BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015G02 630 bp,

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614877.1|  PREDICTED: basic blue protein-like                 202   4e-62   Nicotiana tomentosiformis
ref|XP_009803778.1|  PREDICTED: basic blue protein-like                 201   1e-61   Nicotiana sylvestris
ref|XP_006338690.1|  PREDICTED: blue copper protein-like                196   7e-60   Solanum tuberosum [potatoes]
ref|XP_004231787.1|  PREDICTED: mavicyanin                              196   7e-60   Solanum lycopersicum
gb|KDO55610.1|  hypothetical protein CISIN_1g030729mg                   184   3e-55   Citrus sinensis [Valencia orange]
ref|XP_006447099.1|  hypothetical protein CICLE_v10016947mg             184   3e-55   Citrus clementina
ref|XP_011003937.1|  PREDICTED: mavicyanin                              181   5e-54   Populus euphratica
ref|XP_002298616.2|  hypothetical protein POPTR_0001s33960g             181   9e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010029008.1|  PREDICTED: mavicyanin                              178   1e-52   Eucalyptus grandis [rose gum]
emb|CDP16681.1|  unnamed protein product                                178   1e-52   Coffea canephora [robusta coffee]
ref|XP_007151532.1|  hypothetical protein PHAVU_004G054700g             177   4e-52   Phaseolus vulgaris [French bean]
ref|NP_001237874.1|  uncharacterized protein LOC100305865 precursor     176   6e-52   Glycine max [soybeans]
gb|KDP46298.1|  hypothetical protein JCGZ_10138                         176   7e-52   Jatropha curcas
ref|XP_010670421.1|  PREDICTED: basic blue protein-like                 176   9e-52   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008379120.1|  PREDICTED: mavicyanin                              176   1e-51   Malus domestica [apple tree]
ref|XP_002509536.1|  Blue copper protein precursor, putative            175   1e-51   Ricinus communis
ref|XP_002262831.1|  PREDICTED: mavicyanin                              175   2e-51   Vitis vinifera
ref|XP_010425458.1|  PREDICTED: mavicyanin-like                         174   6e-51   Camelina sativa [gold-of-pleasure]
gb|AFK46705.1|  unknown                                                 173   6e-51   Lotus japonicus
gb|KHF97412.1|  Blue copper                                             172   2e-50   Gossypium arboreum [tree cotton]
ref|XP_007161746.1|  hypothetical protein PHAVU_001G095100g             172   3e-50   Phaseolus vulgaris [French bean]
ref|XP_010514410.1|  PREDICTED: mavicyanin-like                         172   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006395473.1|  hypothetical protein EUTSA_v10005008mg             171   5e-50   Eutrema salsugineum
ref|XP_006291939.1|  hypothetical protein CARUB_v10018126mg             171   5e-50   Capsella rubella
ref|XP_010502682.1|  PREDICTED: mavicyanin-like                         171   6e-50   Camelina sativa [gold-of-pleasure]
ref|NP_001237236.1|  uncharacterized protein LOC100306337 precursor     171   7e-50   Glycine max [soybeans]
ref|XP_010248962.1|  PREDICTED: mavicyanin                              170   9e-50   Nelumbo nucifera [Indian lotus]
gb|KJB11652.1|  hypothetical protein B456_001G270000                    170   1e-49   Gossypium raimondii
ref|XP_004489604.1|  PREDICTED: blue copper protein-like                170   1e-49   Cicer arietinum [garbanzo]
ref|XP_009129442.1|  PREDICTED: mavicyanin-like                         168   5e-49   Brassica rapa
ref|XP_007031840.1|  Cupredoxin superfamily protein                     169   6e-49   Theobroma cacao [chocolate]
emb|CDY28484.1|  BnaC02g36760D                                          167   1e-48   Brassica napus [oilseed rape]
ref|XP_010528169.1|  PREDICTED: mavicyanin                              167   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_002877026.1|  hypothetical protein ARALYDRAFT_484503             167   2e-48   Arabidopsis lyrata subsp. lyrata
emb|CDX83667.1|  BnaC07g24070D                                          167   2e-48   Brassica napus [oilseed rape]
ref|XP_009151984.1|  PREDICTED: mavicyanin                              167   4e-48   Brassica rapa
gb|AAM62707.1|  blue copper protein, putative                           165   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|ACR77748.1|  plastocyanin-like domain-containing protein             165   2e-47   Astragalus sinicus
emb|CDY13690.1|  BnaA06g32330D                                          165   2e-47   Brassica napus [oilseed rape]
gb|KFK33640.1|  hypothetical protein AALP_AA5G039900                    164   2e-47   Arabis alpina [alpine rockcress]
ref|XP_008341310.1|  PREDICTED: basic blue protein-like                 163   7e-47   Malus domestica [apple tree]
ref|NP_566810.1|  plastocyanin-like domain-containing protein           163   8e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111589.1|  Blue copper protein                                163   8e-47   Morus notabilis
ref|XP_007216268.1|  hypothetical protein PRUPE_ppa017323mg             161   3e-46   Prunus persica
ref|XP_003618846.1|  Plastocyanin-like domain-containing protein        161   6e-46   Medicago truncatula
ref|XP_008231138.1|  PREDICTED: mavicyanin                              160   1e-45   Prunus mume [ume]
ref|XP_009371662.1|  PREDICTED: mavicyanin                              159   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_011098865.1|  PREDICTED: mavicyanin                              158   8e-45   Sesamum indicum [beniseed]
ref|XP_004168663.1|  PREDICTED: blue copper protein-like                157   1e-44   
ref|XP_004138792.1|  PREDICTED: blue copper protein-like                157   2e-44   
ref|XP_008441346.1|  PREDICTED: mavicyanin-like                         156   4e-44   Cucumis melo [Oriental melon]
ref|XP_004303985.1|  PREDICTED: basic blue protein                      152   2e-42   Fragaria vesca subsp. vesca
dbj|BAB02115.1|  unnamed protein product                                152   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EYU45397.1|  hypothetical protein MIMGU_mgv1a014864mg                151   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_006848436.1|  hypothetical protein AMTR_s00013p00238100          148   5e-41   Amborella trichopoda
gb|ABK26728.1|  unknown                                                 147   1e-40   Picea sitchensis
gb|KJB79910.1|  hypothetical protein B456_013G071700                    123   9e-31   Gossypium raimondii
gb|KJB50019.1|  hypothetical protein B456_008G150100                    120   7e-30   Gossypium raimondii
ref|XP_007043352.1|  Uclacyanin 1, putative                             118   3e-29   Theobroma cacao [chocolate]
ref|XP_010106325.1|  Early nodulin-like protein 1                       118   4e-29   Morus notabilis
ref|XP_007216249.1|  hypothetical protein PRUPE_ppa017076mg             118   6e-29   Prunus persica
ref|XP_008341968.1|  PREDICTED: blue copper protein-like                118   8e-29   Malus domestica [apple tree]
ref|XP_008230134.1|  PREDICTED: blue copper protein                     118   8e-29   Prunus mume [ume]
ref|XP_011003250.1|  PREDICTED: uclacyanin-2-like                       117   2e-28   Populus euphratica
ref|XP_009342269.1|  PREDICTED: blue copper protein                     117   3e-28   Pyrus x bretschneideri [bai li]
emb|CDY19128.1|  BnaA04g18680D                                          116   6e-28   Brassica napus [oilseed rape]
ref|XP_008798824.1|  PREDICTED: blue copper protein-like                113   2e-27   Phoenix dactylifera
ref|XP_009143966.1|  PREDICTED: blue copper protein-like                114   2e-27   Brassica rapa
emb|CDY12217.1|  BnaC04g12470D                                          114   2e-27   Brassica napus [oilseed rape]
gb|EMT07777.1|  Blue copper protein                                     112   3e-27   Aegilops tauschii
gb|EMT33683.1|  Blue copper protein                                     112   3e-27   Aegilops tauschii
gb|KHN25766.1|  Early nodulin-like protein 1                            113   3e-27   Glycine soja [wild soybean]
ref|XP_003540323.1|  PREDICTED: blue copper protein-like                113   3e-27   Glycine max [soybeans]
gb|EMS58905.1|  Blue copper protein                                     112   3e-27   Triticum urartu
gb|ACU23845.1|  unknown                                                 113   3e-27   Glycine max [soybeans]
ref|XP_009353238.1|  PREDICTED: blue copper protein-like                114   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_009132835.1|  PREDICTED: blue copper protein-like                114   4e-27   Brassica rapa
ref|XP_009341435.1|  PREDICTED: blue copper protein-like                114   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_002272263.1|  PREDICTED: uclacyanin-3                            112   4e-27   Vitis vinifera
ref|XP_010414015.1|  PREDICTED: blue copper protein-like                114   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004137571.1|  PREDICTED: early nodulin-55-2-like                 113   5e-27   Cucumis sativus [cucumbers]
emb|CAN66310.1|  hypothetical protein VITISV_027162                     112   5e-27   Vitis vinifera
ref|XP_004287916.1|  PREDICTED: blue copper protein                     113   5e-27   Fragaria vesca subsp. vesca
ref|XP_008437239.1|  PREDICTED: chemocyanin-like                        112   6e-27   Cucumis melo [Oriental melon]
ref|XP_002309845.1|  UCLACYANIN 1 family protein                        113   6e-27   Populus trichocarpa [western balsam poplar]
emb|CDY65457.1|  BnaC03g71950D                                          113   7e-27   Brassica napus [oilseed rape]
ref|NP_180789.1|  uclacyanin 1                                          113   7e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01024.1|  uclacyanin I - like predicted GPI-anchored protein     113   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510046.1|  PREDICTED: blue copper protein-like                113   9e-27   Camelina sativa [gold-of-pleasure]
gb|KDO59873.1|  hypothetical protein CISIN_1g043413mg                   111   1e-26   Citrus sinensis [Valencia orange]
ref|XP_010469615.1|  PREDICTED: blue copper protein                     112   1e-26   Camelina sativa [gold-of-pleasure]
gb|EMS50846.1|  Blue copper protein                                     110   1e-26   Triticum urartu
gb|EMS58904.1|  Mavicyanin                                              110   2e-26   Triticum urartu
gb|KDO48731.1|  hypothetical protein CISIN_1g042393mg                   110   2e-26   Citrus sinensis [Valencia orange]
ref|XP_002274801.1|  PREDICTED: uclacyanin-3                            111   2e-26   Vitis vinifera
ref|XP_006289951.1|  hypothetical protein CARUB_v10003579mg             110   3e-26   Capsella rubella
gb|KFK31132.1|  hypothetical protein AALP_AA6G072100                    112   3e-26   Arabis alpina [alpine rockcress]
gb|ABK26526.1|  unknown                                                 110   3e-26   Picea sitchensis
ref|XP_010919749.1|  PREDICTED: blue copper protein-like                110   3e-26   Elaeis guineensis
ref|XP_004487369.1|  PREDICTED: blue copper protein-like                111   3e-26   Cicer arietinum [garbanzo]
gb|EMT07779.1|  Mavicyanin                                              109   3e-26   Aegilops tauschii
ref|XP_006295920.1|  hypothetical protein CARUB_v10025057mg             111   4e-26   Capsella rubella
ref|XP_003575446.1|  PREDICTED: stellacyanin-like                       110   4e-26   Brachypodium distachyon [annual false brome]
ref|XP_010247016.1|  PREDICTED: uclacyanin-3                            110   5e-26   Nelumbo nucifera [Indian lotus]
gb|KHN10810.1|  Blue copper protein                                     107   5e-26   Glycine soja [wild soybean]
ref|XP_010109549.1|  Blue copper protein                                110   6e-26   Morus notabilis
gb|ACU19678.1|  unknown                                                 109   1e-25   Glycine max [soybeans]
ref|XP_003543376.1|  PREDICTED: blue copper protein-like                109   1e-25   
gb|KHN36563.1|  Early nodulin-like protein 1                            109   1e-25   Glycine soja [wild soybean]
ref|XP_010522318.1|  PREDICTED: blue copper protein                     110   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_006469730.1|  PREDICTED: early nodulin-20-like                   109   2e-25   Citrus sinensis [Valencia orange]
ref|XP_006410363.1|  hypothetical protein EUTSA_v10017076mg             110   2e-25   Eutrema salsugineum
ref|XP_002879382.1|  hypothetical protein ARALYDRAFT_482160             109   2e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_006352033.1|  PREDICTED: early nodulin-20-like                   108   3e-25   Solanum tuberosum [potatoes]
ref|XP_006441403.1|  hypothetical protein CICLE_v10023892mg             109   3e-25   Citrus clementina
ref|XP_008379599.1|  PREDICTED: blue copper protein-like                108   3e-25   Malus domestica [apple tree]
gb|EMT33682.1|  Blue copper protein                                     107   3e-25   Aegilops tauschii
ref|XP_010931419.1|  PREDICTED: uclacyanin-3-like                       108   3e-25   Elaeis guineensis
dbj|BAK00202.1|  predicted protein                                      106   6e-25   Hordeum vulgare subsp. vulgare [barley]
gb|EMS56684.1|  Mavicyanin                                              106   7e-25   Triticum urartu
ref|XP_006399230.1|  hypothetical protein EUTSA_v10014745mg             106   9e-25   Eutrema salsugineum
ref|XP_006493407.1|  PREDICTED: blue copper protein-like                107   9e-25   Citrus sinensis [Valencia orange]
ref|XP_002515714.1|  Early nodulin 20 precursor, putative               107   1e-24   Ricinus communis
ref|XP_004251506.1|  PREDICTED: uclacyanin-3-like                       107   1e-24   Solanum lycopersicum
ref|XP_011029118.1|  PREDICTED: mavicyanin-like                         105   1e-24   Populus euphratica
ref|XP_003597041.1|  Blue copper protein                                107   1e-24   Medicago truncatula
gb|AFK38402.1|  unknown                                                 106   2e-24   Medicago truncatula
ref|XP_008800585.1|  PREDICTED: mavicyanin-like                         105   2e-24   Phoenix dactylifera
ref|XP_006659099.1|  PREDICTED: blue copper protein-like                105   2e-24   Oryza brachyantha
ref|NP_001152010.1|  blue copper protein precursor                      105   2e-24   Zea mays [maize]
gb|EMS58903.1|  Blue copper protein                                     107   3e-24   Triticum urartu
ref|NP_001060958.2|  Os08g0138200                                       105   3e-24   
gb|EAZ05532.1|  hypothetical protein OsI_27748                          105   3e-24   Oryza sativa Indica Group [Indian rice]
gb|ACN28394.1|  unknown                                                 104   3e-24   Zea mays [maize]
gb|EMT06002.1|  Mavicyanin                                              104   3e-24   Aegilops tauschii
gb|EAZ41457.1|  hypothetical protein OsJ_25979                          104   3e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EMS56686.1|  Mavicyanin                                              104   4e-24   Triticum urartu
gb|KJB19644.1|  hypothetical protein B456_003G111800                    104   4e-24   Gossypium raimondii
ref|XP_010424736.1|  PREDICTED: mavicyanin-like                         105   4e-24   Camelina sativa [gold-of-pleasure]
gb|AFK47720.1|  unknown                                                 105   4e-24   Medicago truncatula
ref|XP_009402874.1|  PREDICTED: mavicyanin-like                         105   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009602744.1|  PREDICTED: uclacyanin-3-like                       105   5e-24   Nicotiana tomentosiformis
ref|XP_006662866.1|  PREDICTED: chemocyanin-like                        102   6e-24   Oryza brachyantha
emb|CDX81058.1|  BnaC03g03120D                                          104   6e-24   Brassica napus [oilseed rape]
gb|AAR15487.1|  Cu2+ plastocyanin-like                                  104   6e-24   Arabidopsis arenosa
ref|XP_002873311.1|  hypothetical protein ARALYDRAFT_487581             104   6e-24   Arabidopsis lyrata subsp. lyrata
dbj|BAD03006.1|  putative blue copper binding protein                   104   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008793738.1|  PREDICTED: blue copper protein-like                105   7e-24   Phoenix dactylifera
ref|XP_010528834.1|  PREDICTED: mavicyanin-like                         102   9e-24   Tarenaya hassleriana [spider flower]
ref|XP_009763857.1|  PREDICTED: uclacyanin-3-like                       104   9e-24   Nicotiana sylvestris
ref|XP_011014141.1|  PREDICTED: mavicyanin-like                         103   1e-23   Populus euphratica
ref|NP_680152.1|  cupredoxin superfamily protein                        103   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EMT26024.1|  Blue copper protein                                     103   1e-23   Aegilops tauschii
ref|XP_003575447.1|  PREDICTED: mavicyanin-like                         103   1e-23   Brachypodium distachyon [annual false brome]
gb|EAZ05531.1|  hypothetical protein OsI_27747                          103   1e-23   Oryza sativa Indica Group [Indian rice]
gb|ABU56004.1|  blue copper-binding protein                             103   1e-23   Dasypyrum villosum
ref|XP_011023908.1|  PREDICTED: basic blue protein-like                 102   1e-23   Populus euphratica
emb|CDX70043.1|  BnaA10g23920D                                          103   1e-23   Brassica napus [oilseed rape]
gb|AAR15473.1|  Cu2+ plastocyanin-like                                  103   1e-23   Olimarabidopsis pumila
ref|XP_002459878.1|  hypothetical protein SORBIDRAFT_02g012920          102   1e-23   Sorghum bicolor [broomcorn]
ref|XP_010491367.1|  PREDICTED: stellacyanin-like                       103   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_003620297.1|  Blue copper protein                                103   1e-23   Medicago truncatula
ref|XP_010035616.1|  PREDICTED: blue copper protein-like                104   1e-23   Eucalyptus grandis [rose gum]
emb|CBI28975.3|  unnamed protein product                                103   2e-23   Vitis vinifera
ref|XP_006653637.1|  PREDICTED: blue copper protein-like                101   2e-23   Oryza brachyantha
gb|ADV57636.1|  copper binding protein 1                                102   2e-23   Gossypium hirsutum [American cotton]
ref|XP_009122335.1|  PREDICTED: blue copper protein                     103   2e-23   Brassica rapa
ref|XP_010270093.1|  PREDICTED: mavicyanin-like                         102   2e-23   Nelumbo nucifera [Indian lotus]
gb|EEC82872.1|  hypothetical protein OsI_27745                          102   2e-23   Oryza sativa Indica Group [Indian rice]
gb|EEE68013.1|  hypothetical protein OsJ_25976                          102   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ADV57637.1|  copper binding protein 2                                102   3e-23   Gossypium hirsutum [American cotton]
gb|KHG23308.1|  hypothetical protein F383_28880                         102   3e-23   Gossypium arboreum [tree cotton]
emb|CAD41463.3|  OSJNBa0079A21.7                                        102   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06003.1|  Stellacyanin                                            104   4e-23   Aegilops tauschii
ref|NP_001053468.1|  Os04g0545600                                       102   4e-23   
gb|EMS56683.1|  Blue copper protein                                     100   4e-23   Triticum urartu
dbj|BAJ99404.1|  predicted protein                                      101   5e-23   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009130995.1|  PREDICTED: mavicyanin-like                         102   5e-23   Brassica rapa
ref|XP_002319042.1|  hypothetical protein POPTR_0013s03090g             101   5e-23   Populus trichocarpa [western balsam poplar]
ref|NP_001060957.1|  Os08g0137800                                       101   5e-23   
ref|XP_004239759.1|  PREDICTED: stellacyanin-like                       101   5e-23   Solanum lycopersicum
ref|XP_007026253.1|  Copper binding protein 9, putative                 101   6e-23   Theobroma cacao [chocolate]
ref|XP_009612608.1|  PREDICTED: uclacyanin-2-like                       103   6e-23   Nicotiana tomentosiformis
emb|CAH67255.1|  OSIGBa0101C23.7                                        101   6e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010513176.1|  PREDICTED: mavicyanin-like                         101   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006447468.1|  hypothetical protein CICLE_v10018339mg             102   7e-23   Citrus clementina
gb|EAY95049.1|  hypothetical protein OsI_16864                          101   7e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_004133765.1|  PREDICTED: blue copper protein-like                100   7e-23   Cucumis sativus [cucumbers]
dbj|BAD03003.1|  putative blue copper binding protein                   101   7e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006445439.1|  hypothetical protein CICLE_v10022525mg             100   7e-23   Citrus clementina
ref|XP_010484775.1|  PREDICTED: mavicyanin-like                         101   8e-23   Camelina sativa [gold-of-pleasure]
gb|EMT03203.1|  Blue copper protein                                     100   8e-23   Aegilops tauschii
gb|EMS56685.1|  Mavicyanin                                              100   8e-23   Triticum urartu
ref|XP_008653633.1|  PREDICTED: mavicyanin-like                         100   9e-23   Zea mays [maize]
tpg|DAA36598.1|  TPA: hypothetical protein ZEAMMB73_027469              100   9e-23   Zea mays [maize]
ref|XP_002319041.1|  hypothetical protein POPTR_0013s03110g             100   1e-22   Populus trichocarpa [western balsam poplar]
gb|EMT28687.1|  Mavicyanin                                              100   1e-22   Aegilops tauschii
ref|XP_011021555.1|  PREDICTED: mavicyanin                              100   1e-22   Populus euphratica
ref|NP_001149787.1|  blue copper protein precursor                      100   1e-22   Zea mays [maize]
ref|XP_009421430.1|  PREDICTED: mavicyanin-like                         100   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007149946.1|  hypothetical protein PHAVU_005G112600g             101   1e-22   Phaseolus vulgaris [French bean]
ref|XP_006449853.1|  hypothetical protein CICLE_v10018260mg           99.0    1e-22   Citrus clementina
gb|KDP28869.1|  hypothetical protein JCGZ_14640                         100   1e-22   Jatropha curcas
ref|XP_004953983.1|  PREDICTED: blue copper protein-like                101   1e-22   Setaria italica
ref|XP_009764625.1|  PREDICTED: uclacyanin-3-like                       102   1e-22   Nicotiana sylvestris
ref|XP_008373105.1|  PREDICTED: blue copper protein                     100   1e-22   Malus domestica [apple tree]
ref|XP_006360596.1|  PREDICTED: early nodulin-20-like                   102   1e-22   Solanum tuberosum [potatoes]
gb|EMT12765.1|  Mavicyanin                                            99.8    2e-22   Aegilops tauschii
gb|EMS59213.1|  Blue copper protein                                     100   2e-22   Triticum urartu
gb|AAR15424.1|  Cu2+ plastocyanin-like                                  100   2e-22   Sisymbrium irio
gb|ACN54192.1|  blue copper protein                                     100   2e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004252640.1|  PREDICTED: mavicyanin-like                       99.4    2e-22   Solanum lycopersicum
ref|XP_007038255.1|  Cupredoxin superfamily protein, putative           102   2e-22   Theobroma cacao [chocolate]
ref|NP_001047603.2|  Os02g0653200                                       100   2e-22   
ref|XP_006467342.1|  PREDICTED: early nodulin-like protein 2-like       100   2e-22   Citrus sinensis [Valencia orange]
ref|XP_010419426.1|  PREDICTED: mavicyanin-like                         100   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003570004.1|  PREDICTED: mavicyanin                              100   2e-22   Brachypodium distachyon [annual false brome]
dbj|BAK00233.1|  predicted protein                                    99.4    2e-22   Hordeum vulgare subsp. vulgare [barley]
emb|CDY65237.1|  BnaC09g47900D                                          100   2e-22   Brassica napus [oilseed rape]
gb|KFK26413.1|  hypothetical protein AALP_AA8G245300                  99.8    2e-22   Arabis alpina [alpine rockcress]
ref|XP_010940769.1|  PREDICTED: mavicyanin-like                       99.4    3e-22   Elaeis guineensis
ref|XP_010523261.1|  PREDICTED: stellacyanin                          99.8    3e-22   Tarenaya hassleriana [spider flower]
ref|XP_006347977.1|  PREDICTED: uclacyanin-2-like                     99.8    3e-22   Solanum tuberosum [potatoes]
ref|XP_007152571.1|  hypothetical protein PHAVU_004G141300g             100   3e-22   Phaseolus vulgaris [French bean]
ref|XP_010252614.1|  PREDICTED: early nodulin-like protein 1          99.4    3e-22   Nelumbo nucifera [Indian lotus]
