    FHVLAVDDSLFDRKYIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IDSNDPNALSKSPV  65

Query  292  --NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
               V +VNLIITDY MPGM GY+LLKKVK+S+ F+D+PVV+MSSEN+P+RI++C+E
Sbjct  66   THQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISRCLE  121



>emb|CDX72077.1| BnaC08g27970D [Brassica napus]
Length=235

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAG-DVQHN  279
            MG    +   HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL  G +  H 
Sbjct  1    MGMAAAEWKFHVLAVDDSLVDRKLIERLLQKSSCQVTTVDSGYKALEFLGLRQGIESSHP  60

Query  280  ---SPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
               SP+    +VNLIITDY MPGM GY+LLKK+K+SA FK +PVV+MSSEN+P+RI++C+
Sbjct  61   TALSPSPQEVEVNLIITDYCMPGMTGYDLLKKLKESAAFKSIPVVIMSSENVPARISRCL  120

Query  451  E  453
            E
Sbjct  121  E  121



>ref|XP_009626718.1| PREDICTED: two-component response regulator ARR8-like isoform 
X1 [Nicotiana tomentosiformis]
Length=229

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 8/125 (6%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQ---  273
            MG    ++  HVLAVDD  I+  +IE+L ++S+C+VTT ++G +ALE+LGL   +     
Sbjct  1    MGMAAAEQQFHVLAVDDSLIDRKLIERLFRTSACQVTTVDSGNKALEFLGLQEHENHPNP  60

Query  274  -----HNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
                 HN  N    +VNLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRI
Sbjct  61   PHACPHNHQNLQEVEVNLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRI  120

Query  439  NQCME  453
            N+C+E
Sbjct  121  NRCLE  125



>gb|ABG33766.1| reponse regulator 6 [Musa acuminata]
Length=156

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 4/112 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNV----  297
             HVLAVDD  ++  +IE+LLK+SS +VTT ++G +AL++LGL A D   +S + +     
Sbjct  34   FHVLAVDDSVLDRKLIERLLKTSSFQVTTVDSGTKALQFLGLHAEDASISSVHADQLDVE  93

Query  298  PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              VNLIITDY MPGM GY+LLKK+K+S+ F+D+PVV+MSSENIPSRIN+C+E
Sbjct  94   VNVNLIITDYCMPGMTGYDLLKKIKESSSFRDIPVVIMSSENIPSRINRCLE  145



>ref|XP_003527040.1| PREDICTED: two-component response regulator ARR6-like [Glycine 
max]
Length=204

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   +   VN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSIGFDSVDVN  77

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E
Sbjct  78   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLE  125



>ref|XP_009106145.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator 
ARR15 [Brassica rapa]
Length=210

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D    S      KVN
Sbjct  16   LHVLAVDDSIVDRKVIERLLRISACKVTTVESGTRALQYLGL---DGDKGSSGLKDLKVN  72

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  73   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  119



>ref|XP_010484006.1| PREDICTED: two-component response regulator ARR6-like [Camelina 
sativa]
Length=190

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEVKSVGFE  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLE  129



>ref|XP_010428484.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
 ref|XP_010428485.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
Length=201

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 5/107 (5%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G     S      KVN
Sbjct  16   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLDKG-----SSGLKDLKVN  70

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  71   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  117



>ref|XP_010471585.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
 ref|XP_010471586.1| PREDICTED: two-component response regulator ARR15-like [Camelina 
sativa]
Length=200

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 5/107 (5%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL  G     S      KVN
Sbjct  16   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLDKG-----SSGLKDLKVN  70

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI QCM
Sbjct  71   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIEQCM  117



>dbj|BAL43557.1| type-A response regulator [Petunia x hybrida]
Length=227

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDV-QHN  279
            MG    +   HVLAVDD  I+  +IE+LLK+SSC+VTT ++G +ALE+LGL   +  + N
Sbjct  1    MGMAAAESQFHVLAVDDSLIDRKLIERLLKTSSCQVTTVDSGSKALEFLGLQEHEQNKSN  60

Query  280  SP-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
             P     N    ++NLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRIN+
Sbjct  61   QPCVSLDNHQEAEINLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRINR  120

Query  445  CME  453
            C+E
Sbjct  121  CLE  123



>ref|XP_006854776.1| hypothetical protein AMTR_s00063p00116400 [Amborella trichopoda]
 gb|ERN16243.1| hypothetical protein AMTR_s00063p00116400 [Amborella trichopoda]
Length=196

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +1

Query  97   MAMGENGEDEV-IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQ  273
            MA  E    E   HVLAVDD  I+  +IEKLLK+SS +VTT ++G +ALEYLGL   D Q
Sbjct  1    MARPETQFQETQFHVLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALEYLGL--QDNQ  58

Query  274  HNS---PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
             +    PN N  +VNLIITDY MPGM GY+LLKK+K+S+  K++PVV+MSSEN+PSRI +
Sbjct  59   QDPALCPNQNEVEVNLIITDYCMPGMTGYDLLKKIKESSYLKNIPVVIMSSENVPSRITR  118

Query  445  CME  453
            C+E
Sbjct  119  CLE  121



>emb|CBX43986.1| putative A-type response regulator 4 [Populus x canadensis]
Length=193

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 88/116 (76%), Gaps = 8/116 (7%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS-PNTNVP--  300
             HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D Q +S P++  P  
Sbjct  13   FHVLAVDDSLIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLHGDDEQRDSNPSSVSPDH  72

Query  301  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                 ++N+IITDY MPGM GY+LLKK+K+S  FKD+PVV+MSSEN+PSRIN+C+E
Sbjct  73   HHQHIEINMIITDYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLE  128



>ref|NP_201097.1| two-component response regulator ARR6 [Arabidopsis thaliana]
 sp|Q9ZWS6.2|ARR6_ARATH RecName: Full=Two-component response regulator ARR6 [Arabidopsis 
thaliana]
 dbj|BAA34728.1| response regulator 6 [Arabidopsis thaliana]
 dbj|BAB10861.1| response regulator 6 [Arabidopsis thaliana]
 gb|AAO44065.1| At5g62920 [Arabidopsis thaliana]
 dbj|BAE99822.1| response regulator 6 [Arabidopsis thaliana]
 gb|AED97674.1| two-component response regulator ARR6 [Arabidopsis thaliana]
Length=186

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  + +HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+  S    
Sbjct  20   GSPDPLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEEKSVGFE  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLE  129



>ref|NP_177627.1| two-component response regulator ARR15 [Arabidopsis thaliana]
 sp|Q7G8V2.1|ARR15_ARATH RecName: Full=Two-component response regulator ARR15 [Arabidopsis 
thaliana]
 gb|AAD55287.1|AC008263_18 Similar to gb|AB008490 response regulator 7 (ARR7) from Arabidopsis 
thaliana. EST gb|AA042183 comes from this gene [Arabidopsis 
thaliana]
 gb|AAG40611.1|AF305720_1 response regulator 15 [Arabidopsis thaliana]
 gb|AAG51914.1|AC013258_8 putative response regulator (two component phosphotransfer signaling); 
70657-71777 [Arabidopsis thaliana]
 gb|AEE35644.1| two-component response regulator ARR15 [Arabidopsis thaliana]
Length=206

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL   D  + S      KVN
Sbjct  18   LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGL---DGDNGSSGLKDLKVN  74

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+  +++PVV+MSSENI  RI QCM
Sbjct  75   LIVTDYSMPGLTGYELLKKIKESSALREIPVVIMSSENIQPRIEQCM  121



>emb|CDX68161.1| BnaA07g22010D [Brassica napus]
Length=197

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D      +    KVN
Sbjct  16   LHVLAVDDSFVDRKVIERLLRISACKVTTVESGTRALQYLGLDGDDAPSALKDL---KVN  72

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI+QCM
Sbjct  73   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIDQCM  119



>ref|NP_173339.1| two-component response regulator ARR7 [Arabidopsis thaliana]
 sp|Q9ZWS7.1|ARR7_ARATH RecName: Full=Two-component response regulator ARR7 [Arabidopsis 
thaliana]
 gb|AAF79300.1|AC068602_23 F14D16.20 [Arabidopsis thaliana]
 dbj|BAA34729.1| response regulator 7 [Arabidopsis thaliana]
 gb|ABD42983.1| At1g19050 [Arabidopsis thaliana]
 gb|AEE29795.1| two-component response regulator ARR7 [Arabidopsis thaliana]
Length=206

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL  G     + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGG---KGASNLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG++GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++
Sbjct  81   LIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQECLK  128



>gb|KFK44048.1| hypothetical protein AALP_AA1G208700 [Arabis alpina]
Length=201

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D +  + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGEKGASDLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S++F+++PVV+MSSENI  RI QC++
Sbjct  81   LIVTDYSMPGVTGYDLLKKIKESSVFREIPVVIMSSENILPRIEQCLK  128



>ref|XP_002322145.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
 gb|EEF06272.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa]
Length=224

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   N  K
Sbjct  27   EELHVLAVDDSFVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSVGFNDLK  83

Query  304  VNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K +S+ F+++PVV+MSSENI +RI++C+E
Sbjct  84   INLIMTDYSMPGMTGYELLKKIKQESSAFREIPVVIMSSENILARIDRCLE  134



>ref|XP_009374451.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=156

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = +1

Query  97   MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  276
            M +G   +DE  HVLAVDD  ++  IIEKLL +S+C VTTAEN   ALE LGL  G  Q 
Sbjct  1    MGLGWK-DDEKPHVLAVDDSLVDCKIIEKLLTNSACNVTTAENAHGALELLGLADG--QQ  57

Query  277  NSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            N  NT V  VN IITDYSMPGM GYELLKK+KDS   K++PVVV+SSE+IP+RI +C+E
Sbjct  58   NFGNT-VSNVNTIITDYSMPGMTGYELLKKIKDSPTVKEIPVVVVSSEDIPTRIEKCLE  115



>ref|XP_009604813.1| PREDICTED: two-component response regulator ARR9-like [Nicotiana 
tomentosiformis]
Length=228

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    ++  H+LAVDD  I+  +IE+L ++S+C+VTT ++  +ALE+LGL   +  H +
Sbjct  1    MGMAAAEQQFHILAVDDSLIDRKLIERLFRTSACQVTTVDSENKALEFLGLQEHEHNHPN  60

Query  283  PNTNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
            P    P      +VNLIITDY MPGM GY+LLKK+K+S+ F+++PVV+MSSEN+PSRIN+
Sbjct  61   PPCACPHNHQEVEVNLIITDYCMPGMTGYDLLKKIKESSSFRNIPVVIMSSENVPSRINR  120

Query  445  CME  453
            C+E
Sbjct  121  CLE  123



>ref|XP_010550669.1| PREDICTED: two-component response regulator ARR5-like [Tarenaya 
hassleriana]
Length=198

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +1

Query  112  NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT  291
            +G  E++HVLAVDD  ++   IE+LLK SSCKVT  ++G RAL+YLGL   D + +S   
Sbjct  19   SGSPELLHVLAVDDSHVDRKFIERLLKISSCKVTVVDSGTRALQYLGL---DGEKSSVGF  75

Query  292  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
               KVNLI+TDYSMPGM GYEL+KK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  76   ADLKVNLIMTDYSMPGMTGYELMKKIKESSAFREIPVVIMSSENILPRIDRCLE  129



>ref|XP_009149845.1| PREDICTED: two-component response regulator ARR5 [Brassica rapa]
 emb|CDY68129.1| BnaAnng26230D [Brassica napus]
Length=179

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  +NS      K
Sbjct  19   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGDNNSVGFEDLK  75

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  76   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLE  125



>emb|CDY70164.1| BnaCnng67000D [Brassica napus]
 emb|CDY36905.1| BnaA06g16900D [Brassica napus]
Length=183

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  +NS      K
Sbjct  23   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGDNNSVGFEDLK  79

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  80   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLE  129



>ref|XP_002304795.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa]
 gb|EEE79774.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa]
Length=193

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 88/116 (76%), Gaps = 8/116 (7%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS-PNTNVP--  300
             HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D Q +S P++  P  
Sbjct  13   FHVLAVDDSLIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLSGDDEQRDSNPSSVSPDH  72

Query  301  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                 ++N+IITDY MPGM GY+LLKK+K+S  FKD+PVV+MSSEN+PSRIN+C+E
Sbjct  73   HHQHIEINMIITDYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLE  128



>gb|EYU38278.1| hypothetical protein MIMGU_mgv1a019913mg [Erythranthe guttata]
Length=147

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
             HVLAVDD  I+  +IE+LLK+SS +VT  E+GV+ALE+LGL+ GD + N  NT   ++N
Sbjct  13   FHVLAVDDSIIDRKLIERLLKTSSYQVTVVESGVKALEFLGLV-GDEKSN--NTLKVEIN  69

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDYSMP + GY+LL+K+K+S + KD+PVV+MSSEN+ SRIN CME
Sbjct  70   LIITDYSMPAVTGYDLLRKIKESRLLKDIPVVIMSSENVASRINSCME  117



>gb|KHN16287.1| Two-component response regulator ARR6 [Glycine soja]
Length=204

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RA +YLGL   D + +S   +  KVN
Sbjct  21   LHVLAVDDSHVDRKVIERLLKISSCKVTVVESGSRAPQYLGL---DGEKSSIGLDSVKVN  77

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F++VPVVVMSSENI +RI+ C+E
Sbjct  78   LIMTDYSMPGMTGYELLKKIKESSVFREVPVVVMSSENILTRIDSCLE  125



>emb|CDY06142.1| BnaA09g36380D [Brassica napus]
Length=236

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL  G  + N 
Sbjct  1    MGMAAAECQFHVLAVDDSLVDRKLIERLLQKSSCQVTTVDSGYKALEFLGLRQG-TESND  59

Query  283  PNTNVP---KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            P    P   +VNLIITDY MPGM GY+LLKK+K+S  FK++PVV+MSSEN+P+RI++C+E
Sbjct  60   PTALSPSPQEVNLIITDYCMPGMTGYDLLKKLKESPAFKNIPVVIMSSENVPARISRCLE  119



>emb|CBI40157.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP---  300
             HVLAVDD  I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + ++ SP +  P   
Sbjct  9    FHVLAVDDSIIDRKLIEKLLKTSSYQVTAVDSGSKALEFLGLQEAEQRNLSPPSLCPSQE  68

Query  301  -KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             +VNLIITDY MPGM GY+LL+K+K+S   KD+PVV+MSSENIPSRIN+C+E
Sbjct  69   MEVNLIITDYCMPGMTGYDLLRKIKESTSLKDIPVVIMSSENIPSRINRCLE  120



>ref|XP_010426279.1| PREDICTED: two-component response regulator ARR5 [Camelina sativa]
Length=184

 Score =   131 bits (329),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 92/122 (75%), Gaps = 7/122 (6%)
 Frame = +1

Query  88   SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  267
            +SS+A  +    E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D
Sbjct  16   TSSLASSQ----ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---D  68

Query  268  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
             ++ S      K+NLI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSENI  RI++C
Sbjct  69   GENGSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSIFREIPVVIMSSENILPRIDRC  128

Query  448  ME  453
            +E
Sbjct  129  LE  130



>ref|XP_008384995.1| PREDICTED: two-component response regulator ARR17-like, partial 
[Malus domestica]
Length=159

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            DE  HVLAVDD  ++  IIEKLL +S+CKVTTAEN   ALE LGL  G  Q N  N  V 
Sbjct  11   DEKPHVLAVDDSLVDRKIIEKLLTNSACKVTTAENAHGALELLGLADG--QQNFGNI-VS  67

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             VN+IITDYSMPGM GYELLKK+KDS   K++PVVV+SSE+IP+RI +C+E
Sbjct  68   NVNMIITDYSMPGMTGYELLKKIKDSPTVKEIPVVVVSSEDIPTRIEKCLE  118



>ref|XP_004299595.1| PREDICTED: two-component response regulator ARR5-like [Fragaria 
vesca subsp. vesca]
Length=228

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  I+  +IEKLLK S CKVT  ++G RAL+YLGL  G+ + +S   +  KVN
Sbjct  23   LHVLAVDDSIIDRKVIEKLLKISCCKVTAVDSGTRALQYLGL-DGE-KKSSVGFDAMKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI +RI++C+E
Sbjct  81   LIITDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENIVTRIDRCLE  128



>ref|XP_009151412.1| PREDICTED: two-component response regulator ARR6 [Brassica rapa]
 emb|CDY00336.1| BnaA06g22370D [Brassica napus]
 emb|CDX84366.1| BnaC03g51340D [Brassica napus]
Length=190