gb|ADE76474.1|  unknown                                               99.8    3e-22   Picea sitchensis
ref|XP_010473933.1|  PREDICTED: mavicyanin-like                       99.4    4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010513354.1|  PREDICTED: mavicyanin-like                       99.4    4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002303545.1|  hypothetical protein POPTR_0003s11780g           99.0    4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010418740.1|  PREDICTED: mavicyanin-like                       99.4    4e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001168456.1|  uncharacterized protein LOC100382230 precursor   99.8    4e-22   Zea mays [maize]
ref|XP_002452517.1|  hypothetical protein SORBIDRAFT_04g027290        99.8    5e-22   Sorghum bicolor [broomcorn]
ref|XP_009386091.1|  PREDICTED: mavicyanin-like                       99.4    5e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008437773.1|  PREDICTED: basic blue protein                    98.6    5e-22   
gb|EMT06001.1|  Mavicyanin                                            99.8    5e-22   Aegilops tauschii
ref|XP_006647616.1|  PREDICTED: blue copper protein-like              99.4    5e-22   Oryza brachyantha
ref|XP_011101849.1|  PREDICTED: mavicyanin-like                       99.0    5e-22   Sesamum indicum [beniseed]
ref|XP_002466248.1|  hypothetical protein SORBIDRAFT_01g004320        99.8    5e-22   Sorghum bicolor [broomcorn]
ref|NP_001060959.1|  Os08g0138400                                     99.0    6e-22   
ref|XP_009617386.1|  PREDICTED: mavicyanin-like isoform X1            98.2    7e-22   Nicotiana tomentosiformis
gb|EAY92135.1|  hypothetical protein OsI_13846                        98.2    7e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAK00909.1|  predicted protein                                    98.2    7e-22   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010242081.1|  PREDICTED: uclacyanin-2-like                       100   7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008449431.1|  PREDICTED: mavicyanin-like                       98.6    7e-22   Cucumis melo [Oriental melon]
ref|XP_010513178.1|  PREDICTED: mavicyanin-like                       99.0    8e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001053467.1|  Os04g0545400                                     98.6    8e-22   
ref|XP_010238910.1|  PREDICTED: uncharacterized protein LOC100829219    100   8e-22   
ref|XP_002874308.1|  hypothetical protein ARALYDRAFT_489473           98.6    8e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_004970211.1|  PREDICTED: blue copper protein-like                100   9e-22   Setaria italica
ref|XP_002528414.1|  Cucumber peeling cupredoxin, putative            98.2    9e-22   Ricinus communis
ref|XP_010258754.1|  PREDICTED: uclacyanin-2-like                     97.4    9e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009417408.1|  PREDICTED: uclacyanin-2-like                     98.6    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004229737.1|  PREDICTED: uclacyanin-3-like                     98.2    1e-21   Solanum lycopersicum
ref|XP_001760382.1|  predicted protein                                97.4    1e-21   Physcomitrella patens
gb|EEC82220.1|  hypothetical protein OsI_26368                        98.2    1e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_198005.1|  plastocyanin-like domain-containing protein / p...  98.2    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417403.1|  PREDICTED: uclacyanin-2-like                     98.6    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002459877.1|  hypothetical protein SORBIDRAFT_02g012910        97.8    1e-21   Sorghum bicolor [broomcorn]
ref|XP_006385823.1|  hypothetical protein POPTR_0003s15000g           97.8    1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006588272.1|  PREDICTED: blue copper protein-like              99.0    1e-21   
ref|XP_002460378.1|  hypothetical protein SORBIDRAFT_02g027260        97.4    1e-21   Sorghum bicolor [broomcorn]
ref|XP_003610698.1|  Early nodulin-like protein                       97.8    1e-21   Medicago truncatula
ref|XP_009604686.1|  PREDICTED: uclacyanin-3-like                     97.4    1e-21   Nicotiana tomentosiformis
ref|XP_011071572.1|  PREDICTED: mavicyanin-like                       97.8    1e-21   Sesamum indicum [beniseed]
ref|XP_009399281.1|  PREDICTED: uclacyanin-3-like                     99.8    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO37971.1|  putative blue copper-binding protein                  97.8    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010905831.1|  PREDICTED: basic blue protein-like               96.3    1e-21   Elaeis guineensis
ref|XP_002266922.1|  PREDICTED: basic blue protein                    96.3    1e-21   Vitis vinifera
ref|XP_006345914.1|  PREDICTED: blue copper protein-like              97.8    1e-21   Solanum tuberosum [potatoes]
ref|XP_009129922.1|  PREDICTED: mavicyanin-like                       97.8    1e-21   Brassica rapa
dbj|BAC83768.1|  putative phytocyanin                                 98.2    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAR13691.1|  Cu2+ plastocyanin-like protein                        98.2    1e-21   Brassica oleracea
gb|KDP29124.1|  hypothetical protein JCGZ_16513                       96.3    1e-21   Jatropha curcas
gb|EMS58906.1|  Blue copper protein                                   97.1    1e-21   Triticum urartu
ref|XP_004953310.1|  PREDICTED: blue copper protein-like              98.2    1e-21   Setaria italica
gb|ADV57644.1|  copper binding protein 9                              96.7    2e-21   Gossypium hirsutum [American cotton]
gb|KJB22859.1|  hypothetical protein B456_004G069900                  97.1    2e-21   Gossypium raimondii
ref|XP_006296184.1|  hypothetical protein CARUB_v10025347mg           97.8    2e-21   Capsella rubella
ref|XP_010051204.1|  PREDICTED: uclacyanin-2-like                     99.0    2e-21   Eucalyptus grandis [rose gum]
ref|XP_010473934.1|  PREDICTED: cucumber peeling cupredoxin-like      98.2    2e-21   
ref|XP_010104273.1|  Blue copper protein                              97.4    2e-21   
ref|XP_009373210.1|  PREDICTED: uclacyanin-3                          97.4    2e-21   
gb|ADV57638.1|  copper binding protein 3                              97.4    2e-21   
ref|XP_006385822.1|  hypothetical protein POPTR_0003s15000g           97.4    2e-21   
gb|KDP25566.1|  hypothetical protein JCGZ_20722                       97.1    2e-21   
ref|XP_004956416.1|  PREDICTED: blue copper protein-like              97.4    2e-21   
ref|NP_180663.1|  cupredoxin domain-containing protein                97.8    2e-21   
gb|KJB22860.1|  hypothetical protein B456_004G069900                  97.1    2e-21   
ref|XP_010512729.1|  PREDICTED: mavicyanin-like                       97.4    2e-21   
gb|EMT14986.1|  Blue copper protein                                   97.4    2e-21   
emb|CDY19774.1|  BnaA09g04270D                                        97.1    2e-21   
ref|XP_011033855.1|  PREDICTED: mavicyanin-like                       96.7    2e-21   
ref|XP_011081079.1|  PREDICTED: blue copper protein-like              97.8    2e-21   
ref|XP_006394874.1|  hypothetical protein EUTSA_v10004981mg           97.1    2e-21   
ref|NP_001152678.1|  blue copper protein precursor                    97.4    3e-21   
gb|KHN24517.1|  Blue copper protein                                   96.7    3e-21   
ref|XP_008458947.1|  PREDICTED: cucumber peeling cupredoxin-like      97.1    3e-21   
gb|KJB67327.1|  hypothetical protein B456_010G186200                  97.1    3e-21   
ref|XP_002452820.1|  hypothetical protein SORBIDRAFT_04g033180        97.4    3e-21   
ref|XP_006410227.1|  hypothetical protein EUTSA_v10017707mg           97.1    3e-21   
ref|XP_009595241.1|  PREDICTED: mavicyanin-like                       96.7    3e-21   
gb|KFK35457.1|  hypothetical protein AALP_AA5G286600                  96.7    3e-21   
ref|XP_011074212.1|  PREDICTED: blue copper protein                   97.1    4e-21   
ref|XP_006487069.1|  PREDICTED: mavicyanin-like                       96.7    4e-21   
ref|XP_010109138.1|  Blue copper protein                              96.7    4e-21   
ref|XP_003594205.1|  Cucumber peeling cupredoxin                      96.3    4e-21   
emb|CDX87053.1|  BnaC09g03680D                                        96.7    4e-21   
gb|EYU36477.1|  hypothetical protein MIMGU_mgv1a014161mg              97.1    4e-21   
gb|KJB25691.1|  hypothetical protein B456_004G204400                  96.3    4e-21   
pdb|1WS7|A  Chain A, Crystal Structure Of Mavicyanin From Cucurbi...  94.7    4e-21   
ref|XP_010275467.1|  PREDICTED: uclacyanin-3-like                     96.7    4e-21   
ref|XP_010939704.1|  PREDICTED: blue copper protein-like              96.3    4e-21   
gb|KGN50322.1|  hypothetical protein Csa_5G167140                     96.7    4e-21   
ref|XP_004158120.1|  PREDICTED: LOW QUALITY PROTEIN: blue copper ...  96.7    4e-21   
ref|NP_001130720.1|  uncharacterized protein LOC100191824 precursor   96.3    4e-21   
ref|XP_002314710.1|  hypothetical protein POPTR_0010s10020g           96.7    4e-21   
gb|ACG40270.1|  blue copper protein precursor                         96.3    4e-21   
ref|XP_006289264.1|  hypothetical protein CARUB_v10002730mg           96.3    5e-21   
sp|P80728.1|MAVI_CUCPE  RecName: Full=Mavicyanin                      94.4    5e-21   
ref|XP_009617784.1|  PREDICTED: uclacyanin-3-like                     96.7    5e-21   
ref|XP_010513183.1|  PREDICTED: mavicyanin-like                       96.7    5e-21   
ref|XP_011022375.1|  PREDICTED: stellacyanin-like                     96.3    5e-21   
ref|XP_010663957.1|  PREDICTED: blue copper protein-like              97.1    5e-21   
ref|XP_009586893.1|  PREDICTED: mavicyanin-like                       95.9    5e-21   
emb|CBI35287.3|  unnamed protein product                              96.7    6e-21   
ref|XP_002297929.1|  hypothetical protein POPTR_0001s11680g           96.3    6e-21   
ref|XP_008789579.1|  PREDICTED: mavicyanin-like                       95.9    6e-21   
ref|XP_008776646.1|  PREDICTED: mavicyanin-like                       96.3    6e-21   
ref|XP_003571364.1|  PREDICTED: mavicyanin-like                       95.9    6e-21   
ref|XP_010928884.1|  PREDICTED: mavicyanin-like isoform X1            96.3    6e-21   
gb|KDP40451.1|  hypothetical protein JCGZ_03951                       95.9    6e-21   
ref|XP_002274104.1|  PREDICTED: umecyanin                             95.5    7e-21   
ref|XP_006599708.1|  PREDICTED: blue copper protein-like              96.7    7e-21   
ref|XP_011081177.1|  PREDICTED: blue copper protein-like              96.3    7e-21   
ref|XP_006837021.1|  hypothetical protein AMTR_s00098p00173330        96.3    7e-21   
tpg|DAA57322.1|  TPA: early nodulin 20                                97.4    7e-21   
ref|NP_001148734.1|  early nodulin 20 precursor                       97.1    8e-21   
ref|XP_010418742.1|  PREDICTED: mavicyanin-like                       95.9    8e-21   
gb|AAD10251.1|  blue copper-binding protein homolog                   95.5    8e-21   
ref|XP_004511352.1|  PREDICTED: mavicyanin-like                       95.5    9e-21   
ref|XP_010513170.1|  PREDICTED: mavicyanin-like                       95.5    9e-21   
ref|XP_003521063.1|  PREDICTED: uclacyanin-2                          95.5    1e-20   
gb|ACU17256.1|  unknown                                               95.5    1e-20   
ref|XP_006410224.1|  hypothetical protein EUTSA_v10017770mg           96.3    1e-20   
ref|NP_001147368.1|  uclacyanin-2 precursor                           95.9    1e-20   
ref|XP_004152622.1|  PREDICTED: blue copper protein-like              95.9    1e-20   
ref|XP_009759380.1|  PREDICTED: mavicyanin-like isoform X1            95.1    1e-20   
ref|XP_008375772.1|  PREDICTED: uclacyanin-2                          94.4    1e-20   
emb|CAC39044.1|  uclacyanin 3-like protein                            95.5    1e-20   
ref|XP_006359909.1|  PREDICTED: mavicyanin-like                       95.1    1e-20   
gb|KDO47972.1|  hypothetical protein CISIN_1g046887mg                 94.7    1e-20   
ref|XP_010034982.1|  PREDICTED: blue copper protein                   95.1    1e-20   
ref|XP_006410241.1|  hypothetical protein EUTSA_v10017853mg           95.9    1e-20   
ref|XP_002443828.1|  hypothetical protein SORBIDRAFT_07g002870        94.7    1e-20   
ref|XP_010052912.1|  PREDICTED: mavicyanin-like                       95.1    1e-20   
tpg|DAA59341.1|  TPA: uclacyanin-2                                    95.5    1e-20   
gb|EMS47632.1|  Blue copper protein                                   95.5    1e-20   
ref|XP_009354404.1|  PREDICTED: early nodulin-like protein 2          95.1    2e-20   
gb|EMT26506.1|  Blue copper protein                                   93.6    2e-20   
ref|NP_001067784.1|  Os11g0428800                                     93.6    2e-20   
gb|EMT03640.1|  Blue copper protein                                   94.7    2e-20   
ref|XP_010421501.1|  PREDICTED: mavicyanin-like                       95.1    2e-20   
ref|XP_009770280.1|  PREDICTED: mavicyanin-like                       94.4    2e-20   
gb|AFK46878.1|  unknown                                               94.7    2e-20   
ref|XP_004972899.1|  PREDICTED: uclacyanin-2-like                     94.7    2e-20   
ref|XP_008356719.1|  PREDICTED: early nodulin-like protein 2          96.7    2e-20   
ref|XP_006296353.1|  hypothetical protein CARUB_v10025525mg           94.7    2e-20   
ref|XP_010662600.1|  PREDICTED: mavicyanin-like                       94.4    2e-20   
ref|XP_008240416.1|  PREDICTED: blue copper protein-like              95.1    2e-20   
ref|XP_007208915.1|  hypothetical protein PRUPE_ppa1027131mg          95.5    2e-20   
ref|XP_006659514.1|  PREDICTED: blue copper protein-like              94.4    2e-20   
ref|XP_002443827.1|  hypothetical protein SORBIDRAFT_07g002860        94.4    2e-20   
ref|XP_007155021.1|  hypothetical protein PHAVU_003G166500g           94.4    2e-20   
ref|XP_006448072.1|  hypothetical protein CICLE_v10018211mg           94.7    2e-20   
ref|XP_006410240.1|  hypothetical protein EUTSA_v10017630mg           94.7    2e-20   
gb|EMS57593.1|  Stellacyanin                                          96.7    2e-20   
ref|XP_010234087.1|  PREDICTED: mavicyanin-like                       94.4    2e-20   
ref|XP_010694374.1|  PREDICTED: blue copper protein-like              95.1    2e-20   
ref|XP_004246136.1|  PREDICTED: mavicyanin-like                       94.0    2e-20   
ref|XP_010454981.1|  PREDICTED: mavicyanin-like isoform X1            94.7    2e-20   
gb|EMS67148.1|  Early nodulin-like protein 1                          94.0    2e-20   
ref|XP_002303318.2|  hypothetical protein POPTR_0003s04580g           94.7    2e-20   
ref|XP_003592422.1|  Blue copper protein                              94.4    2e-20   
ref|XP_009790019.1|  PREDICTED: blue copper protein-like              96.3    3e-20   
ref|XP_011026746.1|  PREDICTED: mavicyanin                            94.4    3e-20   
ref|XP_008778065.1|  PREDICTED: mavicyanin-like                       94.0    3e-20   
ref|XP_004301049.1|  PREDICTED: mavicyanin-like                       94.4    3e-20   
ref|XP_009367150.1|  PREDICTED: early nodulin-like protein 2          96.7    3e-20   
ref|NP_001150898.1|  blue copper protein precursor                    94.4    3e-20   
ref|XP_009373387.1|  PREDICTED: blue copper protein-like              94.4    3e-20   
ref|XP_008643784.1|  PREDICTED: blue copper protein isoform X1        94.7    3e-20   
ref|XP_006839071.1|  hypothetical protein AMTR_s00090p00096100        94.0    3e-20   
ref|XP_006450890.1|  hypothetical protein CICLE_v10009575mg           94.4    3e-20   
ref|XP_010493895.1|  PREDICTED: mavicyanin-like                       94.4    3e-20   
ref|XP_010418734.1|  PREDICTED: mavicyanin-like                       94.4    3e-20   
ref|XP_008436972.1|  PREDICTED: stellacyanin                          94.4    3e-20   
ref|XP_006475877.1|  PREDICTED: blue copper protein-like              94.4    3e-20   
ref|XP_006363741.1|  PREDICTED: mavicyanin-like                       93.6    3e-20   
ref|XP_003517582.1|  PREDICTED: mavicyanin-like                       94.0    3e-20   
gb|EYU41504.1|  hypothetical protein MIMGU_mgv1a014825mg              94.0    3e-20   
ref|XP_006422904.1|  hypothetical protein CICLE_v10030206mg           93.6    3e-20   
ref|XP_011464698.1|  PREDICTED: blue copper protein-like              95.1    4e-20   
ref|XP_006658198.1|  PREDICTED: blue copper protein-like              94.0    4e-20   
ref|XP_009615798.1|  PREDICTED: mavicyanin-like                       94.0    4e-20   
ref|XP_001765613.1|  predicted protein                                92.4    4e-20   
emb|CDM84499.1|  unnamed protein product                              95.1    4e-20   
gb|EMT08781.1|  Chemocyanin                                           93.6    4e-20   
ref|XP_009760606.1|  PREDICTED: mavicyanin-like                       94.0    4e-20   
emb|CDY65141.1|  BnaC02g48390D                                        94.0    4e-20   
ref|XP_011032393.1|  PREDICTED: mavicyanin-like                       94.0    4e-20   
ref|XP_007141217.1|  hypothetical protein PHAVU_008G177100g           94.4    4e-20   
ref|XP_006448074.1|  hypothetical protein CICLE_v10018199mg           93.6    4e-20   
ref|XP_009771215.1|  PREDICTED: stellacyanin-like                     93.6    4e-20   
ref|XP_004956273.1|  PREDICTED: blue copper protein-like              93.6    4e-20   
ref|XP_007157148.1|  hypothetical protein PHAVU_002G046900g           94.0    4e-20   
ref|XP_002520566.1|  Cucumber peeling cupredoxin, putative            93.6    5e-20   
ref|XP_011012945.1|  PREDICTED: chemocyanin-like                      94.4    5e-20   
gb|KJB77347.1|  hypothetical protein B456_012G133200                  92.0    5e-20   
ref|XP_010413184.1|  PREDICTED: mavicyanin-like                       93.6    5e-20   
ref|XP_010508251.1|  PREDICTED: uclacyanin-2-like                     94.0    5e-20   
ref|XP_009627024.1|  PREDICTED: mavicyanin-like                       92.8    5e-20   
gb|KJB57835.1|  hypothetical protein B456_009G182800                  93.2    5e-20   
ref|XP_010542107.1|  PREDICTED: mavicyanin-like                       93.2    5e-20   
ref|XP_009398997.1|  PREDICTED: mavicyanin-like                       93.2    5e-20   
ref|XP_010653267.1|  PREDICTED: stellacyanin-like                     93.2    6e-20   
ref|XP_011090739.1|  PREDICTED: mavicyanin                            93.6    6e-20   
dbj|BAK00577.1|  predicted protein                                    93.6    6e-20   
emb|CAN70380.1|  hypothetical protein VITISV_002167                   92.4    6e-20   
gb|ABK21243.1|  unknown                                               92.8    6e-20   
ref|XP_006410225.1|  hypothetical protein EUTSA_v10017568mg           93.6    6e-20   
ref|XP_010473927.1|  PREDICTED: mavicyanin-like                       92.8    6e-20   
ref|NP_001149663.1|  uclacyanin-2 precursor                           92.8    7e-20   
gb|EMT33685.1|  Mavicyanin                                            92.4    7e-20   
ref|XP_010541901.1|  PREDICTED: mavicyanin-like                       92.8    7e-20   
ref|XP_006296298.1|  hypothetical protein CARUB_v10025469mg           93.6    7e-20   
ref|XP_006492291.1|  PREDICTED: mavicyanin-like                       93.2    7e-20   
ref|XP_008661974.1|  PREDICTED: uclacyanin-2 isoform X1               92.8    7e-20   
ref|XP_002302319.1|  plastocyanin-like domain-containing family p...  93.2    7e-20   
emb|CDX77818.1|  BnaC07g20720D                                        94.7    8e-20   
gb|KJB59902.1|  hypothetical protein B456_009G280000                  92.8    8e-20   
gb|EMT04532.1|  Mavicyanin                                            92.8    8e-20   
gb|KHG06922.1|  Blue copper                                           92.8    8e-20   
ref|XP_009765641.1|  PREDICTED: mavicyanin-like                       92.8    8e-20   
ref|XP_006421531.1|  hypothetical protein CICLE_v10006656mg           93.6    8e-20   
ref|XP_010542103.1|  PREDICTED: blue copper protein-like              93.2    8e-20   
gb|KEH17865.1|  plastocyanin-like domain protein                      93.2    8e-20   
ref|XP_010255991.1|  PREDICTED: mavicyanin                            93.2    8e-20   
ref|XP_008219351.1|  PREDICTED: blue copper protein                   93.2    9e-20   
emb|CDY43296.1|  BnaC06g01720D                                        94.4    9e-20   
ref|XP_006286572.1|  hypothetical protein CARUB_v10002053mg           92.8    9e-20   
ref|XP_010541902.1|  PREDICTED: blue copper protein-like              93.2    9e-20   
ref|XP_010513174.1|  PREDICTED: blue copper protein-like              94.0    9e-20   
ref|XP_002526464.1|  Uclacyanin-2 precursor, putative                 92.8    1e-19   
ref|XP_007163468.1|  hypothetical protein PHAVU_001G236700g           92.0    1e-19   
ref|XP_009417598.1|  PREDICTED: blue copper protein-like              93.2    1e-19   
ref|XP_008362376.1|  PREDICTED: blue copper protein-like              92.8    1e-19   
emb|CDX95619.1|  BnaC03g25000D                                        93.2    1e-19   
emb|CDX76688.1|  BnaC08g32740D                                        93.2    1e-19   
dbj|BAJ94638.1|  predicted protein                                    93.2    1e-19   
ref|XP_006421527.1|  hypothetical protein CICLE_v10005962mg           93.2    1e-19   
ref|XP_004310211.1|  PREDICTED: early nodulin-like protein 2          94.7    1e-19   
dbj|BAK03354.1|  predicted protein                                    93.2    1e-19   
ref|XP_006838549.1|  hypothetical protein AMTR_s00002p00202700        92.8    1e-19   
ref|XP_006387908.1|  hypothetical protein POPTR_0487s00220g           91.3    1e-19   
gb|EEC82871.1|  hypothetical protein OsI_27744                        92.0    1e-19   
ref|XP_009758781.1|  PREDICTED: uclacyanin-3-like                     92.8    1e-19   
ref|XP_008227489.1|  PREDICTED: umecyanin-like                        92.8    1e-19   
ref|XP_002460764.1|  hypothetical protein SORBIDRAFT_02g034540        92.0    1e-19   
ref|XP_004250256.1|  PREDICTED: early nodulin-like protein 1          92.4    1e-19   
dbj|BAD03078.1|  putative blue copper binding protein                 92.0    1e-19   
emb|CDX68793.1|  BnaC01g06600D                                        92.0    1e-19   
ref|XP_010468877.1|  PREDICTED: mavicyanin-like isoform X2            92.8    1e-19   
gb|KDP40154.1|  hypothetical protein JCGZ_02152                       92.4    1e-19   
ref|XP_009412667.1|  PREDICTED: uclacyanin-2-like                     92.4    1e-19   
ref|XP_008455830.1|  PREDICTED: blue copper protein-like              94.0    1e-19   
ref|XP_011016865.1|  PREDICTED: blue copper protein-like              92.8    1e-19   
ref|XP_006419891.1|  hypothetical protein CICLE_v10005979mg           92.8    1e-19   
emb|CDP20526.1|  unnamed protein product                              94.0    1e-19   
ref|XP_008646293.1|  PREDICTED: blue copper protein-like              93.6    1e-19   
ref|XP_006653638.1|  PREDICTED: blue copper protein-like              92.8    1e-19   
ref|XP_006448073.1|  hypothetical protein CICLE_v10017505mg           92.4    1e-19   
ref|XP_006448071.1|  hypothetical protein CICLE_v10018221mg           92.4    1e-19   
ref|XP_008776471.1|  PREDICTED: uclacyanin-2-like                     92.4    1e-19   
ref|XP_003624663.1|  Blue copper protein                              92.0    1e-19   
ref|XP_002460818.1|  hypothetical protein SORBIDRAFT_02g035570        92.8    1e-19   
ref|XP_010546807.1|  PREDICTED: mavicyanin                            92.4    1e-19   
gb|EMT17633.1|  Mavicyanin                                            92.0    1e-19   
ref|NP_001062070.1|  Os08g0482600                                     92.0    1e-19   
ref|XP_006406703.1|  hypothetical protein EUTSA_v10021757mg           90.9    1e-19   
ref|XP_010526247.1|  PREDICTED: early nodulin-like protein 1          92.0    2e-19   
ref|XP_004958966.1|  PREDICTED: blue copper protein-like              91.7    2e-19   
ref|XP_002881159.1|  hypothetical protein ARALYDRAFT_902137           92.4    2e-19   
ref|XP_011076445.1|  PREDICTED: stellacyanin                          92.0    2e-19   
gb|AAO86692.1|  small blue copper protein Bcp1                        92.4    2e-19   
ref|XP_010468876.1|  PREDICTED: mavicyanin-like isoform X1            92.4    2e-19   
ref|XP_009797132.1|  PREDICTED: uclacyanin-3-like                     91.7    2e-19   
ref|XP_006295902.1|  hypothetical protein CARUB_v10025032mg           92.8    2e-19   
emb|CDX77822.1|  BnaC07g20760D                                        93.6    2e-19   
ref|XP_002879222.1|  predicted protein                                92.4    2e-19   
ref|XP_006490062.1|  PREDICTED: blue copper protein-like              92.4    2e-19   