 Score =   131 bits (330),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            +++HVLAVDD  ++   IE+LLK SSCKVT  ++  RAL+YLGL   DV          K
Sbjct  23   DLLHVLAVDDSHVDRKFIERLLKVSSCKVTVVDSATRALQYLGL---DVNEKPIGCKDLK  79

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            VNLI+TDYSMPGM GYELLKK+K+S+ F+DVPVVVMSSENI  RI++C+E
Sbjct  80   VNLIMTDYSMPGMTGYELLKKIKESSAFRDVPVVVMSSENILPRIDRCLE  129



>gb|KJB78543.1| hypothetical protein B456_013G004700 [Gossypium raimondii]
Length=166

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 7/108 (6%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
             HVLAVDD  I+  +IEKLLK+SS +VT  ++G +ALE+LGL   D Q         KVN
Sbjct  10   FHVLAVDDTLIDRKLIEKLLKTSSYQVTAVDSGTKALEFLGLNNNDHQD-------VKVN  62

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GY+LL+K+K+S+ FKD+PVV+MSS+NIPSRIN+C+E
Sbjct  63   LIITDYCMPGMTGYDLLRKIKESSSFKDIPVVIMSSDNIPSRINRCLE  110



>emb|CDY30966.1| BnaC04g24580D [Brassica napus]
Length=232

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LG+ + D    S
Sbjct  1    MGMAAVESQFHVLAVDDSSLDRKLIERLLQKSSCQVTTVDSGYKALEFLGIESNDPNALS  60

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             +    +VNLIITDY MPGM GY+LLKKVK+S  FK++PVV+MSSEN+P+RI++C+E
Sbjct  61   TSPQEVEVNLIITDYCMPGMTGYDLLKKVKESPAFKNIPVVIMSSENVPARISRCLE  117



>ref|XP_004249241.1| PREDICTED: two-component response regulator ARR8 [Solanum lycopersicum]
Length=239

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    D   HVLAVDD  I+  +IE+L K SSC+VTT ++G +ALE+LGL     + N 
Sbjct  1    MGMAAADLQFHVLAVDDSLIDRKLIERLFKISSCQVTTVDSGSKALEFLGLQEEHDEQNH  60

Query  283  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
            P     N    ++NLIITDY MPGM GY+LLKK+K+SA  +++PVV+MSSEN+PSRI++C
Sbjct  61   PCVSPSNQQEVEINLIITDYCMPGMTGYDLLKKIKESASLRNIPVVIMSSENVPSRISRC  120

Query  448  ME  453
            +E
Sbjct  121  LE  122



>ref|XP_010516309.1| PREDICTED: two-component response regulator ARR9 [Camelina sativa]
Length=236

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 93/125 (74%), Gaps = 10/125 (8%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IESND  58

Query  283  PN--TNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
            PN  +  P      +VNLIITDY MPGM G++LLKKVK+S+ FK++PVV+MSSEN+P+RI
Sbjct  59   PNALSTAPVNHQEVEVNLIITDYCMPGMTGFDLLKKVKESSAFKNIPVVIMSSENVPARI  118

Query  439  NQCME  453
            ++C+E
Sbjct  119  SRCLE  123



>ref|NP_191263.1| two-component response regulator ARR9 [Arabidopsis thaliana]
 sp|O80366.1|ARR9_ARATH RecName: Full=Two-component response regulator ARR9; AltName: 
Full=Response reactor 4 [Arabidopsis thaliana]
 dbj|BAA31146.1| responce reactor4 [Arabidopsis thaliana]
 emb|CAB72174.1| responce reactor 4 [Arabidopsis thaliana]
 gb|AAL90898.1| AT3g57040/F24I3_120 [Arabidopsis thaliana]
 gb|AAM91401.1| At3g57040/F24I3_120 [Arabidopsis thaliana]
 gb|AEE79602.1| two-component response regulator ARR9 [Arabidopsis thaliana]
Length=234

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 89/125 (71%), Gaps = 10/125 (8%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL       N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQS-TDSND  58

Query  283  PNT--------NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
            PN          V +VNLIITDY MPGM GY+LLKKVK+S+ F+D+PVV+MSSEN+P+RI
Sbjct  59   PNAFSKAPVNHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARI  118

Query  439  NQCME  453
            ++C+E
Sbjct  119  SRCLE  123



>ref|XP_009104741.1| PREDICTED: two-component response regulator ARR15-like [Brassica 
rapa]
Length=217

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D      +    KVN
Sbjct  36   LHVLAVDDSFVDRKVIERLLRISACKVTTVESGTRALQYLGLDGDDAPSALKDL---KVN  92

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCM  450
            LI+TDYSMPG+ GYELLKK+K+S+ F+++PVV+MSSENI  RI+QCM
Sbjct  93   LIVTDYSMPGLTGYELLKKIKESSAFREIPVVIMSSENIQPRIDQCM  139



>emb|CDX96681.1| BnaA08g22240D [Brassica napus]
Length=207

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGNTGASDLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI +RI QC++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSTFREIPVVIMSSENILTRIEQCLK  128



>ref|XP_010503433.1| PREDICTED: two-component response regulator ARR5-like [Camelina 
sativa]
Length=205

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 92/122 (75%), Gaps = 7/122 (6%)
 Frame = +1

Query  88   SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  267
            +SS+A  +    E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D
Sbjct  37   TSSLASSQ----ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---D  89

Query  268  VQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
             ++ S      K+NLI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSENI  RI++C
Sbjct  90   GENGSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSIFREIPVVIMSSENILPRIDRC  149

Query  448  ME  453
            +E
Sbjct  150  LE  151



>ref|XP_002893028.1| hypothetical protein ARALYDRAFT_889335 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69287.1| hypothetical protein ARALYDRAFT_889335 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL  G     + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGG---KGASNLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLK  128



>ref|XP_010477106.1| PREDICTED: two-component response regulator ARR7 [Camelina sativa]
Length=208

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLK  128



>ref|XP_006351276.1| PREDICTED: two-component response regulator ARR9-like [Solanum 
tuberosum]
Length=226

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    D   HVLAVDD  I+  +IE+L K SSC+VTT ++G +ALE+LGL     + N 
Sbjct  1    MGMAAADLQFHVLAVDDSLIDRKLIERLFKISSCQVTTVDSGSKALEFLGLQEEHDEQNH  60

Query  283  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
            P     N    ++NLIITDY MPGM GY+LLKK+K+SA  +++PVV+MSSEN+PSRI++C
Sbjct  61   PCVSPSNQQEVEINLIITDYCMPGMTGYDLLKKIKESASLRNIPVVIMSSENVPSRISRC  120

Query  448  ME  453
            +E
Sbjct  121  LE  122



>ref|XP_006291901.1| hypothetical protein CARUB_v10018078mg [Capsella rubella]
 gb|EOA24799.1| hypothetical protein CARUB_v10018078mg [Capsella rubella]
Length=186

 Score =   130 bits (328),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D +++S      K
Sbjct  26   ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGENSSVGFEDLK  82

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  83   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLE  132



>ref|XP_008360657.1| PREDICTED: two-component response regulator ARR17-like [Malus 
domestica]
Length=167

 Score =   130 bits (327),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +1

Query  103  MGENGEDE-VIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN  279
            MG + E E V HVLAVDD  ++  IIEKLL  S+CKVTTAE+G  ALE LGL   D Q N
Sbjct  14   MGLDFEHEKVPHVLAVDDSFVDRKIIEKLLIKSACKVTTAEDGHGALELLGL--ADGQQN  71

Query  280  SPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              NT V  VN+IITDY MPGM GYELLK+VK+S   K++PVVV+SSENIPSRI +C+E
Sbjct  72   FANT-VSNVNMIITDYCMPGMTGYELLKRVKESPKGKEIPVVVVSSENIPSRIEKCLE  128



>emb|CDX83788.1| BnaC08g18570D [Brassica napus]
Length=212

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGNTGASDLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI +RI QC++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSTFREIPVVIMSSENILTRIEQCLK  128



>ref|XP_006579380.1| PREDICTED: uncharacterized protein LOC100527518 isoform X1 [Glycine 
max]
Length=210

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            + VLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL  G   ++S   +  KVN
Sbjct  26   LQVLAVDDSLVDRKVIERLLRISSCKVTVVESGTRALQYLGLDGG---NSSLGFDSVKVN  82

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI++C+E
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDRCLE  130



>ref|XP_010498312.1| PREDICTED: two-component response regulator ARR7-like [Camelina 
sativa]
Length=210

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLK  128



>ref|XP_010028399.1| PREDICTED: two-component response regulator ARR5 [Eucalyptus 
grandis]
 gb|KCW83455.1| hypothetical protein EUGRSUZ_B00374 [Eucalyptus grandis]
Length=224

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +1

Query  112  NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT  291
             G  + +HVLAVDD  ++  +IEKLLK  SCKVT  ++G+RAL++LGL   D + +S   
Sbjct  20   GGSGQELHVLAVDDSLVDRKVIEKLLKRLSCKVTAVDSGLRALQFLGL---DGEKSSVGL  76

Query  292  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +  KVNLI+TDYSMPGM GYELLKK+K+S+ F++ PVV+MSSE I +RIN+C+E
Sbjct  77   DDLKVNLIMTDYSMPGMTGYELLKKIKESSAFRETPVVIMSSERILARINRCLE  130



>ref|XP_002283787.2| PREDICTED: two-component response regulator ARR5-like [Vitis 
vinifera]
Length=258

 Score =   132 bits (333),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL++LGL   D + NS   +  KVN
Sbjct  65   LHVLAVDDSHVDRKVIERLLKISSCKVTAVESGTRALQFLGL---DGEENSVGFDGLKVN  121

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S  F+ +PVV+MSSENI +RI++C+E
Sbjct  122  LIMTDYSMPGMTGYELLKKIKESKAFRKIPVVIMSSENILTRIDRCLE  169



>ref|XP_010459562.1| PREDICTED: two-component response regulator ARR7-like [Camelina 
sativa]
Length=211

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLK  128



>ref|XP_009364893.1| PREDICTED: two-component response regulator ARR17-like [Pyrus 
x bretschneideri]
Length=167

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +1

Query  103  MGENGEDE-VIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN  279
            MG + E E V HVLAVDD  ++  IIEKLL  S+CKVTTAE+G  ALE LGL   D Q N
Sbjct  14   MGLDFEHENVPHVLAVDDSFVDRKIIEKLLIKSACKVTTAEDGHGALELLGL--ADGQQN  71

Query  280  SPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              NT V  VN+IITDY MPGM GYELLK+VK+S   K++PVVV+SSENIPSRI +C+E
Sbjct  72   FANT-VSNVNMIITDYCMPGMTGYELLKRVKESPKGKEIPVVVVSSENIPSRIEKCLE  128



>ref|XP_010645611.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera]
Length=140

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 9/117 (8%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG  GE +  HVLAVDD  I+   IEKLLK+SS +VT  ++  +ALE+LGL   + +   
Sbjct  1    MGMAGESQ-FHVLAVDDSIIDRKWIEKLLKTSSFQVTVVDSVSKALEFLGLQEAEQER--  57

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                  KVNLIITDYSMPGM GY+LL+K+K+S   KD+PVV+MSSENIPSRIN+C+E
Sbjct  58   ------KVNLIITDYSMPGMTGYDLLRKIKESTSLKDIPVVIMSSENIPSRINRCLE  108



>ref|XP_002877596.1| hypothetical protein ARALYDRAFT_906046 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53855.1| hypothetical protein ARALYDRAFT_906046 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D +++S      K
Sbjct  23   ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGENSSVGFEDLK  79

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  80   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLE  129



>ref|XP_002267404.1| PREDICTED: two-component response regulator ARR8 [Vitis vinifera]
Length=220

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP---  300
             HVLAVDD  I+  +IEKLLK+SS +VT  ++G +ALE+LGL   + ++ SP +  P   
Sbjct  9    FHVLAVDDSIIDRKLIEKLLKTSSYQVTAVDSGSKALEFLGLQEAEQRNLSPPSLCPSQE  68

Query  301  -KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             +VNLIITDY MPGM GY+LL+K+K+S   KD+PVV+MSSENIPSRIN+C+E
Sbjct  69   MEVNLIITDYCMPGMTGYDLLRKIKESTSLKDIPVVIMSSENIPSRINRCLE  120



>emb|CAN69259.1| hypothetical protein VITISV_026384 [Vitis vinifera]
Length=210

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            +E  HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL++LGL   D + NS   +  
Sbjct  16   EEEAHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQFLGL---DEEKNSAGLDGL  72

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            KV+LIITDY MPGM GYELLKK+K+S+ F++ PVV+MSSENI +RI++C+E
Sbjct  73   KVDLIITDYCMPGMTGYELLKKIKESSTFRETPVVIMSSENILTRIDRCLE  123



>ref|XP_004140290.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
sativus]
 ref|XP_004170846.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
sativus]
 gb|KGN51089.1| hypothetical protein Csa_5G434550 [Cucumis sativus]
Length=156

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 16/120 (13%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP---  300
             HVLAVDD  I+  +IE+LLK+SS  VT  ++G +ALE+LGL    VQH+   T+     
Sbjct  10   FHVLAVDDSFIDRKLIERLLKTSSYHVTAVDSGTKALEFLGL----VQHHDQQTDSKIAP  65

Query  301  ---------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                      VNLIITDYSMPGM+GYELL+K+K+S   KD+PVV+MSSEN+PSRIN+C+E
Sbjct  66   DQNHHHQEVDVNLIITDYSMPGMSGYELLRKIKESKSLKDIPVVIMSSENVPSRINRCLE  125



>ref|XP_010504623.1| PREDICTED: two-component response regulator ARR9-like isoform 
X1 [Camelina sativa]
Length=235

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 93/125 (74%), Gaps = 10/125 (8%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VT+ ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTSVDSGSKALEFLGLRQG-IESND  58

Query  283  PN--TNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
            PN  +  P      +VNLIITDY MPGM G++LLKKVK+S+ FK++PVV+MSSEN+P+RI
Sbjct  59   PNALSTAPVNHQQVEVNLIITDYCMPGMTGFDLLKKVKESSAFKNIPVVIMSSENVPARI  118

Query  439  NQCME  453
            ++C+E
Sbjct  119  SRCLE  123



>ref|XP_006304206.1| hypothetical protein CARUB_v10010295mg [Capsella rubella]
 gb|EOA37104.1| hypothetical protein CARUB_v10010295mg [Capsella rubella]
Length=210

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL   D    + N    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL---DGDKGASNLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F++VPVV+MSSENI  RI +C++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREVPVVIMSSENILPRIEECLK  128



>gb|AFK41993.1| unknown [Lotus japonicus]
Length=209

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 87/109 (80%), Gaps = 4/109 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP-NTNVPKV  306
            +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL+YLGL   D + NS    +  KV
Sbjct  20   LHVLAVDDSLVDRKVIERLLKISSCKVTVVDSGTRALQYLGL---DGEENSSIGFDGVKV  76

Query  307  NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            NLI+TDYSMPGM GYELLKK+K+S+ F+++PVVVMSSENI +RI++C+E
Sbjct  77   NLIMTDYSMPGMTGYELLKKIKESSAFREIPVVVMSSENILTRIDRCLE  125



>ref|XP_006402918.1| hypothetical protein EUTSA_v10006209mg [Eutrema salsugineum]
 gb|ESQ44371.1| hypothetical protein EUTSA_v10006209mg [Eutrema salsugineum]
Length=241

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 10/125 (8%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G  + N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLREGS-ESNE  58

Query  283  PN--TNVPK------VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
            PN  +  P+      VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+RI
Sbjct  59   PNALSTSPEIHQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPARI  118

Query  439  NQCME  453
            ++C+E
Sbjct  119  SRCLE  123



>ref|XP_010508734.1| PREDICTED: two-component response regulator ARR8 [Camelina sativa]
Length=226

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD----V  270
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D    V
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  271  QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  448  ME  453
            +E
Sbjct  120  LE  121



>ref|XP_002866522.1| hypothetical protein ARALYDRAFT_496477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42781.1| hypothetical protein ARALYDRAFT_496477 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL    V+  S    
Sbjct  20   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---GVEEKSVGFQ  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ F+ VPVV+MSSENI  RI++C+E
Sbjct  77   DLKVNLIMTDYSMPGMTGYELLKKIKESSAFRQVPVVIMSSENILPRIDRCLE  129



>ref|XP_009110302.1| PREDICTED: two-component response regulator ARR7 [Brassica rapa]
Length=207