>ref|XP_009614877.1| PREDICTED: basic blue protein-like [Nicotiana tomentosiformis]
Length=173

 Score =   202 bits (514),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVA-AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            L + +L+  I  V+I+  A AAQHVVGGSQGWDESTDF+SWASG TFK+GD LVFRYNPG
Sbjct  4    LRKSLLIFAIVTVIIQNKAMAAQHVVGGSQGWDESTDFNSWASGETFKIGDTLVFRYNPG  63

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            LHSVVE+  ESAYKSCDTSS VNS S GNDVVKLNKPG+RYFACGTAGHC+QGMKLK+TT
Sbjct  64   LHSVVEVEGESAYKSCDTSSSVNSMSAGNDVVKLNKPGTRYFACGTAGHCDQGMKLKITT  123

Query  368  LTG  376
            +TG
Sbjct  124  VTG  126



>ref|XP_009803778.1| PREDICTED: basic blue protein-like [Nicotiana sylvestris]
Length=173

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +2

Query  2    EANLYRCMLVVVIGAVMIEQVA-AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRY  178
            EA     ++  +I  VMI+  A AAQHVVGGSQGWDESTDF++WASG TFKVGD LVFRY
Sbjct  2    EALRKSLLIFAIIMTVMIQNKAMAAQHVVGGSQGWDESTDFNAWASGETFKVGDTLVFRY  61

Query  179  NPGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLK  358
            NPGLHSVVE+  ESAYKSCDTSS VNS S GNDVVKLNKPG+RYFACGTAGHC+QGMKLK
Sbjct  62   NPGLHSVVEVEGESAYKSCDTSSSVNSMSAGNDVVKLNKPGTRYFACGTAGHCDQGMKLK  121

Query  359  VTTLTG  376
            +TT+TG
Sbjct  122  ITTVTG  127



>ref|XP_006338690.1| PREDICTED: blue copper protein-like [Solanum tuberosum]
Length=170

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVA-AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + +L+ VI  VMI++ A AAQHVVGGSQGWDES DF SWASG TFKVGD LVFRYNPGLH
Sbjct  6    KSLLIFVIVTVMIQKNAMAAQHVVGGSQGWDESADFKSWASGQTFKVGDTLVFRYNPGLH  65