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 88/110 (80%), Gaps = 7/110 (6%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP--K  303
            +HVLAVDD  ++  +IE+LL+ SSCKVTT E+G RAL+YLGL       N+ ++++   K
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL-----DGNTGDSDLKDLK  78

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            VNLI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI +RI QC++
Sbjct  79   VNLIVTDYSMPGLTGYDLLKKIKESSTFREIPVVIMSSENILTRIEQCLK  128



>ref|XP_010515122.1| PREDICTED: two-component response regulator ARR5-like [Camelina 
sativa]
Length=206

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D ++ S      K
Sbjct  46   ELLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGENGSVGFEDLK  102

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSENI  RI++C+E
Sbjct  103  INLIMTDYSMPGMTGYELLKKIKESSIFREIPVVIMSSENILPRIDRCLE  152



>ref|XP_011028649.1| PREDICTED: two-component response regulator ARR5-like isoform 
X1 [Populus euphratica]
 ref|XP_011028650.1| PREDICTED: two-component response regulator ARR5-like isoform 
X1 [Populus euphratica]
 ref|XP_011028651.1| PREDICTED: two-component response regulator ARR5-like isoform 
X1 [Populus euphratica]
Length=229

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL+YLGL   D + +S   N  K
Sbjct  32   EELHVLAVDDSFVDRKVIERLLKISSCKVTVVESGSRALQYLGL---DGEKSSVAFNDLK  88

Query  304  VNLIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K +S+ F+++PVV+MSSENI +RI++C+E
Sbjct  89   INLIMTDYSMPGMTGYELLKKIKQESSAFREIPVVIMSSENILARIDRCLE  139



>ref|XP_010652890.1| PREDICTED: two-component response regulator ARR6 [Vitis vinifera]
 emb|CBI32076.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVP  300
            +E  HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL++LGL   D + NS   +  
Sbjct  27   EEEAHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQFLGL---DEEKNSAGLDGL  83

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            KV+LIITDY MPGM GYELLKK+K+S+ F++ PVV+MSSENI +RI++C+E
Sbjct  84   KVDLIITDYCMPGMTGYELLKKIKESSTFRETPVVIMSSENILTRIDRCLE  134



>ref|XP_010505899.1| PREDICTED: two-component response regulator ARR8-like [Camelina 
sativa]
Length=224

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD----V  270
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D    V
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  271  QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  448  ME  453
            +E
Sbjct  120  LE  121



>ref|XP_006404297.1| hypothetical protein EUTSA_v10010754mg [Eutrema salsugineum]
 gb|ESQ45750.1| hypothetical protein EUTSA_v10010754mg [Eutrema salsugineum]
Length=183

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  ++S    
Sbjct  20   GSPELLHVLAVDDSIVDRKFIERLLRVSSCKVTLVDSATRALQYLGL---DGDNSSVGFE  76

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              K+NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  77   DLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLE  129



>emb|CDY22518.1| BnaC03g23280D [Brassica napus]
Length=217

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVPK  303
             HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   + Q + PN  +  P+
Sbjct  9    FHVLAVDDSFFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESN-QSDDPNATSTSPE  67

Query  304  V--NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            V  NLIITDY MPGM GY+LLK+VK+SA F+ +PVV+MSSENIP+RI++C+E
Sbjct  68   VEINLIITDYCMPGMTGYDLLKRVKESAAFRSIPVVIMSSENIPARISRCLE  119



>ref|XP_010517619.1| PREDICTED: two-component response regulator ARR8-like [Camelina 
sativa]
Length=223

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD----V  270
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D    V
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  271  QHNSPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  448  ME  453
            +E
Sbjct  120  LE  121



>emb|CBI15098.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+G RAL++LGL   D + NS   +  KVN
Sbjct  103  LHVLAVDDSHVDRKVIERLLKISSCKVTAVESGTRALQFLGL---DGEENSVGFDGLKVN  159

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S  F+ +PVV+MSSENI +RI++C+E
Sbjct  160  LIMTDYSMPGMTGYELLKKIKESKAFRKIPVVIMSSENILTRIDRCLE  207



>ref|XP_006439725.1| hypothetical protein CICLE_v10022334mg [Citrus clementina]
 gb|ESR52965.1| hypothetical protein CICLE_v10022334mg [Citrus clementina]
Length=199

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL   D + ++   +  KVN
Sbjct  11   LHVLAVDDSYVDRKLIERLLQISSCKVTAVESGTRALQYLGL---DGEQSNVGFDALKVN  67

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY+MPGM GYELLKK+K+S++F++VPVV+MSSE++ ++I+ C+E
Sbjct  68   LIITDYTMPGMTGYELLKKIKESSVFREVPVVIMSSEDVLTQIDSCLE  115



>gb|ABG35777.1| SRR217 [Striga asiatica]
Length=220

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD  I+  +IE+LLK+SS +VTT ++G +ALE+LG  + D   NS
Sbjct  1    MGMAAAEAQFHVLAVDDSLIDRKLIERLLKTSSYQVTTVDSGNKALEFLGW-SKDESGNS  59

Query  283  PNTNVPK------VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
               + PK      VNL+ITDY MPGM GYELLKKVK+S   +D+PVV+MSSEN+PSRIN+
Sbjct  60   NAFDSPKNHQVVEVNLVITDYCMPGMTGYELLKKVKESTFLRDIPVVIMSSENVPSRINR  119

Query  445  CME  453
            C+E
Sbjct  120  CLE  122



>emb|CDY54257.1| BnaC01g42890D [Brassica napus]
Length=183

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D  ++S      K
Sbjct  23   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DGDNSSVGFQDLK  79

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  80   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLE  129



>ref|XP_006304102.1| hypothetical protein CARUB_v10010030mg [Capsella rubella]
 gb|EOA37000.1| hypothetical protein CARUB_v10010030mg [Capsella rubella]
Length=265

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    SP  +  KV+
Sbjct  39   LHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNDKASPQLDRLKVD  95

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GYELLKK+K+S+ F+ VPVV+MSSEN+ +RI++C+E
Sbjct  96   LIITDYCMPGMTGYELLKKIKESSNFRQVPVVIMSSENVVTRIDRCLE  143



>ref|XP_006476689.1| PREDICTED: two-component response regulator ARR15-like [Citrus 
sinensis]
Length=199

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVT  E+G RAL+YLGL   D + ++   +  KVN
Sbjct  11   LHVLAVDDSYVDRKLIERLLQISSCKVTAVESGTRALQYLGL---DGEQSNVGFDALKVN  67

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY+MPGM GYELLKK+K+S++F++VPVV+MSSE++ ++I+ C+E
Sbjct  68   LIITDYTMPGMTGYELLKKIKESSVFREVPVVIMSSEDVLTQIDSCLE  115



>ref|XP_006417463.1| hypothetical protein EUTSA_v10008575mg [Eutrema salsugineum]
 gb|ESQ35816.1| hypothetical protein EUTSA_v10008575mg [Eutrema salsugineum]
Length=250

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  S   +  KV+
Sbjct  30   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DNEKASAEFDRLKVD  86

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E
Sbjct  87   LIITDYCMPGMTGYELLKKIKESSSFREVPVVIMSSENVLTRIDRCLE  134



>ref|XP_006281027.1| hypothetical protein CARUB_v10027044mg [Capsella rubella]
 gb|EOA13925.1| hypothetical protein CARUB_v10027044mg [Capsella rubella]
Length=235

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +1

Query  115  GEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTN  294
            G  +++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   DV+       
Sbjct  65   GSPDLLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL---DVEEKPLGFE  121

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              KVNLI+TDYSMPGM GYELLKK+K+S+ F++VPVV+MSSENI  RI++C+E
Sbjct  122  DLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLE  174



>ref|XP_011020390.1| PREDICTED: two-component response regulator ARR8-like [Populus 
euphratica]
Length=193

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 87/116 (75%), Gaps = 8/116 (7%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS-PNTNVP--  300
             HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D Q +S P+   P  
Sbjct  13   FHVLAVDDSLIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLNGDDEQRDSNPSPVSPDH  72

Query  301  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                 ++N+IITDY MPGM GY+LLKK+K+S  FKD+PVV+MSSEN+PSRIN+C+E
Sbjct  73   HHQHIEINMIITDYCMPGMTGYDLLKKIKESKYFKDIPVVIMSSENVPSRINRCLE  128



>ref|XP_010269354.1| PREDICTED: two-component response regulator ARR9-like isoform 
X2 [Nelumbo nucifera]
Length=209

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD  I+  +IE+LLK+SS +VT  ++G +ALE+LGL   D  + S
Sbjct  1    MGMAAEAQ-FHVLAVDDSLIDRKLIERLLKNSSYQVTAVDSGSKALEFLGLREDDQTNPS  59

Query  283  P-----NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
            P     N +  +VNLIITDY MPGM GY+LLKK+K+S+  KD+PVV+MSSEN+PSRIN+C
Sbjct  60   PPSVPSNHHEMQVNLIITDYCMPGMTGYDLLKKIKESSSLKDIPVVIMSSENVPSRINRC  119

Query  448  ME  453
            +E
Sbjct  120  LE  121



>ref|XP_010272107.1| PREDICTED: two-component response regulator ARR5-like [Nelumbo 
nucifera]
Length=230

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 9/123 (7%)
 Frame = +1

Query  85   PSSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAG  264
            PS SM      E E +HVLAVDD  ++  +IE+LLK SSCKVT  ++G RAL++LGL   
Sbjct  31   PSPSMV-----ESEGLHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQFLGLDG-  84

Query  265  DVQHNSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQ  444
                NS   +  KVN++ITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++
Sbjct  85   ---ENSVGLDGLKVNMVITDYCMPGMTGYELLKKIKESSTFREVPVVIMSSENVLARIDR  141

Query  445  CME  453
            C+E
Sbjct  142  CLE  144



>gb|KFK34102.1| hypothetical protein AALP_AA5G102300 [Arabis alpina]
Length=185

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPK  303
            E++HVLAVDD  ++   IE+LL+ SSCKVT  ++  RAL+YLGL   D ++++      K
Sbjct  24   ELLHVLAVDDSIVDRKFIERLLRVSSCKVTLVDSATRALQYLGL---DGENSTVGFEDLK  80

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +NLI+TDYSMPGM GYELLKK+K+S+ F+++PVV+MSSENI  RI++C+E
Sbjct  81   INLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRCLE  130



>ref|XP_009142738.1| PREDICTED: two-component response regulator ARR8-like [Brassica 
rapa]
Length=214

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 86/112 (77%), Gaps = 8/112 (7%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT----NV  297
             HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL     + N PN+      
Sbjct  9    FHVLAVDDSQLDREMIERLLQKSSCQVTTVDSGSKALEFLGLR----ESNDPNSLETHQE  64

Query  298  PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             ++NLIITDY MPGM GY+LLKKVK+SA F+ +PVV+MSSEN+P+RI++C+E
Sbjct  65   VEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLE  116



>ref|XP_006294950.1| hypothetical protein CARUB_v10024006mg [Capsella rubella]
 gb|EOA27848.1| hypothetical protein CARUB_v10024006mg [Capsella rubella]
Length=225

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN-  279
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D   N 
Sbjct  1    MGMETESQ-FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDEDPNV  59

Query  280  ---SPNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQC  447
               SP+ +   ++NLIITDY MPGM GY+LLKKVK+SA FK +PVV+MSSEN+P+RI++C
Sbjct  60   LSTSPHIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFKSIPVVIMSSENVPARISRC  119

Query  448  ME  453
            +E
Sbjct  120  LE  121



>gb|AFK34128.1| unknown [Lotus japonicus]
 gb|AFK37219.1| unknown [Lotus japonicus]
Length=207

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 87/109 (80%), Gaps = 4/109 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ SSCKVT  ++G RAL+YLGL   D + +S   +  KVN
Sbjct  20   LHVLAVDDSHVDRKVIERLLRISSCKVTVVDSGTRALQYLGL---DGEKSSIGLDSVKVN  76

Query  310  LIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K +S++F+++PVVVMSSENI +RI+ C+E
Sbjct  77   LIMTDYSMPGMTGYELLKKIKQESSVFREIPVVVMSSENILTRIDSCLE  125



>ref|XP_006291782.1| hypothetical protein CARUB_v10017962mg [Capsella rubella]
 gb|EOA24680.1| hypothetical protein CARUB_v10017962mg [Capsella rubella]
Length=234

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 92/125 (74%), Gaps = 10/125 (8%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IESND  58

Query  283  PN--TNVP------KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
            PN  +  P      +VNLIITDY MPGM G++LLKKVK+S+  K++PVV+MSSEN+P+RI
Sbjct  59   PNALSTAPVNHQEVEVNLIITDYCMPGMTGFDLLKKVKESSALKNIPVVIMSSENVPARI  118

Query  439  NQCME  453
            ++C+E
Sbjct  119  SRCLE  123



>ref|NP_001240226.1| uncharacterized protein LOC100788079 [Glycine max]
 gb|ACU21117.1| unknown [Glycine max]
 gb|KHN30383.1| Two-component response regulator ARR9 [Glycine soja]
Length=248

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 91/125 (73%), Gaps = 8/125 (6%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD  I+  +IE+LL++SS +VTT ++G +ALE+LGL   D  + S
Sbjct  1    MGMAAAESQFHVLAVDDSIIDRKLIERLLRTSSYQVTTVDSGSKALEFLGLRENDESNPS  60

Query  283  -----PNTNVPK---VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
                 PN + P+   VNL+ITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRI
Sbjct  61   IPSVCPNNHQPQEVEVNLVITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRI  120

Query  439  NQCME  453
            N+C+E
Sbjct  121  NRCLE  125



>ref|XP_009606673.1| PREDICTED: two-component response regulator ARR9 isoform X1 [Nicotiana 
tomentosiformis]
Length=222

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    D   HVLAVDD  I+  +IE+L + SSC+VTT ++G +ALE+LGL   +    S
Sbjct  1    MGMAAADLQFHVLAVDDSLIDRKLIERLFRISSCQVTTVDSGSKALEFLGLQDQNQPCVS  60

Query  283  P-NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            P N    +VNLIITDY MPGM GY+LLKK+K+S+  +++PVV+MSSEN+PSRI++C+E
Sbjct  61   PSNQQEVEVNLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRISRCLE  118



>ref|XP_011071752.1| PREDICTED: two-component response regulator ARR5-like [Sesamum 
indicum]
Length=206

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK S CKVT  E+G RAL+YLGL   D + +S   +  KVN
Sbjct  16   LHVLAVDDSLVDRKVIERLLKISCCKVTAVESGRRALQYLGL---DGERSSVGFDELKVN  72

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K S+  +++PVVVMSSEN+ +RI++C+E
Sbjct  73   LIMTDYSMPGMTGYELLKKIKGSSKLREIPVVVMSSENVLARIDRCLE  120



>ref|XP_006407515.1| hypothetical protein EUTSA_v10021491mg [Eutrema salsugineum]
 gb|ESQ48968.1| hypothetical protein EUTSA_v10021491mg [Eutrema salsugineum]
Length=218

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK S+CKVTT E+G RAL+YLGL   D    + +    KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLKISACKVTTVESGTRALQYLGL---DGDKGASDLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S+ F+++PVV+MSSENI  RI QC++
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSAFREIPVVIMSSENILPRIEQCIK  128



>ref|XP_010277318.1| PREDICTED: two-component response regulator ARR17-like [Nelumbo 
nucifera]
Length=162

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = +1

Query  106  GENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSP  285
            G+  E E +HVLAVDD  I+  +IEKLLKSSS +VTT E+G RALE LGL     + NS 
Sbjct  19   GDTRESERLHVLAVDDSSIDRKLIEKLLKSSSYRVTTVESGKRALELLGL----GKENSF  74

Query  286  NTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                 KVN+IITDY MP M G++LLK+VK+S+  K++PVV++SSEN+P+RIN+C+E
Sbjct  75   FKE-QKVNMIITDYCMPEMTGFDLLKRVKESSALKEIPVVILSSENVPTRINRCLE  129



>emb|CDX79942.1| BnaA05g02140D [Brassica napus]
Length=215

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 86/113 (76%), Gaps = 9/113 (8%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT-----N  294
             HVLAVDD  ++  +IE+LL+ SSC+VTT ++G +ALE+LGL     + N PN+      
Sbjct  9    FHVLAVDDSQLDRKMIERLLQKSSCQVTTVDSGSKALEFLGLR----ESNDPNSLETHQQ  64

Query  295  VPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              ++NLIITDY MPGM GY+LLKKVK+SA F+ +PVV+MSSEN+P+RI++C+E
Sbjct  65   EVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLE  117



>gb|EMS50922.1| Two-component response regulator ARR8 [Triticum urartu]
Length=230