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            SVVEL  +S+YKSCD SS VNS S GNDVVKLNKPG+RYFACGTAGHC+QGMKLK+ T+T
Sbjct  66   SVVELEGDSSYKSCDISSTVNSMSAGNDVVKLNKPGTRYFACGTAGHCDQGMKLKIKTVT  125

Query  374  G  376
            G
Sbjct  126  G  126



>ref|XP_004231787.1| PREDICTED: mavicyanin [Solanum lycopersicum]
Length=170

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVA-AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + +L+ VI  VMI++ A AAQHVVGGSQGWDES DF SWASG TFKVGD LVFRYNPGLH
Sbjct  6    KSLLISVIVMVMIQKNAMAAQHVVGGSQGWDESADFKSWASGQTFKVGDTLVFRYNPGLH  65

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            SVVEL  +S+YKSCD SS VNS S GNDVVKLNKPG+RYFACGTAGHC+QGMKLK+ T+T
Sbjct  66   SVVELEGDSSYKSCDISSTVNSMSAGNDVVKLNKPGTRYFACGTAGHCDQGMKLKIKTVT  125

Query  374  G  376
            G
Sbjct  126  G  126



>gb|KDO55610.1| hypothetical protein CISIN_1g030729mg [Citrus sinensis]
Length=172

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    NLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            N+ R  LV++I A+  ++ +AAQH VGGSQGW ES D +SWASG TFKVGDQ+VF+Y PG
Sbjct  5    NIKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPG  64

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            LHSVVEL SESAYKSCD  +  +S + GNDVVKL KPG+RYFACGT+GHCEQGMK+K+TT
Sbjct  65   LHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITT  124

Query  368  LTG  376
             +G
Sbjct  125  FSG  127



>ref|XP_006447099.1| hypothetical protein CICLE_v10016947mg [Citrus clementina]
 ref|XP_006470037.1| PREDICTED: blue copper protein-like [Citrus sinensis]
 gb|ESR60339.1| hypothetical protein CICLE_v10016947mg [Citrus clementina]
Length=172

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    NLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            N+ R  LV++I A+  ++ +AAQH VGGSQGW ES D +SWASG TFKVGDQ+VF+Y PG
Sbjct  5    NIKRAFLVLIISALTAKEASAAQHTVGGSQGWVESADLNSWASGQTFKVGDQIVFKYTPG  64

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            LHSVVEL SESAYKSCD  +  +S + GNDVVKL KPG+RYFACGT+GHCEQGMK+K+TT
Sbjct  65   LHSVVELPSESAYKSCDLGTAKDSMNSGNDVVKLVKPGTRYFACGTSGHCEQGMKVKITT  124

Query  368  LTG  376
             +G
Sbjct  125  FSG  127



>ref|XP_011003937.1| PREDICTED: mavicyanin [Populus euphratica]
Length=170

 Score =   181 bits (460),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  14   YRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            +R  LV+V  A++ ++  AAQHVVGGSQGW+ESTDF SWASG  FKVGDQLVF+Y  GLH
Sbjct  3    HRVCLVMVFVALITKEAMAAQHVVGGSQGWEESTDFSSWASGQKFKVGDQLVFKYTSGLH  62

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            SVVELG ESAYKSCD  + +NS + GNDVVKLNKPG+RYFACGT GHC QGMK+K+T  +
Sbjct  63   SVVELGGESAYKSCDLGTALNSMNTGNDVVKLNKPGTRYFACGTLGHCGQGMKVKITVES  122

Query  374  G  376
            G
Sbjct  123  G  123



>ref|XP_002298616.2| hypothetical protein POPTR_0001s33960g [Populus trichocarpa]
 gb|EEE83421.2| hypothetical protein POPTR_0001s33960g [Populus trichocarpa]
Length=168

 Score =   181 bits (458),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  14   YRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            YR  LV+V  A++ ++  AAQHVVGGSQGW+ESTDF SWASG  FKVGDQLVF+Y  GLH
Sbjct  3    YRVCLVLVFVALITKEAMAAQHVVGGSQGWEESTDFSSWASGQKFKVGDQLVFKYTSGLH  62

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            SVVELG ESAYKSC   + +NS + GNDVVKLNKPG+RYFACGT GHC QGMK+K+T  +
Sbjct  63   SVVELGGESAYKSCGLGTALNSMNTGNDVVKLNKPGTRYFACGTLGHCGQGMKVKITVES  122

Query  374  G  376
            G
Sbjct  123  G  123



>ref|XP_010029008.1| PREDICTED: mavicyanin [Eucalyptus grandis]
 gb|KCW55841.1| hypothetical protein EUGRSUZ_I01655 [Eucalyptus grandis]
Length=175

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 4/124 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMI----EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNP  184
            R +LV+++   ++    +Q +AA+H VGGSQGWDEST+FDSW S  TFKVGDQLVF+Y+ 
Sbjct  8    RAVLVLLVACCVLLAITQQASAAKHAVGGSQGWDESTNFDSWTSAQTFKVGDQLVFKYSQ  67

Query  185  GLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            GLHSVVEL SE+AYKSCD    VNS S GNDVVKL+KPG+RYFACGT GHC QGMKLKVT
Sbjct  68   GLHSVVELSSEAAYKSCDIGKSVNSLSTGNDVVKLDKPGTRYFACGTTGHCGQGMKLKVT  127

Query  365  TLTG  376
            T+ G
Sbjct  128  TVAG  131



>emb|CDP16681.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + +LV+VI +++ +Q +A +H VGGSQGWDESTDF SWASG TFKVGDQLVF+Y PGLHS
Sbjct  6    KFVLVMVILSLVEKQASATKHDVGGSQGWDESTDFSSWASGQTFKVGDQLVFKYTPGLHS  65

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            VVELGSESAYKSCD S+ ++S +GGNDVVKL K G+RYFACGTAGHC QGMK+K+
Sbjct  66   VVELGSESAYKSCDISTALDSKNGGNDVVKLAKAGTRYFACGTAGHCGQGMKVKI  120



>ref|XP_007151532.1| hypothetical protein PHAVU_004G054700g [Phaseolus vulgaris]
 gb|ESW23526.1| hypothetical protein PHAVU_004G054700g [Phaseolus vulgaris]
Length=186

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            + + +I A++ ++V AAQHVVGGSQGWD+STDF+SW SG TFKVGD+LVF+Y+  LHSVV
Sbjct  7    VFLALIAAMIAKEVFAAQHVVGGSQGWDQSTDFNSWTSGQTFKVGDKLVFKYSS-LHSVV  65

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            ELG ESAYK+CD SSP+ S S GNDVVKL+KPG+RYF CGT GHC QGMK+K+T + G
Sbjct  66   ELGKESAYKNCDISSPIQSLSNGNDVVKLDKPGTRYFTCGTLGHCSQGMKMKITIVKG  123



>ref|NP_001237874.1| uncharacterized protein LOC100305865 precursor [Glycine max]
 gb|ACU13756.1| unknown [Glycine max]
 gb|KHN24323.1| Blue copper protein [Glycine soja]
Length=162

 Score =   176 bits (446),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            + + ++  ++ ++  A QHVVGGSQGWDESTDF+SW SG TFKVGDQLVF+Y+  LHSVV
Sbjct  7    IFLALVVTLITKETMAEQHVVGGSQGWDESTDFNSWVSGQTFKVGDQLVFKYSS-LHSVV  65

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            ELGSES YK+CD  + VNS S GNDVVKLNKPG+RYFACGT GHC+QGMK+K+TT++G
Sbjct  66   ELGSESEYKNCDLGNAVNSMSSGNDVVKLNKPGTRYFACGTMGHCDQGMKVKITTVSG  123



>gb|KDP46298.1| hypothetical protein JCGZ_10138 [Jatropha curcas]
Length=166

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R  LV+V   ++ ++  AAQH+VGGSQGW+ESTDF+SWAS   FKVGDQLVF+Y  GLHS
Sbjct  4    RIFLVLVFVGLIAKRAFAAQHIVGGSQGWEESTDFNSWASNTKFKVGDQLVFKYTSGLHS  63

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            VVELGSESAYK+CD  + ++S + GNDVVKL KPG+RYFACGT GHC+QGMK+K+TT  G
Sbjct  64   VVELGSESAYKNCDLGTALDSKNTGNDVVKLTKPGTRYFACGTLGHCDQGMKVKITTEAG  123



>ref|XP_010670421.1| PREDICTED: basic blue protein-like [Beta vulgaris subsp. vulgaris]
Length=177

 Score =   176 bits (446),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L R +L +V+   +  Q  A QHVVGGS GWDESTD++SWA G TFKVGD LVF+Y PGL
Sbjct  4    LKRRLLALVLMVCITTQAYATQHVVGGSDGWDESTDYNSWAKGQTFKVGDTLVFKYTPGL  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H+V ELGSES YKSCDTS+  NS S GNDVVKL+K GSRYFACGTAGHC  GMKLKV  +
Sbjct  64   HNVAELGSESEYKSCDTSNAANSMSTGNDVVKLDKAGSRYFACGTAGHCSAGMKLKVDVV  123

Query  371  TG  376
             G
Sbjct  124  AG  125



>ref|XP_008379120.1| PREDICTED: mavicyanin [Malus domestica]
Length=168

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +LV+V  A+  ++  AAQHVVGGSQGW+ESTD +SWASG  FKVGDQLVF+Y  GLHSVV
Sbjct  8    LLVLVFAALFTKETLAAQHVVGGSQGWEESTDLNSWASGEKFKVGDQLVFKYTSGLHSVV  67

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            EL +ESAYKSC+T S ++S S GNDVVKL K G+RYFACGT GHC QGMK+K+TT+ G
Sbjct  68   ELPNESAYKSCNTGSALDSKSSGNDVVKLTKAGTRYFACGTLGHCGQGMKMKITTVAG  125



>ref|XP_002509536.1| Blue copper protein precursor, putative [Ricinus communis]
 gb|EEF50923.1| Blue copper protein precursor, putative [Ricinus communis]
Length=166

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  14   YRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            Y+  L++   A+ +++  AAQHVVGGSQGWDES DF SW S   FKVGDQL F+Y  GLH
Sbjct  3    YKFFLMLFFVALFVKEGMAAQHVVGGSQGWDESADFSSWTSSKKFKVGDQLAFKYTSGLH  62

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            SVVEL SESAYK+CD  SP++S S GNDVVKL+K G+RYFACGT GHC+QGMK+K+TT T
Sbjct  63   SVVELASESAYKNCDLGSPLDSLSTGNDVVKLSKEGTRYFACGTLGHCDQGMKVKITTET  122

Query  374  G  376
            G
Sbjct  123  G  123



>ref|XP_002262831.1| PREDICTED: mavicyanin [Vitis vinifera]
 emb|CBI40050.3| unnamed protein product [Vitis vinifera]
Length=176

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            LYR +  +V+  ++  +  A QHVVGGSQGWDES+D+  WASG TF+VGDQLVF+Y PGL
Sbjct  4    LYRVLSALVVVGLLTNKALATQHVVGGSQGWDESSDYSKWASGQTFEVGDQLVFKYTPGL  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVEL +ESAYK+CD  S +NS + GN+VVKL+K G+RYFACGT GHC+QGMKLKV+T+
Sbjct  64   HSVVELPNESAYKNCDVGSALNSMNSGNNVVKLSKAGTRYFACGTIGHCDQGMKLKVSTV  123

Query  371  TG  376
            + 
Sbjct  124  SA  125



>ref|XP_010425458.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=174

 Score =   174 bits (440),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G V ++   AAQHV+GGSQGW++S DFDSWAS  +FKVGDQLVF+Y+ GL
Sbjct  5    QAVLVILVFSGLVAVQTTLAAQHVIGGSQGWEQSVDFDSWASDQSFKVGDQLVFKYS-GL  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  +
Sbjct  64   HSVVELGSETAYKSCDVGTPVNSLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNVV  123



>gb|AFK46705.1| unknown [Lotus japonicus]
Length=162

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L   + + ++ +++ ++  A QHVVGGSQGWD+STDF+SW SG TF VGDQLVF+Y+ GL
Sbjct  3    LKNTIFLALVVSLITKEALAEQHVVGGSQGWDQSTDFNSWVSGKTFNVGDQLVFKYSSGL  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            HSVVELGSES YK+CD  S VN+ S GND VKL+KPG+RYFACGT+GHC QGMK+K+TT
Sbjct  63   HSVVELGSESDYKNCDIGSAVNTMSSGNDAVKLSKPGTRYFACGTSGHCSQGMKVKITT  121



>gb|KHF97412.1| Blue copper [Gossypium arboreum]
Length=167

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
             +++++  ++ +QV+A QHVVGGSQGW+ES D +SWAS  TFKVGDQLVF+Y+ GLHSVV
Sbjct  12   FVLIIVLPLIAKQVSATQHVVGGSQGWEESVDLNSWASAQTFKVGDQLVFKYSSGLHSVV  71

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            ELGSE+AYK+CD  + ++S + GNDVVKLNK G+RYFACGT GHC+QGMK+K+TT+ G
Sbjct  72   ELGSETAYKNCDLGTSLDSKNTGNDVVKLNKVGTRYFACGTLGHCDQGMKMKITTVAG  129



>ref|XP_007161746.1| hypothetical protein PHAVU_001G095100g [Phaseolus vulgaris]
 gb|ESW33740.1| hypothetical protein PHAVU_001G095100g [Phaseolus vulgaris]
Length=166

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            + + +  A++  +  A QHVVGGSQGWD ST+F+SW SG TF VGDQLVF+Y+ GLHSVV
Sbjct  7    IFLALFVALITNEAMAEQHVVGGSQGWDASTNFNSWVSGQTFNVGDQLVFKYSSGLHSVV  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            ELGSES YK+CD  + VNS S GNDVVKLNKPG+RYFACGT GHC QGMK+K+TT+
Sbjct  67   ELGSESEYKNCDLGNTVNSMSSGNDVVKLNKPGARYFACGTLGHCGQGMKVKITTV  122



>ref|XP_010514410.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=173

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G V ++   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQLVF+Y+ GL
Sbjct  4    QAVLVILVFSGLVSVQTTLAAQHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYS-GL  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  +
Sbjct  63   HSVVELGSETAYKSCDLGTPVNSLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNVV  122



>ref|XP_006395473.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum]
 gb|ESQ32759.1| hypothetical protein EUTSA_v10005008mg [Eutrema salsugineum]
Length=175

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 3/121 (2%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G + ++   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQLVF+Y+ GL
Sbjct  4    QAVLVILVFSGLITVKTTLAAQHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYS-GL  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  +
Sbjct  63   HSVVELGSETAYKSCDLGTPVNSLSSGNDVVKLSKTGTRYFACGTPGHCEQGMKVKVNVV  122

Query  371  T  373
            +
Sbjct  123  S  123



>ref|XP_006291939.1| hypothetical protein CARUB_v10018126mg [Capsella rubella]
 gb|EOA24837.1| hypothetical protein CARUB_v10018126mg [Capsella rubella]
Length=171

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G + ++   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQLVF+Y+ GL
Sbjct  4    QAVLVILVFSGLISVKTTLAAQHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYS-GL  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  +
Sbjct  63   HSVVELGSETAYKSCDLGTPVNSLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNVV  122



>ref|XP_010502682.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=175

 Score =   171 bits (433),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G V +++  AAQHV+GGSQGW++S DFDSW+S  +FKVGDQLVF+Y+ GL
Sbjct  4    QAVLVILVFSGLVSVQKTLAAQHVIGGSQGWEQSVDFDSWSSDQSFKVGDQLVFKYS-GL  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSVVELGSE+AYKSCD  +PVNS S GNDV+KL+K G+RYFACGT GHCEQGMK+KV
Sbjct  63   HSVVELGSETAYKSCDLGTPVNSLSSGNDVLKLSKTGTRYFACGTVGHCEQGMKIKV  119



>ref|NP_001237236.1| uncharacterized protein LOC100306337 precursor [Glycine max]
 gb|ACU14464.1| unknown [Glycine max]
 gb|KHN01530.1| Mavicyanin [Glycine soja]
Length=190

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            + + +I  ++ ++  AAQHVVGGSQGWD+STDF SW SG TFKVGD+LVF+Y+   HSVV
Sbjct  7    IFLALIATLIAKEAFAAQHVVGGSQGWDQSTDFKSWTSGQTFKVGDKLVFKYS-SFHSVV  65

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            ELG+ESAYK+CD SSPV S S GNDVVKL+KPG+RYF CGT GHC QGMK+K+T   G
Sbjct  66   ELGNESAYKNCDISSPVQSLSTGNDVVKLDKPGTRYFTCGTLGHCSQGMKVKITIRKG  123



>ref|XP_010248962.1| PREDICTED: mavicyanin [Nelumbo nucifera]
Length=168

 Score =   170 bits (431),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = +2

Query  5    ANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNP  184
            A +YR M++V    +        QHVVGGSQGW ESTDF +W SG TFKVGDQLVF+Y  
Sbjct  2    ACVYRLMVLVSFVVLAANGALTTQHVVGGSQGWGESTDFSAWTSGRTFKVGDQLVFKYTA  61

Query  185  GLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            GLH+VVEL  E+AYKSCDTSS V+S  GGN VVKL+KPG+RYFACGT GHC+QGMK+K+ 
Sbjct  62   GLHTVVELADENAYKSCDTSSAVDSMDGGNSVVKLSKPGTRYFACGTPGHCDQGMKVKIK  121

Query  365  TL  370
            T+
Sbjct  122  TV  123



>gb|KJB11652.1| hypothetical protein B456_001G270000 [Gossypium raimondii]
Length=167