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNV----  297
             HVLAVDD  ++  +IE+LLK+SS +VTT ++G +ALE+LGL   D   +S + +     
Sbjct  10   FHVLAVDDSVLDRKLIERLLKTSSFQVTTVDSGTKALEFLGLHGEDASISSVHADQLDVE  69

Query  298  PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
              VNLIITDY MPGM GY+LLKK+K+S+ F+D+PVV+MSSENIPSRIN+C+E
Sbjct  70   VNVNLIITDYCMPGMTGYDLLKKIKESSSFRDIPVVIMSSENIPSRINRCLE  121



>ref|XP_009382585.1| PREDICTED: two-component response regulator ARR9-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAG-DVQH-NSPNTNVPK  303
             HVLAVDD  I+  +IE+LLK+SS +VTT ++G +ALE LGL    D+   +SP+ N   
Sbjct  9    FHVLAVDDSLIDRKLIERLLKTSSYQVTTVDSGSKALELLGLREDQDISSPSSPDKNEIA  68

Query  304  VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            VNL+ITDY MPGM GY+LLKK+K S+  KDVPVV+MSSEN+PSRIN+C+E
Sbjct  69   VNLVITDYCMPGMTGYDLLKKIKGSSSLKDVPVVIMSSENVPSRINRCLE  118



>gb|AAQ10675.1| type-A response regulator [Catharanthus roseus]
Length=254

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +1

Query  112  NGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT  291
            +G  + +HVLAVDD  ++  +IE+LLK S CKVT  E+G RAL+YLGL   D + ++   
Sbjct  8    SGSAKELHVLAVDDSLVDRKVIERLLKISCCKVTAVESGRRALQYLGL---DGEKSTVGF  64

Query  292  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +  KVNLI+TDYSMPGM GYELLKK+K S+  K++PVV+MSSENI +RI++C+E
Sbjct  65   DGLKVNLILTDYSMPGMTGYELLKKIKGSSTLKEIPVVIMSSENILTRIDRCLE  118



>ref|NP_176202.1| response regulator 3 [Arabidopsis thaliana]
 sp|Q9ZWS9.1|ARR3_ARATH RecName: Full=Two-component response regulator ARR3 [Arabidopsis 
thaliana]
 gb|AAD39333.1|AC007258_22 response regulator 3 [Arabidopsis thaliana]
 dbj|BAA34725.1| response regulator 3 [Arabidopsis thaliana]
 gb|ABD60731.1| At1g59940 [Arabidopsis thaliana]
 dbj|BAF00859.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33642.1| response regulator 3 [Arabidopsis thaliana]
Length=231

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    +   +  KV+
Sbjct  33   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DDDKAAVEFDRLKVD  89

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GYELLKK+K+S  FK+VPVV+MSSEN+ +RI++C+E
Sbjct  90   LIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVMTRIDRCLE  137



>gb|AFK34510.1| unknown [Medicago truncatula]
Length=167

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 87/114 (76%), Gaps = 6/114 (5%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT------  291
             HVLAVDD  I+ ++IE+LLK+SS  VT  ++G +AL++LGL+  +V++  P++      
Sbjct  4    FHVLAVDDSVIDRMLIERLLKTSSFHVTVVDSGTKALKFLGLVEDEVRNEKPHSIAAETD  63

Query  292  NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             V +VNLIITDY MPGM GY+LL+K+K+S   KD+PVV+ SSEN+PSRIN+C+E
Sbjct  64   QVVEVNLIITDYCMPGMTGYDLLRKIKESNSLKDIPVVITSSENVPSRINRCLE  117



>gb|KEH35093.1| two-component response regulator ARR3-like protein [Medicago 
truncatula]
Length=201

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 86/109 (79%), Gaps = 4/109 (4%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK +SCKVT  E+G RAL+YLGL   D   +S   +  KVN
Sbjct  23   LHVLAVDDSFVDRKVIERLLKFTSCKVTVVESGTRALQYLGL---DGDTSSIGFDGVKVN  79

Query  310  LIITDYSMPGMNGYELLKKVK-DSAMFKDVPVVVMSSENIPSRINQCME  453
            +I+TDYSMPGM GYELLKK+K +S++F+++PVVVMSSENI +RI+ C+E
Sbjct  80   MIMTDYSMPGMTGYELLKKIKQESSVFREIPVVVMSSENILTRIDSCLE  128



>emb|CDY41014.1| BnaC05g14720D [Brassica napus]
Length=214

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D    +      KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISACKVTTVESGARALQYLGL---DGDKGASGLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S++F+++PVV+MSSENI  RI QC+ 
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSVFREIPVVIMSSENILPRIEQCLR  128



>ref|XP_008465907.1| PREDICTED: two-component response regulator ARR9-like [Cucumis 
melo]
Length=155

 Score =   127 bits (320),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 85/115 (74%), Gaps = 7/115 (6%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN----SPNTNV  297
             HVLAVDD  I+  +IE+LLK+SS  VT  ++G +ALE+LGL+    Q      +P  + 
Sbjct  10   FHVLAVDDSFIDRKLIERLLKTSSYHVTAVDSGTKALEFLGLVQDHDQQTDSKIAPENHH  69

Query  298  PK---VNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
             +   VNLIITDYSMPGM+GYELL+K+K+S   KD+PVV+MSSEN+PSRIN+C+E
Sbjct  70   HQEVDVNLIITDYSMPGMSGYELLRKIKESKSLKDIPVVIMSSENVPSRINRCLE  124



>ref|XP_006411396.1| hypothetical protein EUTSA_v10017200mg [Eutrema salsugineum]
 gb|ESQ52849.1| hypothetical protein EUTSA_v10017200mg [Eutrema salsugineum]
Length=228

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 8/116 (7%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVP-  300
             HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   + +   PN  +  P 
Sbjct  9    FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRESNDESEDPNVLSTSPV  68

Query  301  -----KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                 ++NLIITDY MPGM GY+LLK+VK+SA FK +PVV+MSSEN+P+RI++C+E
Sbjct  69   THQEVEINLIITDYCMPGMTGYDLLKRVKESAAFKSIPVVIMSSENVPARISRCLE  124



>ref|XP_009149383.1| PREDICTED: two-component response regulator ARR7-like [Brassica 
rapa]
 emb|CDY26701.1| BnaA06g13210D [Brassica napus]
Length=213

 Score =   129 bits (325),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LL+ S+CKVTT E+G RAL+YLGL   D    +      KVN
Sbjct  24   LHVLAVDDSIVDRKVIERLLRISACKVTTVESGARALQYLGL---DGDKGASGLKDLKVN  80

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPG+ GY+LLKK+K+S++F+++PVV+MSSENI  RI QC+ 
Sbjct  81   LIVTDYSMPGLTGYDLLKKIKESSVFREIPVVIMSSENILPRIEQCLR  128



>dbj|BAJ88185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +1

Query  88   SSSMAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGD  267
            SS MA+    E    HVLAVDD  ++  +IE+LLK+SS +VTT ++G +AL++LGL A D
Sbjct  41   SSPMAVAAIAE-APFHVLAVDDSVLDRKLIERLLKTSSFQVTTVDSGTKALQFLGLHAED  99

Query  268  VQHNSPNTNV----PKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSR  435
               +S + +       VNLIITDY MPGM GY+LLKK+K+S+ F+D+PVV+MSSENIPSR
Sbjct  100  ASISSVHADQLDVEVNVNLIITDYCMPGMTGYDLLKKIKESSSFRDIPVVIMSSENIPSR  159

Query  436  INQCME  453
            IN+C+E
Sbjct  160  INRCLE  165



>gb|KDP21284.1| hypothetical protein JCGZ_21755 [Jatropha curcas]
Length=252

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            +  + +D+ +HVLAVDD  I+  +IE+LLK SSCKVT  ++G RAL++LGL   + + +S
Sbjct  21   LSPSSDDQEVHVLAVDDSLIDRKVIERLLKISSCKVTAVDSGRRALQFLGL--DEEKTSS  78

Query  283  PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
               +  KV+LIITDY MPGM GYELLKK+K+S+ F+++PVV+MSSEN+ +RI++C+E
Sbjct  79   VGLDSLKVDLIITDYCMPGMTGYELLKKIKESSTFREIPVVIMSSENVMTRIDRCLE  135