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
             ++V++  ++ +QV+A QHVVGGSQGW+ES D +SWAS  TFKVGDQLVF+Y+ GLHSVV
Sbjct  12   FVLVIVLPLIAKQVSATQHVVGGSQGWEESVDLNSWASAQTFKVGDQLVFKYSSGLHSVV  71

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            ELGSE+AYK+CD  + ++S + G DVVKLNK G+RYFACGT GHC+QGMK+KVTT+ G
Sbjct  72   ELGSETAYKNCDLGTSLDSKNTGKDVVKLNKVGTRYFACGTLGHCDQGMKMKVTTVAG  129



>ref|XP_004489604.1| PREDICTED: blue copper protein-like [Cicer arietinum]
Length=174

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            + ++++  ++ ++  A QHVVGGSQGWD+STDFDSW SG TFKVGDQLVF+Y+  LHSVV
Sbjct  7    IFLILVATLITKEALATQHVVGGSQGWDQSTDFDSWTSGQTFKVGDQLVFKYSS-LHSVV  65

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            EL +ES YK CD S+P+N+ S G DVVKL+KPG+RYF CGT GHC QGMK+K+T + G
Sbjct  66   ELSNESTYKKCDISTPINTLSTGKDVVKLDKPGTRYFTCGTLGHCGQGMKVKITVVKG  123



>ref|XP_009129442.1| PREDICTED: mavicyanin-like [Brassica rapa]
Length=168

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            ++V  G + ++   AAQHV+GGSQGW+ES DFDSW+S  +FKVGDQLVF+Y+ GLHSVVE
Sbjct  7    ILVFAGLMAVKTTFAAQHVMGGSQGWEESVDFDSWSSDQSFKVGDQLVFKYS-GLHSVVE  65

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            LGSE+AYKSCD  +PVNS S GNDVVKL++ G+RYFACGT GHCEQGMK+KV  ++
Sbjct  66   LGSETAYKSCDLGTPVNSLSSGNDVVKLSETGTRYFACGTPGHCEQGMKVKVNVVS  121



>ref|XP_007031840.1| Cupredoxin superfamily protein [Theobroma cacao]
 gb|EOY02766.1| Cupredoxin superfamily protein [Theobroma cacao]
Length=206

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
            +Q +AAQHVVGGSQGWDES D +SWASG TFKVGDQLVF+Y+ GLHSVVELGSE+AYK+C
Sbjct  61   KQASAAQHVVGGSQGWDESVDLNSWASGQTFKVGDQLVFKYSSGLHSVVELGSETAYKNC  120

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            D  + ++S + G+DVVKL+K G+RYFACGT GHC+QGMK+K+TT+ G
Sbjct  121  DLGTALDSKNTGDDVVKLSKVGTRYFACGTLGHCDQGMKMKITTVAG  167



>emb|CDY28484.1| BnaC02g36760D [Brassica napus]
Length=170

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            ++V  G + ++   AAQHV+GGSQGW+ES DFDSW+S  +FKVGDQLVF+Y+ GLHSVVE
Sbjct  9    ILVFAGLMAVKSTLAAQHVMGGSQGWEESVDFDSWSSDQSFKVGDQLVFKYS-GLHSVVE  67

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            LGSE+AYKSCD  + VNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  ++
Sbjct  68   LGSETAYKSCDLGTTVNSLSSGNDVVKLSKTGTRYFACGTPGHCEQGMKVKVNIVS  123



>ref|XP_010528169.1| PREDICTED: mavicyanin [Tarenaya hassleriana]
Length=184

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +2

Query  74   QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
            QHVVGGSQGW+ESTDFDSWASG TFK+GDQLVF+Y+ GLHSVVELGSE+AYKSCD  +PV
Sbjct  24   QHVVGGSQGWEESTDFDSWASGLTFKLGDQLVFKYS-GLHSVVELGSETAYKSCDLGTPV  82

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
             S S GNDVVKL KPG+RYFACGT GHC+QGMK+KV  ++
Sbjct  83   KSMSSGNDVVKLTKPGARYFACGTPGHCDQGMKVKVNVVS  122



>ref|XP_002877026.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53285.1| hypothetical protein ARALYDRAFT_484503 [Arabidopsis lyrata subsp. 
lyrata]
Length=171

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 99/120 (83%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G + ++   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQ+VF+Y+ GL
Sbjct  4    QAVLVILVFSGLISVKTTLAAQHVIGGSQGWEQSVDFDSWSSDQSFKVGDQIVFKYS-GL  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  + VNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  +
Sbjct  63   HSVVELGSETAYKSCDLGTSVNSLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNVV  122



>emb|CDX83667.1| BnaC07g24070D [Brassica napus]
Length=173

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +++V  G + ++   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQLVF+Y+ GLHSVV
Sbjct  8    VILVFSGLLAVKTTLAAQHVIGGSQGWEQSVDFDSWSSDKSFKVGDQLVFKYS-GLHSVV  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            ELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHC+ GMK+KV  ++
Sbjct  67   ELGSEAAYKSCDLGTPVNSLSSGNDVVKLSKTGTRYFACGTPGHCQSGMKVKVNVVS  123



>ref|XP_009151984.1| PREDICTED: mavicyanin [Brassica rapa]
Length=187

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +++V  G + ++   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQLVF+Y+ GLHSVV
Sbjct  8    VILVFSGLLAVKTTLAAQHVIGGSQGWEQSVDFDSWSSDKSFKVGDQLVFKYS-GLHSVV  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            ELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHC+ GMK+KV  ++
Sbjct  67   ELGSEAAYKSCDLGTPVNSLSSGNDVVKLSKTGTRYFACGTPGHCQSGMKVKVNVVS  123



>gb|AAM62707.1| blue copper protein, putative [Arabidopsis thaliana]
Length=172

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 98/120 (82%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G + ++   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQ+VF+Y+ GL
Sbjct  4    QAVLVILVFSGLLSVKTALAAQHVIGGSQGWEQSVDFDSWSSDQSFKVGDQIVFKYS-GL  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  + VNS S GNDVVKL+K G+RYF CGT GHCEQGMK+KV  +
Sbjct  63   HSVVELGSETAYKSCDLGTSVNSLSSGNDVVKLSKTGTRYFVCGTVGHCEQGMKIKVNVV  122



>gb|ACR77748.1| plastocyanin-like domain-containing protein [Astragalus sinicus]
Length=191

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L   + +V++ +++ ++V A +HVVGGSQGWD STDF+SW SG TFKVGDQLVF+Y+  L
Sbjct  3    LKNTIFMVLVASLITKEVLATKHVVGGSQGWDASTDFNSWISGKTFKVGDQLVFKYS-SL  61

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELG+ES YK+CD S+P+NS S G DVVKL+KP +RY  CGT GHC QGMK+K+T  
Sbjct  62   HSVVELGNESDYKNCDISTPLNSLSSGKDVVKLDKPSTRYLTCGTLGHCGQGMKVKITIA  121

Query  371  TG  376
             G
Sbjct  122  KG  123



>emb|CDY13690.1| BnaA06g32330D [Brassica napus]
Length=187

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +++V  G +  +   AAQHV+GGSQGW++S DFDSW+S  +FKVGDQLVF+Y+ GLHSVV
Sbjct  8    VMLVFSGLLAFKITLAAQHVIGGSQGWEQSVDFDSWSSDKSFKVGDQLVFKYS-GLHSVV  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            ELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHC+ GMK+KV  ++
Sbjct  67   ELGSEAAYKSCDLGTPVNSLSSGNDVVKLSKTGTRYFACGTPGHCQSGMKVKVNVVS  123



>gb|KFK33640.1| hypothetical protein AALP_AA5G039900 [Arabis alpina]
Length=181

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +++V  G + +    AAQHV+GGSQGW+++ DF+SW+S  +FKVGDQLVF+Y+ GLHSVV
Sbjct  8    VILVFSGLLSVTTTLAAQHVIGGSQGWEQTIDFNSWSSDQSFKVGDQLVFKYS-GLHSVV  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            ELGSE+AYKSCD  +PVNS S GNDVVKL+K G+RYFACGT GHCEQGMK+ V
Sbjct  67   ELGSETAYKSCDLGTPVNSLSSGNDVVKLSKTGTRYFACGTPGHCEQGMKITV  119



>ref|XP_008341310.1| PREDICTED: basic blue protein-like [Malus domestica]
Length=174

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
            ++  AAQHVVGGSQGW++STD +SWASG  FK GDQLVF+Y  GLHSVVEL +ESAYK C
Sbjct  19   KETLAAQHVVGGSQGWEQSTDLNSWASGQKFKAGDQLVFKYXSGLHSVVELPNESAYKGC  78

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            DT S ++S S G+DVVKL K G+RYFACGT+GHC+QGMK+K+TT+ G
Sbjct  79   DTGSALDSKSSGSDVVKLTKAGTRYFACGTSGHCDQGMKMKITTVDG  125



>ref|NP_566810.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana]
 gb|AAL62418.1| blue copper protein, putative [Arabidopsis thaliana]
 gb|AAP21370.1| At3g27200 [Arabidopsis thaliana]
 gb|AEE77278.1| plastocyanin-like domain-containing protein [Arabidopsis thaliana]
Length=174

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G + ++   AA+HV+GGSQGW++S DFDSW+S  +FKVGDQ+VF+Y+  L
Sbjct  4    QAVLVILVFSGLLSVKTALAARHVIGGSQGWEQSVDFDSWSSDQSFKVGDQIVFKYSE-L  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  + VNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  +
Sbjct  63   HSVVELGSETAYKSCDLGTSVNSLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNVV  122



>ref|XP_010111589.1| Blue copper protein [Morus notabilis]
 gb|EXC31334.1| Blue copper protein [Morus notabilis]
Length=179

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +2

Query  8    NLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            N +  +LV+V+   M +Q  +AQHVVGGSQGWD STDF+SW S  TFKVGD LVF+Y+  
Sbjct  5    NTFFFVLVLVVW--MTKQAQSAQHVVGGSQGWDASTDFNSWVSDKTFKVGDHLVFKYS-A  61

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            LHSV EL +E+AYK+C+ SS ++S S GNDVVKLNKPG+RYFACGT+GHC+ GMK+K+TT
Sbjct  62   LHSVAELANENAYKNCEISSALDSKSSGNDVVKLNKPGTRYFACGTSGHCQGGMKVKITT  121

Query  368  LTG  376
            ++G
Sbjct  122  VSG  124



>ref|XP_007216268.1| hypothetical protein PRUPE_ppa017323mg [Prunus persica]
 gb|EMJ17467.1| hypothetical protein PRUPE_ppa017323mg [Prunus persica]
Length=172

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +LV+V   ++ ++  AAQ  VGGSQGWDESTDF+SWAS   FKVGDQLVF+Y+ GLHS+V
Sbjct  8    LLVLVFVGLITKKGFAAQLTVGGSQGWDESTDFNSWASAQKFKVGDQLVFKYSSGLHSLV  67

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            EL +ESAYKSCD    ++S + GNDVVKL K G+RYFACGT GHC QGMK+K+TT+ G
Sbjct  68   ELPNESAYKSCDLGGALDSKNSGNDVVKLTKAGTRYFACGTLGHCGQGMKVKITTVDG  125



>ref|XP_003618846.1| Plastocyanin-like domain-containing protein [Medicago truncatula]
 gb|AES75064.1| plastocyanin-like domain protein [Medicago truncatula]
 gb|AFK46467.1| unknown [Medicago truncatula]
Length=179

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
            ++V A QH VGGSQGWD S+DFDSW+SG TFKVGDQLVF+Y   +HSVVEL  ESAYK C
Sbjct  19   KEVLATQHNVGGSQGWDPSSDFDSWSSGQTFKVGDQLVFKYTS-MHSVVELSDESAYKKC  77

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            D S+P+NS S G DVVKL+KPG+RYF CGT GHC+QGMK+K+T
Sbjct  78   DISTPLNSLSTGKDVVKLDKPGTRYFTCGTLGHCDQGMKVKIT  120



>ref|XP_008231138.1| PREDICTED: mavicyanin [Prunus mume]
Length=172

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +LV+V   ++ ++  AAQ  VGGSQGWDESTDF+SWAS   FKVGDQLVF+Y+ GLHSVV
Sbjct  8    LLVLVFVCLITKKGFAAQLTVGGSQGWDESTDFNSWASAQKFKVGDQLVFKYSSGLHSVV  67

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            EL +ESAYKSCD    + S + GNDVVKL K G+RYFACGT GHC QGMK+K+TT+ G
Sbjct  68   ELPNESAYKSCDLGGALASKNTGNDVVKLTKAGTRYFACGTLGHCGQGMKVKITTVDG  125



>ref|XP_009371662.1| PREDICTED: mavicyanin [Pyrus x bretschneideri]
Length=177

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
            ++  A+QH VGGSQGW++ST+ +SWAS   FKVGDQLVF+Y  GLHSVVEL +ESAYKSC
Sbjct  19   KETLASQHHVGGSQGWEQSTELNSWASAQKFKVGDQLVFKYTSGLHSVVELPNESAYKSC  78

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            D  S +++ S GNDVVKL K G+RYFACGT+GHC+QGMK+K+TT+ G
Sbjct  79   DAGSALDTKSSGNDVVKLTKAGTRYFACGTSGHCDQGMKMKITTVDG  125



>ref|XP_011098865.1| PREDICTED: mavicyanin [Sesamum indicum]
Length=171

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
             +  AA+HVVGGSQGWDES DFDSWAS   FKVGD+L F+Y  GLHSVVEL  ESAYKSC
Sbjct  22   REALAAKHVVGGSQGWDESVDFDSWASARIFKVGDELEFKYTAGLHSVVELAGESAYKSC  81

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            D  S ++S +GG++ VKL+K G+RYF CGT GHCEQGMK+K+TT
Sbjct  82   DIGSALDSLNGGSNTVKLSKSGTRYFTCGTPGHCEQGMKVKITT  125



>ref|XP_004168663.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN63174.1| Blue copper protein [Cucumis sativus]
Length=174

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 93/120 (78%), Gaps = 2/120 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAA--QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            ++++++GA ++ +++ A  +H+VGGSQGW ES DFDSWAS  TFKVGDQ+VF+Y+  LHS
Sbjct  16   LVMMIVGAALMAEMSLADQRHMVGGSQGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHS  75

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            VVEL  ES+YK+CD  + + S S GND +KL K G+RYFACGT GHC QGMK+K+   TG
Sbjct  76   VVELSDESSYKNCDIGNSIESKSSGNDAIKLTKSGTRYFACGTIGHCSQGMKVKIKIATG  135



>ref|XP_004138792.1| PREDICTED: blue copper protein-like [Cucumis sativus]
Length=170

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 93/120 (78%), Gaps = 2/120 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAA--QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            ++++++GA ++ +++ A  +H+VGGSQGW ES DFDSWAS  TFKVGDQ+VF+Y+  LHS
Sbjct  16   LVMMIVGAALMAEMSLADQRHMVGGSQGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHS  75

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            VVEL  ES+YK+CD  + + S S GND +KL K G+RYFACGT GHC QGMK+K+   TG
Sbjct  76   VVELSDESSYKNCDIGNSIESKSSGNDAIKLTKSGTRYFACGTIGHCSQGMKVKIKIATG  135



>ref|XP_008441346.1| PREDICTED: mavicyanin-like [Cucumis melo]
Length=172

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAA--QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            +++++GA ++ ++  A  +H+VGGSQGW ES DFDSWAS  TFKVGDQ+VF+Y+  LHSV
Sbjct  15   VMMIVGAALMAEMGLADQRHMVGGSQGWQESVDFDSWASSQTFKVGDQIVFKYDSSLHSV  74

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            VEL  ES+YK+CD  + + S S GNDV+KL K G+RYFACGT GHC QGMK+K+   TG
Sbjct  75   VELPEESSYKNCDIGNSIESKSSGNDVIKLTKSGTRYFACGTIGHCSQGMKVKIKIATG  133



>ref|XP_004303985.1| PREDICTED: basic blue protein [Fragaria vesca subsp. vesca]
Length=184

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +L +   A++ ++  AAQHVVGGSQGW++STD +SWAS   FKVGDQLVF+Y+  +HSVV
Sbjct  8    LLSLFFVALVAKKGLAAQHVVGGSQGWEQSTDLNSWASSQKFKVGDQLVFKYSS-MHSVV  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            EL +ESA+K+CD  S +++  GGNDVVKLNK G+RYFACGT GHC+ GMK+K+TT+
Sbjct  67   ELPNESAFKNCDLGSALDTKKGGNDVVKLNKAGTRYFACGTLGHCDGGMKVKITTV  122



>dbj|BAB02115.1| unnamed protein product [Arabidopsis thaliana]
Length=169

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 93/120 (78%), Gaps = 8/120 (7%)
 Frame = +2

Query  17   RCMLVVVI--GAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + +LV+++  G + ++   AA+HV+GGSQGW++S DFDSW+S  +FKVGDQ+       L
Sbjct  4    QAVLVILVFSGLLSVKTALAARHVIGGSQGWEQSVDFDSWSSDQSFKVGDQI------EL  57

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            HSVVELGSE+AYKSCD  + VNS S GNDVVKL+K G+RYFACGT GHCEQGMK+KV  +
Sbjct  58   HSVVELGSETAYKSCDLGTSVNSLSSGNDVVKLSKTGTRYFACGTVGHCEQGMKIKVNVV  117



>gb|EYU45397.1| hypothetical protein MIMGU_mgv1a014864mg [Erythranthe guttata]
Length=175

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
            ++  A +HVVGGSQGWDESTDFDSWAS  TF VGD+L F+Y PGLHSVVELGSESA KSC
Sbjct  21   KRALAKKHVVGGSQGWDESTDFDSWASAQTFNVGDELEFKYTPGLHSVVELGSESALKSC  80

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            D  S +NS S G+D +KL+K G+RYFACGT+GHC QGMK+K+TT+
Sbjct  81   DVGSSLNSLSSGSDTIKLSKAGTRYFACGTSGHCGQGMKVKITTV  125



>ref|XP_006848436.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda]
 gb|ERN10017.1| hypothetical protein AMTR_s00013p00238100 [Amborella trichopoda]
Length=173

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVA-AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            L   ++ ++IG  M  + A  A+H VGGSQGW+ STD DSWAS  TF+VGDQLVF+Y  G
Sbjct  5    LRSLLITIMIGLGMSTRGAFGAKHEVGGSQGWELSTDLDSWASAQTFRVGDQLVFKYTKG  64

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            LHSVVEL ++  Y +CD S+ ++S S G+DVVKL+KPG +YF CGT GHC+ GMKLKV  
Sbjct  65   LHSVVELANKKEYDACDLSNALSSLSDGSDVVKLDKPGHKYFTCGTMGHCQGGMKLKVKV  124

Query  368  LT  373
            L+
Sbjct  125  LS  126



>gb|ABK26728.1| unknown [Picea sitchensis]
Length=184

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  50   MIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYK  229
            + +   A Q+ VGGSQGWD STDF++W SG TFKVGD L F+Y  GLHSVVEL SE  Y 
Sbjct  29   ITQSCMAVQYPVGGSQGWDLSTDFNTWESGKTFKVGDTLSFKYTTGLHSVVELASEKDYN  88

Query  230  SCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +C+  +PVNS SGG++VVKLNK G+RYFACGT GHC  GMK+KV
Sbjct  89   ACNIGNPVNSLSGGSNVVKLNKAGTRYFACGTPGHCSGGMKMKV  132



>gb|KJB79910.1| hypothetical protein B456_013G071700 [Gossypium raimondii]
Length=244

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R ++ +   A++++   AA + VGG+ G WD STD  +WA+   F VGD L+F+Y P 
Sbjct  1    MARTLVCLAATAMLVQLAMAANYTVGGANGGWDSSTDLQTWAASQKFAVGDNLIFQYTPN  60

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H +VE+ +++ Y SC TSSP+ +++ GN VV L  PG RYF CGT GHC QGM++++ T
Sbjct  61   -HDLVEV-TKADYDSCQTSSPIRTYTDGNTVVPLTSPGKRYFICGTLGHCSQGMQIEIDT  118

Query  368  L  370
            L
Sbjct  119  L  119



>gb|KJB50019.1| hypothetical protein B456_008G150100 [Gossypium raimondii]
Length=209

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGG-SQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R ++ +    + +E   AA H VGG S GWD STD  SW +  TF VGD L+F+Y P 
Sbjct  3    VLRTLVCLTAIGMFMELAMAANHTVGGASGGWDTSTDLQSWVASQTFAVGDNLIFQYTPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+ +++ + SC TSSP+ +++ GN V+ L  PG RYF CGT GHC QGM++++ T
Sbjct  63   -HDVLEV-TKADHDSCQTSSPLQTYTDGNTVIPLTSPGKRYFICGTLGHCSQGMQIEIDT  120

Query  368  L  370
            L
Sbjct  121  L  121



>ref|XP_007043352.1| Uclacyanin 1, putative [Theobroma cacao]
 gb|EOX99183.1| Uclacyanin 1, putative [Theobroma cacao]
Length=210

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R ++ +   A++I+   AA + VGG  G WD STD  +W +   F VGD L+F+Y P 
Sbjct  3    VLRTLVGLAATAMLIQLAMAANYTVGGPSGSWDSSTDLQTWVASQKFVVGDNLIFQYTPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+  ++ Y SC TSSP+ +++ GN V+ L+ PG RYF CGT GHC QGM++++ T
Sbjct  63   -HDVLEV-RKADYDSCQTSSPIQTYNNGNTVISLSSPGKRYFICGTPGHCSQGMQIEIDT  120

Query  368  L  370
            L
Sbjct  121  L  121



>ref|XP_010106325.1| Early nodulin-like protein 1 [Morus notabilis]
 gb|EXC10039.1| Early nodulin-like protein 1 [Morus notabilis]
Length=207

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +L+V++ ++++  V+AA H VGG  GWD +++  +WAS  TF VGD LVF Y P +H V+
Sbjct  14   ILIVIMASILLRGVSAANHTVGGVSGWDLTSNIQAWASQTTFHVGDYLVFSYTP-VHDVL  72

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            E+  E  YKSCD S P+ +++ G  V+ L + G RYF CG  GHC  G+KL+   L
Sbjct  73   EV-EEEDYKSCDISDPIRTYNDGETVIPLTQEGPRYFICGRQGHCSMGLKLEAHVL  127



>ref|XP_007216249.1| hypothetical protein PRUPE_ppa017076mg [Prunus persica]
 gb|EMJ17448.1| hypothetical protein PRUPE_ppa017076mg [Prunus persica]
Length=240

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +2

Query  17   RCMLV-VVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R  LV +V+  ++IE   AA + VGG  G WD +TD  +WAS  TF VGD L F+Y P  
Sbjct  5    RTTLVSLVVVTMLIELAMAASYNVGGPNGGWDSTTDLQTWASSQTFLVGDNLNFQYAPS-  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H VVE+  ++ Y SC  S+ + S+SGG+  + L+ PG RYF CGT GHC QGMKL+V TL
Sbjct  64   HDVVEV-PKADYDSCQASNSIQSYSGGSTTIPLSSPGKRYFICGTTGHCSQGMKLEVDTL  122



>ref|XP_008341968.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=239

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            ++ +V+  ++IE   AA ++VGG  G WD STD  +WAS  +F VGD L F+Y+P  H V
Sbjct  8    LMSLVVVTMLIELAMAATYMVGGPNGAWDSSTDLQTWASLQSFLVGDNLNFQYSPN-HDV  66

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            +E+  ++ Y SC  S+ + S++GG+  + L+ PG RYF CGT GHC QGMKL+V TL
Sbjct  67   IEV-PKADYDSCQASNSIQSYTGGSTTIPLSSPGKRYFICGTIGHCSQGMKLEVNTL  122



>ref|XP_008230134.1| PREDICTED: blue copper protein [Prunus mume]
Length=244

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +2

Query  17   RCMLV-VVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R  LV +V+  ++IE   A  + VGG  G WD +TD  +WAS  TF VGD L F+Y P  
Sbjct  5    RTTLVSLVVVTMLIELAMATSYNVGGPNGGWDSTTDLQTWASSQTFLVGDNLNFQYAPS-  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H VVE+ S++ Y SC  S+ + S+SGG+  + L+ PG RYF CGT GHC QGMKL+V TL
Sbjct  64   HDVVEV-SKADYDSCQASNSIQSYSGGSTTIPLSSPGKRYFICGTTGHCSQGMKLEVDTL  122



>ref|XP_011003250.1| PREDICTED: uclacyanin-2-like [Populus euphratica]
Length=246

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R +    + A+M+    AA + VGG  G WD +T+  +WA+ N F VGD L+F+Y   
Sbjct  1    MVRTITSFFLVAMMLRLAMAANYTVGGPNGGWDATTNLQAWAASNNFLVGDNLIFQYG-L  59

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            +H V+E+ S++ Y SC T+SP+ S+SGG  V+ L+ PG RYF C T GHC  GMKL++ T
Sbjct  60   MHDVIEV-SKAGYDSCQTTSPLQSYSGGKTVIPLSSPGKRYFTCATPGHCAGGMKLEIDT  118

Query  368  L  370
            L
Sbjct  119  L  119



>ref|XP_009342269.1| PREDICTED: blue copper protein [Pyrus x bretschneideri]
Length=239

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            ++ +V+  ++IE   AA ++VGG  G WD ST+  +WAS  +F VGD L F+Y+P  H V
Sbjct  8    LMSLVVVTMLIELTMAATYMVGGPNGAWDSSTNLQTWASSQSFLVGDNLNFQYSPN-HDV  66

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            +E+  ++ Y SC  S+ + S++GG+  + L+ PG RYF CGT GHC QGMKL+V TL
Sbjct  67   IEV-PKADYDSCQASNSIQSYTGGSTTIPLSSPGKRYFICGTIGHCSQGMKLEVNTL  122



>emb|CDY19128.1| BnaA04g18680D [Brassica napus]
Length=259

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 70/120 (58%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V  + +I    A  H +GG  GW   T+  +WA+G TF VGD LVF Y    
Sbjct  4    REMLIILLVFASTLIGLAVATDHTIGGPSGWTVGTNLGTWAAGQTFAVGDNLVFAYPSAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H VVE+ ++  + SC    P+ +FS GN +V L  PG RYF CG  GHC QGMKL+V  +
Sbjct  64   HDVVEV-TKPEFDSCQAVKPLITFSNGNSIVPLTTPGKRYFICGMPGHCTQGMKLEVNVI  122



>ref|XP_008798824.1| PREDICTED: blue copper protein-like [Phoenix dactylifera]
Length=189

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +LV++I AV      A+++ VG SQGW    D+ +W S  TFKVGD L+F+Y   LHSV 
Sbjct  7    LLVLLIAAV---PAYASEYTVGDSQGWTSGVDYSTWVSDKTFKVGDTLLFQYG-FLHSVD  62

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            E+ SES YK+C TS+ + SFS  N  + L+KPG+RYF CGT+GHC  GMKL V
Sbjct  63   EV-SESDYKACSTSNSMQSFSDQNTKITLSKPGTRYFICGTSGHCSGGMKLAV  114



>ref|XP_009143966.1| PREDICTED: blue copper protein-like [Brassica rapa]
 emb|CDY48275.1| BnaA05g10790D [Brassica napus]
 emb|CDX76046.1| BnaA04g03100D [Brassica napus]
Length=259

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 1/116 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            ++++V+   +I    A  H +GG  GW    +  +WA+G TF VGD LVF Y    H VV
Sbjct  8    IIILVLATTLIGIAVATDHTIGGPSGWTVGANLGTWAAGQTFAVGDNLVFAYPSAFHDVV  67

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            E+ ++  + SC    P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V  L
Sbjct  68   EV-TKPEFDSCQVVKPLITFANGNSIVPLTTPGKRYFICGMPGHCTQGMKLEVNVL  122



>emb|CDY12217.1| BnaC04g12470D [Brassica napus]
Length=258

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (58%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVV--IGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++V  +   +I    A  H +GG  GW    +  +WA+G TF VGD LVF Y    
Sbjct  4    REMLIIVSVLATTLIGLAVATDHTIGGPSGWTVGANLGTWAAGQTFAVGDNLVFAYPSAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H VVE+ ++  + SC    P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V  L
Sbjct  64   HDVVEV-TKPEFDSCQAVKPLITFANGNSIVPLTTPGKRYFICGMPGHCAQGMKLEVNVL  122



>gb|EMT07777.1| Blue copper protein [Aegilops tauschii]
Length=168

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R +L V + A++    AA  +V      WD ST++ +WAS   FK  DQ+VF+Y+P  H 
Sbjct  5    RTILAVAVMAILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFKADDQIVFKYSPQAHD  64

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            V+E+ S++ Y SC T+SP+ + + GND+V L   G+RYF CG  GHC  GMK+K+  ++G
Sbjct  65   VLEV-SKADYDSCSTASPITTLNSGNDIVTLTASGTRYFICGFPGHCAGGMKVKIDVMSG  123



>gb|EMT33683.1| Blue copper protein [Aegilops tauschii]
Length=171

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L+ V    ++   +AA + VG   G WD ST++ +WAS   F+  DQ+VF+Y+P  H
Sbjct  5    RTILLAVAAMAVLSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFQTSDQIVFKYSPQAH  64

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
             V+E+ S++ Y SC T++P+ +F+ GNDVV L   G+RYF CG  GHC  GMK+K+  + 
Sbjct  65   DVLEV-SKADYDSCSTANPITTFNSGNDVVTLTATGTRYFICGFPGHCAGGMKVKIDVMP  123

Query  374  G  376
            G
Sbjct  124  G  124



>gb|KHN25766.1| Early nodulin-like protein 1 [Glycine soja]
Length=216

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 3/119 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGG-SQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
              M  V   AV+I+  +A  ++VGG S GWD +++  SWAS   F VGD LVF+Y P  H
Sbjct  5    ELMFRVSFMAVLIKLASATNYIVGGPSGGWDTNSNLQSWASSQIFSVGDSLVFQYPPN-H  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             VVE+ +++ Y SC  ++P+ S++ G   + L  PG RYF CGT GHC QGMK+++ TL
Sbjct  64   DVVEV-TKADYDSCQPTNPIQSYNDGATTIPLTLPGKRYFICGTIGHCSQGMKVEIDTL  121



>ref|XP_003540323.1| PREDICTED: blue copper protein-like [Glycine max]
Length=216

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 3/119 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGG-SQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
              M  V   AV+I+  +A  ++VGG S GWD +++  SWAS   F VGD LVF+Y P  H
Sbjct  5    ELMFRVSFMAVLIKLASATNYIVGGPSGGWDTNSNLQSWASSQIFSVGDSLVFQYPPN-H  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             VVE+ +++ Y SC  ++P+ S++ G   + L  PG RYF CGT GHC QGMK+++ TL
Sbjct  64   DVVEV-TKADYDSCQPTNPIQSYNDGATTIPLTLPGKRYFICGTIGHCSQGMKVEIDTL  121



>gb|EMS58905.1| Blue copper protein [Triticum urartu]
Length=171

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L+ V    ++   +AA + VG   G WD ST++D+WAS   F+  D++VF+Y+P  H
Sbjct  5    RTILLAVAAMTVLSTASAAIYNVGEPGGAWDFSTNYDTWASSRNFQTSDRIVFKYSPQAH  64

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
             V+E+ S++ Y SC T+SPV + + GNDVV L   G+RYF CG  GHC  GMK+K+  + 
Sbjct  65   DVLEV-SKADYDSCSTASPVTTLNFGNDVVTLTATGTRYFICGFPGHCAGGMKVKIDVMP  123

Query  374  G  376
            G
Sbjct  124  G  124



>gb|ACU23845.1| unknown [Glycine max]
Length=216

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 3/119 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGG-SQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
              M  V   AV+I+  +A  ++VGG S GWD +++  SWAS   F VGD LVF+Y P  H
Sbjct  5    ELMFRVSFMAVLIKLASATNYIVGGPSGGWDTNSNLQSWASSQIFSVGDSLVFQYPPN-H  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             VVE+ +++ Y SC  ++P+ S++ G   + L  PG RYF CGT GHC QGMK+++ TL
Sbjct  64   DVVEV-TKADYDSCQPTNPIQSYNDGATTIPLTLPGKRYFICGTIGHCSQGMKVEIDTL  121



>ref|XP_009353238.1| PREDICTED: blue copper protein-like [Pyrus x bretschneideri]
Length=240

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            ++ +VI  +++E   A  + VGG  G WD +TD  +WAS ++F VGD L F+Y+P  H V
Sbjct  8    LMNLVIVTMLVESAMAVTYTVGGPNGRWDSTTDLKTWASSHSFLVGDNLNFQYSPN-HEV  66

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +E+  ++ Y SC   + + S+SGG+  + L+ PG RYF CGTAGHC QGMKL+V
Sbjct  67   IEV-PKADYDSCQARNSIQSYSGGSTTIPLSSPGKRYFICGTAGHCSQGMKLEV  119



>ref|XP_009132835.1| PREDICTED: blue copper protein-like [Brassica rapa]
 emb|CDX84741.1| BnaA03g14890D [Brassica napus]
Length=257

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 4/118 (3%)
 Frame = +2

Query  17   RCMLVVV---IGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            R ML+++   +   +I    A  H +GG  GW    +  +WA+G TF VGD LVF Y   
Sbjct  4    REMLIIISVLLATTLIGLTVATDHTIGGPSGWTVGANLKTWAAGQTFVVGDNLVFAYPSA  63

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             H VVE+ ++  Y SC    P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   FHDVVEV-TKPEYDSCQAVKPLITFANGNSIVPLTTPGKRYFICGMPGHCTQGMKLEV  120



>ref|XP_009341435.1| PREDICTED: blue copper protein-like [Pyrus x bretschneideri]
Length=240

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            ++ +VI  +++E   A  + VGG  G WD +TD  +WAS ++F VGD L F+Y+P  H V
Sbjct  8    LMNLVIVTMLVESAMAVTYTVGGPNGRWDSTTDLKTWASSHSFLVGDNLNFQYSPN-HEV  66

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +E+  ++ Y SC   + + S+SGG+  + L+ PG RYF CGTAGHC QGMKL+V
Sbjct  67   IEV-PKADYDSCQARNSIQSYSGGSTTIPLSSPGKRYFICGTAGHCSQGMKLEV  119



>ref|XP_002272263.1| PREDICTED: uclacyanin-3 [Vitis vinifera]
 emb|CBI16675.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = +2

Query  62   VAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDT  241
            + A  H VGGS GWD   D+ +WASG TF VGD LVF Y    HSV E+ S+S+Y SC T
Sbjct  17   IYAENHTVGGSSGWDTGVDYSTWASGETFTVGDYLVFTYGS-THSVDEV-SKSSYDSCAT  74

Query  242  SSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            S+P  S++GG++ + L   GS YF C T GHC QGMKL +T
Sbjct  75   SNPTKSYTGGSNTIALTTAGSLYFLCPTTGHCSQGMKLAIT  115