>gb|KFK43337.1| hypothetical protein AALP_AA1G111900 [Arabis alpina]
Length=246

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  S   +  KV+
Sbjct  31   VHVLAVDDSLVDRIVIERLLRVTSCKVTAVDSGWRALEFLGL---DNEKASAEFDRLKVD  87

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GYELLKK+K+S+ F++VPVV+MSSEN+ +RI++C+E
Sbjct  88   LIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLE  135



>ref|NP_181663.1| response regulator 3 [Arabidopsis thaliana]
 sp|O80365.1|ARR8_ARATH RecName: Full=Two-component response regulator ARR8; AltName: 
Full=Response reactor 3 [Arabidopsis thaliana]
 dbj|BAA31145.1| responce reactor3 [Arabidopsis thaliana]
 gb|AAC78541.1| putative two-component response regulator 3 protein [Arabidopsis 
thaliana]
 gb|AAL69459.1| At2g41310/F13H10.14 [Arabidopsis thaliana]
 dbj|BAF00286.1| putative two-component response regulator 3 protein [Arabidopsis 
thaliana]
 gb|AEC09959.1| response regulator 3 [Arabidopsis thaliana]
Length=225

 Score =   129 bits (325),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 86/116 (74%), Gaps = 11/116 (9%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPN--TNVPK  303
             HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL   D   N PN  +  P+
Sbjct  9    FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDD---NDPNALSTSPQ  65

Query  304  V------NLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +      NLIITDY MPGM GY+LLKKVK+SA F+ +PVV+MSSEN+P+RI++C+E
Sbjct  66   IHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLE  121



>ref|XP_006301719.1| hypothetical protein CARUB_v10022177mg [Capsella rubella]
 gb|EOA34617.1| hypothetical protein CARUB_v10022177mg [Capsella rubella]
Length=240

 Score =   130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    S   +  KV+
Sbjct  34   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DDDKASVEFDRLKVD  90

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GYELLKK+K+S  FK+VPVV+MSSEN+ +RI++C+E
Sbjct  91   LIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVLTRIDRCLE  138



>ref|XP_004249238.1| PREDICTED: two-component response regulator ARR9 [Solanum lycopersicum]
Length=227

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 3/120 (3%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG    +   HVLAVDD  I+  +IE LLK+S+C+VTT ++G +ALE+LGL   D     
Sbjct  1    MGMAAVESQFHVLAVDDSVIDRKLIEMLLKTSACQVTTVDSGSKALEFLGLQENDKNQTC  60

Query  283  ---PNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
                N    ++NLIITDY MPGM GY+LLKK+K+SA  +++PVV+MSSEN+PSRI++C+E
Sbjct  61   VSLDNHQEAEINLIITDYCMPGMTGYDLLKKIKESASLRNIPVVIMSSENVPSRISRCLE  120



>gb|AHM24030.1| two-component response regulator [Rosa canina]
Length=233

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 88/118 (75%), Gaps = 8/118 (7%)
 Frame = +1

Query  121  DEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHN------S  282
            D   HVLAVDD  I+  +IE+LLK+SS +VTT ++G +ALE+LGL   D Q N      S
Sbjct  6    DSQFHVLAVDDSLIDRKLIERLLKTSSYQVTTVDSGSKALEFLGLYEDD-QTNPDSPSVS  64

Query  283  PNTNVP-KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            PN     +VNLIITDY MPGM GY+LL+K+K+S+  K++PVV+MSSEN+PSRIN+C+E
Sbjct  65   PNNQQEVEVNLIITDYCMPGMTGYDLLRKIKESSSLKNIPVVIMSSENVPSRINRCLE  122



>ref|XP_010427564.1| PREDICTED: two-component response regulator ARR9-like [Camelina 
sativa]
Length=235

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 10/125 (8%)
 Frame = +1

Query  103  MGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNS  282
            MG   E +  HVLAVDD   +  +IE+LL+ SSC+VTT ++G +ALE+LGL  G ++ N 
Sbjct  1    MGMAAESQ-FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQG-IESND  58

Query  283  PNT--------NVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRI  438
            PN            +VNLIITDY MPGM GY+LLKKVK+S+ FK++PVV+MSSEN+P+ I
Sbjct  59   PNALSTALVNHQEVEVNLIITDYCMPGMTGYDLLKKVKESSAFKNIPVVIMSSENVPATI  118

Query  439  NQCME  453
            ++C+E
Sbjct  119  SRCLE  123



>ref|XP_010095968.1| Two-component response regulator [Morus notabilis]
 gb|EXB62661.1| Two-component response regulator [Morus notabilis]
Length=247

 Score =   130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 7/119 (6%)
 Frame = +1

Query  97   MAMGENGEDEVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQH  276
            MAM  N +    HVLAVDD  I+  +IE LLK+SS +VT  ++G +ALE+LGL   D Q+
Sbjct  1    MAMAANAQ---FHVLAVDDSIIDRKLIETLLKTSSFQVTAVDSGSKALEFLGL-HEDEQN  56

Query  277  NSPNTNVPKVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            +  N+   +VN+IITDYSMPGM GY+LL+K+K S   KDVPVV+MSSENIPSRI++C+E
Sbjct  57   HHHNS---EVNMIITDYSMPGMTGYDLLRKIKKSKYLKDVPVVIMSSENIPSRISRCLE  112



>ref|XP_010414625.1| PREDICTED: two-component response regulator ARR3 [Camelina sativa]
Length=232

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D    +   +  KV+
Sbjct  34   VHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DEDKAAVEFDRLKVD  90

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GYELLKK+K+S  FK+VPVV+MSSEN+ +RI++C+E
Sbjct  91   LIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVLTRIDRCLE  138



>gb|AAK14395.1|AF339732_1 response regulator protein [Dianthus caryophyllus]
Length=264

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  133  HVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVNL  312
            HVLAVDD  I+  +IE+LLK++SCKVT  ++G+RALE+LGL   D +  +   +  K++L
Sbjct  36   HVLAVDDSLIDRKVIERLLKTTSCKVTVVDSGMRALEFLGL---DAEQRTSVVDGLKIDL  92

Query  313  IITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            IITDY MPGM GYELLKK+K+S+ FK+ PVV+MSSEN+ +RI++C+E
Sbjct  93   IITDYCMPGMTGYELLKKIKESSTFKETPVVIMSSENVIARIDRCLE  139



>ref|XP_002886648.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62907.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++ I+IE+LL+ +SCKVT  ++G RALE+LGL   D +  +   +  KV+
Sbjct  33   VHVLAVDDSLLDRIVIERLLRITSCKVTAVDSGWRALEFLGL---DDKKAAVEFDRLKVD  89

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LIITDY MPGM GYELLKK+K+S  FK+VPVV+MSSEN+ +RI++C+E
Sbjct  90   LIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVITRIDRCLE  137



>ref|XP_003608937.1| Two-component response regulator ARR5 [Medicago truncatula]
Length=214

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  130  IHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNTNVPKVN  309
            +HVLAVDD  ++  +IE+LLK SSCKVT  E+  RAL++LGL   D +++    +  KVN
Sbjct  26   LHVLAVDDSLVDRKVIERLLKISSCKVTVVESARRALQFLGL---DGENSDVAFDAVKVN  82

Query  310  LIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            LI+TDYSMPGM GYELLKK+K+S++F+++PVV+MSSEN+ +RI++C+E
Sbjct  83   LIMTDYSMPGMTGYELLKKIKESSVFREIPVVIMSSENVLTRIDRCLE  130



>gb|KJB77154.1| hypothetical protein B456_012G123500 [Gossypium raimondii]
Length=236

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  124  EVIHVLAVDDDPINLIIIEKLLKSSSCKVTTAENGVRALEYLGLLAGDVQHNSPNT-NVP  300
            E +HVLAVDD  ++  +IE+LL+ SSCKVT  ++G RAL+YLGL   ++Q    N  +  
Sbjct  27   EEVHVLAVDDSLVDRKVIERLLRISSCKVTAVDSGRRALQYLGL-DEEIQKKETNGFDGL  85

Query  301  KVNLIITDYSMPGMNGYELLKKVKDSAMFKDVPVVVMSSENIPSRINQCME  453
            KV+LIITDY MPGM GYELLKKVK+S+ F+++PVV+MSSEN+ +RI++C+E
Sbjct  86   KVDLIITDYCMPGMTGYELLKKVKESSAFREIPVVIMSSENVIARIDRCLE  136



Lambda      K        H        a         alpha
   0.314    0.132    0.368    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 550993649940