>ref|XP_010414015.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=261

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+   +I    A  H +GG  GW   T   +WA+  TF VGD LVF Y    
Sbjct  4    RDMLIIISVLATTLIGLTVATDHTIGGPSGWTVGTSLRTWAAAQTFAVGDNLVFSYPATF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  + SC +  P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEFDSCQSVKPLITFANGNSIVPLTTPGKRYFICGMPGHCSQGMKLEV  119



>ref|XP_004137571.1| PREDICTED: early nodulin-55-2-like [Cucumis sativus]
 ref|XP_004162955.1| PREDICTED: early nodulin-55-2-like [Cucumis sativus]
 gb|KGN63959.1| hypothetical protein Csa_1G031800 [Cucumis sativus]
Length=217

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R ++V+VI A+    V A  H VGGS GWD +++  +W++  TF+VGD LVF+Y P +H 
Sbjct  11   RMIIVMVITAIFFRCVNATNHSVGGSSGWDLNSNILAWSAATTFQVGDYLVFKYLP-VHD  69

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            V+E+ + + + +C T +P+ + S G  V+ LN+PGSRYF CG   HC  G+KL+V  L
Sbjct  70   VLEV-NRTDFFNCRTVNPIRTHSDGETVIPLNQPGSRYFICGRPQHCLMGLKLRVQVL  126



>emb|CAN66310.1| hypothetical protein VITISV_027162 [Vitis vinifera]
Length=181

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = +2

Query  62   VAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDT  241
            + A  H VGGS GWD   D+ +WASG TF VGD LVF Y    HSV E+ S+S+Y SC T
Sbjct  17   IYAENHTVGGSSGWDTGVDYSTWASGETFTVGDYLVFTYGS-THSVDEV-SKSSYDSCAT  74

Query  242  SSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            S+P  S++GG++ + L   GS YF C T GHC QGMKL +T
Sbjct  75   SNPTKSYTGGSNTIALTTAGSLYFLCPTTGHCSQGMKLAIT  115



>ref|XP_004287916.1| PREDICTED: blue copper protein [Fragaria vesca subsp. vesca]
Length=233

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 3/116 (3%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            ++  V+  V++E  AAA + VGG  G WD STD  +WAS  TF VGD L F+Y+P  H+V
Sbjct  9    LMSFVMMNVLVELAAAATYTVGGPNGGWDASTDLQTWASSQTFLVGDNLNFQYSPS-HNV  67

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            +E+ S++ Y SC  S+ + ++SGG+  + L+  G RYF CGT GHC QGMKL+V T
Sbjct  68   LEV-SKADYDSCQGSNSIQAYSGGSTTIPLSSAGKRYFICGTIGHCSQGMKLEVGT  122



>ref|XP_008437239.1| PREDICTED: chemocyanin-like [Cucumis melo]
Length=217

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R ++V+VI A+    V A  H VGGS GWD +++  +W++  TF+VGD LVF+Y P +H 
Sbjct  11   RMIIVMVITAIFFRCVNATNHSVGGSSGWDLNSNILAWSAATTFQVGDYLVFKYLP-VHD  69

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            V+E+ + + + +C T +P+ + S G  V+ LN+PGSRYF CG   HC  G+KL+V  L
Sbjct  70   VLEV-NRTDFFNCRTVNPIRTHSDGETVIPLNQPGSRYFICGRPQHCLMGLKLRVQVL  126



>ref|XP_002309845.1| UCLACYANIN 1 family protein [Populus trichocarpa]
 gb|EEE90295.1| UCLACYANIN 1 family protein [Populus trichocarpa]
Length=247

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 5/122 (4%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R    + + A+M+    AA + VGG  G WD +T+  +WA+ N F VGD L+F+Y  G
Sbjct  1    MVRTFTSLALMAMMLRLAMAANYTVGGPNGGWDATTNLQAWAASNQFLVGDNLIFQY--G  58

Query  188  L-HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            L H V E+ S++ Y SC  +SP+ S+SGG  V+ L+ PG RYF C T GHC  GMKL++ 
Sbjct  59   LVHDVNEV-SKADYDSCQITSPLKSYSGGTTVIPLSSPGKRYFTCATPGHCAGGMKLEID  117

Query  365  TL  370
            TL
Sbjct  118  TL  119



>emb|CDY65457.1| BnaC03g71950D [Brassica napus]
Length=255

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+    I    A  H +GG +GW    +  +WA+G TF VGD LVF Y    
Sbjct  4    REMLIIISVLATTFIGLAVATDHTIGGPRGWTVGANLKTWAAGQTFVVGDNLVFAYPSAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  Y SC    P+  F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEYDSCQAVKPLIKFANGNSIVPLTTPGKRYFICGMPGHCTQGMKLEV  119



>ref|NP_180789.1| uclacyanin 1 [Arabidopsis thaliana]
 gb|AAC32038.1| uclacyanin I [Arabidopsis thaliana]
 gb|AAC69948.1| putative uclacyanin I [Arabidopsis thaliana]
 gb|AEC08665.1| uclacyanin 1 [Arabidopsis thaliana]
Length=261

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+   +I    A  H +GG  GW       +WA+G TF VGD LVF Y    
Sbjct  4    REMLIIISVLATTLIGLTVATDHTIGGPSGWTVGASLRTWAAGQTFAVGDNLVFSYPAAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  + SC    P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEFDSCQAVKPLITFANGNSLVPLTTPGKRYFICGMPGHCSQGMKLEV  119



>dbj|BAF01024.1| uclacyanin I - like predicted GPI-anchored protein [Arabidopsis 
thaliana]
Length=261

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+   +I    A  H +GG  GW       +WA+G TF VGD LVF Y    
Sbjct  4    REMLIIISVLATTLIGLTVATDHTIGGPSGWTVGASLRTWAAGQTFAVGDNLVFSYPAAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  + SC    P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEFDSCQAVKPLITFANGNSLVPLTTPGKRYFICGMPGHCSQGMKLEV  119



>ref|XP_010510046.1| PREDICTED: blue copper protein-like [Camelina sativa]
Length=262

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+   +I    A  H +GG  GW       +WA+  TF VGD LVF Y    
Sbjct  4    REMLIIIAVLATTLISLTVATDHTIGGPSGWTVGASLRTWAAAQTFAVGDNLVFSYPAAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  + SC +  P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEFDSCQSVKPLITFANGNSIVPLTTPGKRYFICGMPGHCSQGMKLEV  119



>gb|KDO59873.1| hypothetical protein CISIN_1g043413mg, partial [Citrus sinensis]
Length=185

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R  + V   AV+I+   AA + VGG  G WD +TD  +WA+   F VGD L+F+Y P 
Sbjct  3    VLRTFICVAATAVLIQLSMAANYTVGGPNGGWDTATDLRTWATSQKFLVGDNLIFQY-PS  61

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V E+ S+  Y SC TS+ + S++ GN V+ L+ PG RYF CG  GHC  GMK+ + T
Sbjct  62   SHDVTEV-SKPDYDSCQTSNKIKSYTDGNTVIPLSSPGKRYFICGAPGHCTVGMKVGIDT  120

Query  368  L  370
            L
Sbjct  121  L  121



>ref|XP_010469615.1| PREDICTED: blue copper protein [Camelina sativa]
Length=261

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+   +I    A  H +GG  GW   T   +WA+  TF VGD LVF Y    
Sbjct  4    RDMLIIISVLATTLIGLTVATDHTIGGPSGWTVGTSLRTWAAAQTFAVGDNLVFSYPAAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  + SC +  P+ +F+ G+ +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEFDSCQSVKPLITFANGDSIVPLTTPGKRYFICGMPGHCSQGMKLEV  119



>gb|EMS50846.1| Blue copper protein [Triticum urartu]
Length=171

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L+ +    ++   +AA + VG   G WD ST++ +WAS   F+  DQ+VF+Y+P  H
Sbjct  5    RTILLAMAAMAVLSTASAATYNVGEPGGAWDLSTNYGTWASSRNFQTSDQIVFKYSPQAH  64

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
             V+E+ S++ Y SC T++P+ +F+ GNDVV     G+RYF CG  GHC  GMK+K+  + 
Sbjct  65   DVLEV-SKADYDSCSTANPITTFNSGNDVVTFTATGTRYFICGFPGHCAGGMKVKIDIMP  123

Query  374  G  376
            G
Sbjct  124  G  124



>gb|EMS58904.1| Mavicyanin [Triticum urartu]
Length=171

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L+ +   V++   +AA + VG   G WD ST++ +WAS   F+ GDQ+VF+Y+   H
Sbjct  5    RTILLAMAAMVILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFQTGDQIVFKYSTQAH  64

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
             V+E+ S++ Y SC T+SPV +F+ GNDVV L   G+RYF CG   HC  GMK+K+  + 
Sbjct  65   DVLEV-SKADYDSCSTASPVTTFNSGNDVVTLAATGTRYFICGFPSHCAGGMKVKIDVMP  123

Query  374  G  376
            G
Sbjct  124  G  124



>gb|KDO48731.1| hypothetical protein CISIN_1g042393mg [Citrus sinensis]
Length=187

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + +L+ VI ++    V+A  H VGGS GWD S++  +W++  TF VGD LVF Y P LH 
Sbjct  8    KAILLTVIISIPFSGVSATNHTVGGSTGWDLSSNIHAWSATATFHVGDTLVFTYTP-LHD  66

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            V+E+ ++  Y +C T +P+++ + G+ VV L +PG+RYF CG  GHC  G+K +V  L
Sbjct  67   VLEV-NQLEYATCHTVNPISAHNSGDTVVPLIEPGTRYFICGRNGHCASGLKFRVDVL  123



>ref|XP_002274801.1| PREDICTED: uclacyanin-3 [Vitis vinifera]
Length=232

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R  + + + A++I+   AA + VGG  G WD S++  +WAS  TF VGD L+F++ P 
Sbjct  1    MLRAQMSLAVTALLIQLGMAANYTVGGPNGGWDTSSNLQTWASAQTFIVGDNLIFQFTPN  60

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+ S++ Y SC TS+P  ++S    V+ L+ PG R F CG AGHC QGMK+++ T
Sbjct  61   -HDVLEV-SKADYDSCSTSNPTQTYSSSPAVIPLSSPGKRCFICGMAGHCSQGMKIELDT  118

Query  368  L  370
            L
Sbjct  119  L  119



>ref|XP_006289951.1| hypothetical protein CARUB_v10003579mg [Capsella rubella]
 gb|AAR15456.1| Cu2+ plastocyanin-like [Capsella rubella]
 gb|EOA22849.1| hypothetical protein CARUB_v10003579mg [Capsella rubella]
Length=191

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+   L ++ G V+I +  A  + VG S GWD S+D +SW SG  F  GD L+F+Y+   
Sbjct  8    LFLLNLCIIFGTVVIRRCDATTYFVGDSSGWDISSDLESWTSGKRFSPGDVLMFQYS-ST  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+ +++ Y+SC+T+ P+ +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  67   HSVYEV-AKNNYQSCNTTDPIRTFTNGNTTVSLSKPGDRFFVCGNRLHCFAGMRLQV  122



>gb|KFK31132.1| hypothetical protein AALP_AA6G072100 [Arabis alpina]
Length=260

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 1/116 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            ++  ++   +I    A  H +GG  GW  S +  +WA+  TF VGD LVF Y    H VV
Sbjct  8    IIFSILATTLIGLAVATDHTIGGPSGWTVSANLRTWAAAQTFSVGDNLVFSYPTAFHDVV  67

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            E+ ++  + SC   +P+ +F+ GN +V L  PG RYF CG+ GHC  GMKL+V  L
Sbjct  68   EV-TKPEFDSCQAVNPLTTFANGNSIVPLTTPGKRYFICGSPGHCSSGMKLEVNVL  122



>gb|ABK26526.1| unknown [Picea sitchensis]
Length=187

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 77/115 (67%), Gaps = 2/115 (2%)
 Frame = +2

Query  32   VVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELG  211
            +V+  +M     A  + VG +Q W+   D+ +WASG TF VGD+LVF Y+  LHSV+E+ 
Sbjct  16   MVMMMIMPFNCMATDYTVGDTQQWNLGVDYGTWASGKTFAVGDKLVFAYSA-LHSVMEV-  73

Query  212  SESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            S++ Y +C TS+ + S++GG+  V L+  G++YF CGTAGHC  GMKL VT  TG
Sbjct  74   SKADYDACSTSNAIKSYNGGSTTVTLDSAGAKYFVCGTAGHCSGGMKLGVTVATG  128



>ref|XP_010919749.1| PREDICTED: blue copper protein-like [Elaeis guineensis]
Length=186

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 75/114 (66%), Gaps = 5/114 (4%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +LV++I AV    V A Q+ VG SQGW    D+ +W S  TFKVGD L+F+Y   LHSV 
Sbjct  7    LLVLLIAAV---PVYATQYTVGDSQGWTSGVDYSTWVSDKTFKVGDTLLFQYG-FLHSVD  62

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            E+ SES YK+C  S+ + +++  N  + L+K GSRYF CGT GHC  GMKL VT
Sbjct  63   EV-SESDYKACSASNSIQTYNDQNTKITLSKAGSRYFICGTPGHCTGGMKLAVT  115



>ref|XP_004487369.1| PREDICTED: blue copper protein-like [Cicer arietinum]
Length=232

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            +   ++ V   A+ I+   A  H+VGG  G WD STD  +WAS   F VG+ L F+Y+P 
Sbjct  3    VLEIIIKVSFMAMFIKLAMATNHIVGGPNGGWDTSTDLQTWASSQQFAVGNNLTFQYSPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H+VVE+ +++ Y SC  ++P+ S++ G   + L  P  RYF CGT GHC QGMKL++ T
Sbjct  63   -HNVVEV-TKADYDSCQQTNPIQSYNDGATTITLTSPVKRYFICGTIGHCSQGMKLEIDT  120

Query  368  L  370
            L
Sbjct  121  L  121



>gb|EMT07779.1| Mavicyanin [Aegilops tauschii]
Length=170

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L+ +    ++   +AA + VG   G WD ST++ +WAS   F+ GDQ+VF+Y+P  H
Sbjct  5    RTILLAMASMAILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFQTGDQIVFKYSPQAH  64

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             V+E+ S++ Y SC T+SPV +F+ GNDVV L   G+ Y+ CG  GHC  GMK+K+
Sbjct  65   DVLEV-SKADYDSCSTASPVTTFNSGNDVVTLTTTGTSYYICGFPGHCAGGMKVKI  119



>ref|XP_006295920.1| hypothetical protein CARUB_v10025057mg [Capsella rubella]
 gb|EOA28818.1| hypothetical protein CARUB_v10025057mg [Capsella rubella]
Length=263

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 65/117 (56%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+    I    A  H +GG  GW       SWA+  TF VGD LVF Y    
Sbjct  4    RDMLIIFTVLATTFIGLTVATDHTIGGPSGWTVGASLRSWAAAQTFAVGDNLVFSYPAAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  + SC    P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEFDSCQAVKPLITFANGNSIVPLTTPGKRYFICGMPGHCSQGMKLEV  119



>ref|XP_003575446.1| PREDICTED: stellacyanin-like [Brachypodium distachyon]
Length=190

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L++ I A  +     A + VG   G WD  T++  W S   F+ GDQLVF+Y+P  H
Sbjct  4    RALLILAITAAALGTALGATYTVGAPAGSWDLRTNYAQWTSTVKFRAGDQLVFKYSPAAH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +VVE+ S++ Y +C  SSP+ SF  GNDV+ L   GSRYF CG  GHC+ GMK++V
Sbjct  64   NVVEV-SKADYDACSNSSPLASFQTGNDVIPLPAAGSRYFICGVPGHCDGGMKIRV  118



>ref|XP_010247016.1| PREDICTED: uclacyanin-3 [Nelumbo nucifera]
Length=230

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R +L +    ++++    A   VGGS GWD +TD  +WA+  +F VGD L+F Y+  +H 
Sbjct  5    RTLLGLAALTMIVQLAVGADLKVGGSSGWDTTTDLQTWAASQSFFVGDSLIFTYS-SIHD  63

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            V+E+ +++ Y SC +S+P+ S++ GN  ++L+ P  RYF CG  GHC+QGMKL+V  L
Sbjct  64   VLEV-TKADYDSCSSSNPIKSYNDGNTTIQLSSPVKRYFICGKTGHCDQGMKLEVNVL  120



>gb|KHN10810.1| Blue copper protein [Glycine soja]
Length=102

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  68   AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            A QHVVGGSQGWDESTDF+SW SG TF VGDQ VF+Y+  LHSVVELGSES YK+C+  +
Sbjct  2    AEQHVVGGSQGWDESTDFNSWVSGRTFMVGDQRVFKYSS-LHSVVELGSESEYKNCNIGN  60

Query  248  PVNSFSGGNDVVKLNKP  298
             VNS S GNDV ++ + 
Sbjct  61   AVNSMSSGNDVCEIEQA  77



>ref|XP_010109549.1| Blue copper protein [Morus notabilis]
 gb|EXC23153.1| Blue copper protein [Morus notabilis]
Length=220

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGG-SQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R +L + + A++IE   AA + VGG   GWD ST+  SWAS   F VGD L+F+Y P 
Sbjct  3    MKRTILSMAVMALLIELGMAANYTVGGGPNGWDTSTNLQSWASSQAFLVGDNLIFQYTPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H+++E+ +++ Y SC+ S+ +  ++ GN V+ L+ PG RYF CG +GHC  GMK+++ T
Sbjct  63   -HNLMEV-TKAGYDSCNPSNLLQIYNDGNTVIPLSAPGKRYFICGVSGHCLGGMKVEIDT  120

Query  368  L  370
            L
Sbjct  121  L  121



>gb|ACU19678.1| unknown [Glycine max]
Length=227

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
              M  V   A++I+   A  ++VGG  G WD +++  SWAS   F VGD LVF+Y P  H
Sbjct  5    EMMFRVSFVAILIKLALATNYIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPN-H  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             VVE+ +++ Y SC  +SP+ S++ G   + L   G RYF CGT GHC QGMK+++ TL
Sbjct  64   DVVEV-TKADYDSCQPTSPIQSYNDGTTTIPLTSLGKRYFICGTIGHCSQGMKVEIDTL  121



>ref|XP_003543376.1| PREDICTED: blue copper protein-like [Glycine max]
Length=227

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
              M  V   A++I+   A  ++VGG  G WD +++  SWAS   F VGD LVF+Y P  H
Sbjct  5    EMMFRVSFVAILIKLALATNYIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPN-H  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             VVE+ +++ Y SC  +SP+ S++ G   + L   G RYF CGT GHC QGMK+++ TL
Sbjct  64   DVVEV-TKADYDSCQPTSPIQSYNDGTTTIPLTSLGKRYFICGTIGHCSQGMKVEIDTL  121



>gb|KHN36563.1| Early nodulin-like protein 1 [Glycine soja]
Length=227

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
              M  V   A++I+   A  ++VGG  G WD +++  SWAS   F VGD LVF+Y P  H
Sbjct  5    EMMFRVSFVAILIKLALATNYIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPN-H  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             VVE+ +++ Y SC  +SP+ S++ G   + L   G RYF CGT GHC QGMK+++ TL
Sbjct  64   DVVEV-TKADYDSCQPTSPIQSYNDGTTTIPLTSLGKRYFICGTIGHCSQGMKVEIDTL  121



>ref|XP_010522318.1| PREDICTED: blue copper protein [Tarenaya hassleriana]
Length=266

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 66/118 (56%), Gaps = 1/118 (1%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + +  +V+   +     A  H +GG  GW   +D  +W++  TF VGD LVF Y    H 
Sbjct  5    KMLSALVVATALFGLAIATDHTIGGPSGWTMGSDLRTWSASQTFVVGDNLVFAYPSAFHD  64

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            VVE+ S+  + +C    P+ +FS GN VV L  PG RYF CG  GHC QGMKL+V  L
Sbjct  65   VVEV-SKPEFDNCQAIKPLVTFSNGNTVVPLTSPGKRYFICGMPGHCTQGMKLEVNVL  121



>ref|XP_006469730.1| PREDICTED: early nodulin-20-like [Citrus sinensis]
Length=241

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R  + V   A++I+   AA + VGG  G WD +TD  +WA+   F VGD L+F+Y P 
Sbjct  3    VLRTFICVAATAMLIQLSMAANYTVGGPNGGWDTATDLRTWATSQKFLVGDNLIFQY-PS  61

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V E+ S+  Y SC TS+ + S++ GN V+ L+ PG RYF CG  GHC  GMK+++  
Sbjct  62   SHDVTEV-SKPDYDSCQTSNKIQSYTDGNTVIPLSSPGKRYFICGAPGHCTVGMKVEIDA  120

Query  368  L  370
            L
Sbjct  121  L  121



>ref|XP_006410363.1| hypothetical protein EUTSA_v10017076mg [Eutrema salsugineum]
 gb|ESQ51816.1| hypothetical protein EUTSA_v10017076mg [Eutrema salsugineum]
Length=270

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 66/113 (58%), Gaps = 1/113 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +++ ++   +I    A  H VGG  GW       +WA+G TF VGD LVF Y    H VV
Sbjct  8    IIISLLVTTLIGLAVATDHTVGGPSGWTVGASLGTWAAGQTFSVGDNLVFAYPSAFHDVV  67

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            E+ ++  + SC +  P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  68   EV-TKPEFDSCQSVKPLITFANGNSIVPLTTPGKRYFICGMPGHCTQGMKLEV  119



>ref|XP_002879382.1| hypothetical protein ARALYDRAFT_482160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55641.1| hypothetical protein ARALYDRAFT_482160 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVV--VIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R ML++  V+   ++    A  H +GG  GW       +WA+G TF VGD LVF Y    
Sbjct  4    RDMLIIISVVTTTLLGLAVATDHTIGGPSGWTVGASLRTWAAGQTFAVGDNLVFSYPAAF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H VVE+ ++  + SC    P+ +F+ GN +V L  PG RYF CG  GHC QGMKL+V
Sbjct  64   HDVVEV-TKPEFDSCQAVKPLITFANGNSLVPLITPGKRYFICGMPGHCIQGMKLEV  119



>ref|XP_006352033.1| PREDICTED: early nodulin-20-like [Solanum tuberosum]
Length=243

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R ++ +   A++     AA H VG  +G WDESTD  +WA+  TF VGD L+F Y+P 
Sbjct  3    MVRILMSLATIAILFGSTMAANHTVGAPKGRWDESTDLTTWAASETFLVGDSLIFVYSPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+  +  Y SC T++ +++  GG  ++ L+  G RYF CGT GHC  GMKL+V T
Sbjct  63   -HDVLEV-RKGDYDSCQTTNAISTNGGGMTIISLSSTGKRYFICGTGGHCASGMKLEVNT  120

Query  368  L  370
            L
Sbjct  121  L  121



>ref|XP_006441403.1| hypothetical protein CICLE_v10023892mg, partial [Citrus clementina]
 gb|ESR54643.1| hypothetical protein CICLE_v10023892mg, partial [Citrus clementina]
Length=256

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + +L+ VI ++    V+A  H VGGS GWD S++  +W++  TF VGD LVF Y P LH 
Sbjct  68   KAILLTVIISIPFSGVSATNHTVGGSTGWDLSSNIHAWSATATFHVGDTLVFTYTP-LHD  126

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            V+E+ ++  Y +C T +P+++ + G+ VV L +PG+RYF CG  GHC  G+K +V  L
Sbjct  127  VLEV-NQLEYATCHTVNPISAHNSGDTVVPLIEPGTRYFICGRNGHCASGLKFRVDVL  183



>ref|XP_008379599.1| PREDICTED: blue copper protein-like [Malus domestica]
Length=240

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            ++ +VI  ++IE   A  + VGG  G WD +TD  +WAS  +F VGD L F+Y+   H V
Sbjct  8    LMNLVIVTMLIESAMATTYTVGGPNGRWDSTTDLKTWASSQSFLVGDNLNFQYS-TKHDV  66

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +E+  ++ Y SC   + + S+SGG+  + L+ PG RYF CGT GHC QGMKL+V
Sbjct  67   IEV-PKADYDSCQARNSIQSYSGGSTTITLSSPGKRYFICGTTGHCSQGMKLEV  119



>gb|EMT33682.1| Blue copper protein [Aegilops tauschii]
Length=171

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGS-QGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R +L+ V    ++   +AA + VG   + WD  T++ +WAS  TF+  DQ+VF+Y+P 
Sbjct  3    ITRTILLAVAAMAIMSTASAAIYNVGEPGRAWDLGTNYSTWASSRTFQPDDQIVFKYSPQ  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+ S++ Y SC T++P+ + + GNDV+ L   G+RYF CG  GHC  GMK+K+  
Sbjct  63   AHDVLEV-SKADYDSCSTATPIATLNSGNDVIALTVTGTRYFICGFPGHCAGGMKVKIDV  121

Query  368  L  370
            +
Sbjct  122  M  122



>ref|XP_010931419.1| PREDICTED: uclacyanin-3-like [Elaeis guineensis]
Length=218

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R  + V   A +++    A   VGG  G WD ST+  SWA+   F  GD L F+Y    H
Sbjct  5    RAFIGVATIAALVQVAIGASFPVGGQNGGWDLSTNLASWAATQKFIAGDSLTFKYA-SFH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             V+E+ S++ Y +C TS P N+++GG+ VVKL+ PG RYF CGT GHC QGMK+++
Sbjct  64   DVLEV-SKAEYDACATSKPTNTYTGGSTVVKLSSPGKRYFICGTPGHCSQGMKVEI  118



>dbj|BAK00202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L+ V    ++   +AA + VG   G WD ST++ +WAS   F   D++VF+Y+P  H
Sbjct  5    RTILLAVATMTILSTASAAIYNVGEPGGAWDLSTNYGTWASSRNFHPSDRIVFKYSPQAH  64

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             V+E+ S++ Y SC T+SP+ + + GNDVV L   G+RYF CG  GHC  GMK+K+
Sbjct  65   DVLEV-SKADYDSCSTASPIATLNSGNDVVPLTATGTRYFICGFPGHCAGGMKVKI  119



>gb|EMS56684.1| Mavicyanin [Triticum urartu]
Length=175

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + ++++ +   M+  V +A H VG   G W+  T++  WAS   F +GD++ F+Y+  +H
Sbjct  4    KVLILITMVVAMLRMVISASHTVGAPAGSWNLQTNYTLWASSTRFTIGDEIQFQYSTTVH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +VVE+  ++ Y +C++SSP+ +F  GNDVV L   G+RYF CG  GHC  GMK++V
Sbjct  64   NVVEV-RKAGYNACNSSSPIATFLTGNDVVPLTAIGTRYFICGVPGHCGAGMKVQV  118



>ref|XP_006399230.1| hypothetical protein EUTSA_v10014745mg [Eutrema salsugineum]
 gb|ESQ40683.1| hypothetical protein EUTSA_v10014745mg [Eutrema salsugineum]
Length=193

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            L +V G + + +  A  + VG + GWD S+D DSW  G  F VGD L+F+Y+   HSV E
Sbjct  13   LCIVFGTLALRRCNATTYFVGDTSGWDISSDLDSWTLGKRFSVGDVLMFQYS-STHSVYE  71

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +  +  +++C+T+ P+ +F+ GN  V L+KPG R+F CG   HC  GMKL+V
Sbjct  72   VAKDK-FQNCNTTDPIRTFTNGNTTVALSKPGDRFFVCGNRLHCFAGMKLQV  122



>ref|XP_006493407.1| PREDICTED: blue copper protein-like [Citrus sinensis]
Length=217

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 74/118 (63%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + +L+ VI ++    V+A  H VGG  GWD S++  +W++  TF VGD LVF Y P LH 
Sbjct  8    KAILLTVIISIPFSGVSATNHTVGGPTGWDLSSNIQAWSATATFHVGDTLVFTYTP-LHD  66

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            V+E+ ++  Y +C T  P+ + + G+ VV L +PG+RYF CG  GHC  G+K +V  L
Sbjct  67   VLEV-NQLEYATCHTVKPIGAHNSGDTVVPLIEPGTRYFICGRNGHCASGLKFRVDVL  123



>ref|XP_002515714.1| Early nodulin 20 precursor, putative [Ricinus communis]
 gb|EEF46661.1| Early nodulin 20 precursor, putative [Ricinus communis]
Length=258

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R ++ + + A++ E   AA + VGGS G WD ST+  +WA+   F VGD L+F+Y   
Sbjct  3    ILRNVMSLAVIAMLFELAMAANYTVGGSNGGWDTSTNLQAWAASQLFSVGDNLIFQYGAN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H++ E+ S++ Y SC TS+ +   S G+ V+ L+ PG+RYF CGT GHC QGMK+++  
Sbjct  63   -HNLFEV-SQADYDSCQTSNAIQGHSDGSTVIPLSSPGTRYFICGTPGHCTQGMKVEIDV  120

Query  368  L  370
            L
Sbjct  121  L  121



>ref|XP_004251506.1| PREDICTED: uclacyanin-3-like [Solanum lycopersicum]
Length=232

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + R ++ +   A++     AA H VG  QG WD+ST   +WA+  TF VGD L+F Y P 
Sbjct  3    MVRLLMNLATIAILFGSTMAANHTVGAPQGRWDQSTGLTTWAASETFLVGDSLIFVYTPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+  +S Y SC T++ +++  GG  ++ L+  G RYF CGT GHC  GMKL+V T
Sbjct  63   -HDVLEV-RKSDYDSCQTTNAISTNGGGMTIISLSSTGKRYFICGTGGHCASGMKLEVNT  120

Query  368  L  370
            L
Sbjct  121  L  121



>ref|XP_011029118.1| PREDICTED: mavicyanin-like [Populus euphratica]
 ref|XP_011029119.1| PREDICTED: mavicyanin-like [Populus euphratica]
 ref|XP_011029120.1| PREDICTED: mavicyanin-like [Populus euphratica]
Length=168

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 71/117 (61%), Gaps = 2/117 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
             +++ I AV +  + A +HVVG   GW    D+ +WA G TF VGD LVF+Y PG H+V+
Sbjct  7    FMIIAIVAVFLPSILATEHVVGDKTGWRPGFDYKTWAQGKTFYVGDTLVFKYTPGAHNVL  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQG-MKLKVTTL  370
             + + + ++ C  +  +   + GNDV+ L+ PG +++ CG A HCE G  KL +T L
Sbjct  67   RV-NGTGFQECKAADDIVPLTTGNDVIPLSTPGKKWYICGVAKHCESGNQKLSITVL  122



>ref|XP_003597041.1| Blue copper protein [Medicago truncatula]
 gb|AES67292.1| plastocyanin-like domain protein [Medicago truncatula]
Length=228

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            ++  +L V   A++I+   A  H+VGG  G WD +++  SW S   F VGD L+F+Y P 
Sbjct  3    VHEIILRVSFVAMLIKLAMATNHIVGGPIGGWDTNSNLQSWTSSQQFSVGDNLIFQYPPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H VVE+ +++ Y SC  ++P+ S++ G   + L   G RYF CGT GHC QGMK+++ T
Sbjct  63   -HDVVEV-TKADYDSCQQTNPIQSYNDGATSIPLTSTGKRYFICGTIGHCSQGMKVEIDT  120

Query  368  LTG  376
            L  
Sbjct  121  LAA  123



>gb|AFK38402.1| unknown [Medicago truncatula]
Length=228

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            ++  +L V   A++I+   A  H+VGG  G WD +++  SW S   F VGD L+F+Y P 
Sbjct  3    VHEIILRVSFVAMLIKLAMATNHIVGGPIGGWDTNSNLQSWTSSQQFSVGDNLIFQYPPD  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H VVE+ +++ Y SC  ++P+ S++ G   + L   G RYF CGT GHC QGMK+++ T
Sbjct  63   -HDVVEV-TKADYDSCQQTNPIQSYNDGATSIPLTSTGKRYFICGTIGHCSQGMKVEIDT  120

Query  368  LTG  376
            L  
Sbjct  121  LAA  123



>ref|XP_008800585.1| PREDICTED: mavicyanin-like [Phoenix dactylifera]
Length=183

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 75/123 (61%), Gaps = 5/123 (4%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAA----AQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNP  184
            + + V+V+ AV +  + A     ++VVG  QGWD   ++  W  G  F VGD LVFRY+P
Sbjct  5    QMLAVLVVAAVSMATLPAMARATEYVVGDDQGWDLGVNYTDWVQGKMFVVGDSLVFRYSP  64

Query  185  GLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
              H+V+ + +  A+++C+ +SP+ +   GND + L+ PG R++ CG A HCE G K  +T
Sbjct  65   DNHNVLGV-TGPAFRACNKTSPLKTLQSGNDTIPLSSPGRRWYICGKANHCESGQKFVIT  123

Query  365  TLT  373
             L+
Sbjct  124  VLS  126



>ref|XP_006659099.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=182

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +2

Query  77   HVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
            + VG   G WD  T++  WAS  TF+ GDQLVF+Y+P  H VVE+ ++  Y +C  SSP+
Sbjct  29   YTVGAPAGSWDMRTNYAQWASSITFRAGDQLVFKYSPSAHDVVEV-TKDGYDACSASSPI  87

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             +F+ GND V L   G+RYF CG  GHC  GMKL V
Sbjct  88   ATFTSGNDTVALAAAGTRYFICGFPGHCAGGMKLAV  123



>ref|NP_001152010.1| blue copper protein precursor [Zea mays]
 gb|ACG45379.1| blue copper protein precursor [Zea mays]
Length=174

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVIGA-VMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R  LV V  A V++   +AA + VG   G WD  T++ +W S   F  GDQ+VF+Y+P  
Sbjct  5    RLALVSVFAAAVLLGMASAATYNVGEPGGSWDLRTNYGTWVSSKRFHPGDQIVFKYSPQA  64

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H VVE+ +++ Y SC  +SPV + + GND + L  PG+RYF CG  GHC+ GMK+++  +
Sbjct  65   HDVVEV-NKADYDSCSIASPVATHNSGNDAIALASPGTRYFICGFPGHCDAGMKIQINVV  123



>gb|EMS58903.1| Blue copper protein [Triticum urartu]
Length=268

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R +L+ V    ++   +AA + VG   G WD ST++ +WAS   F   DQ++F+Y+P  H
Sbjct  5    RTILLAVSAMAILSTASAAIYNVGEPSGQWDLSTNYGTWASSRNFHPSDQIIFKYSPQAH  64

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             V+E+ S++ Y SC T+SP+ + + GNDVV L   G+RYF CG  GHC  GMK+K+
Sbjct  65   DVLEV-SKADYDSCSTASPIATLNSGNDVVSLTATGTRYFLCGFPGHCAGGMKVKI  119



>ref|NP_001060958.2| Os08g0138200 [Oryza sativa Japonica Group]
 dbj|BAD03007.1| putative blue copper binding protein [Oryza sativa Japonica Group]
 dbj|BAD03084.1| putative blue copper binding protein [Oryza sativa Japonica Group]
 dbj|BAF22872.2| Os08g0138200 [Oryza sativa Japonica Group]
Length=190

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +2

Query  68   AAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTS  244
            A  + VG   G WD  T++  WAS  TF+ GD+LVFRY+P  H VVE+ +++ Y +C  +
Sbjct  27   ATTYTVGAPAGSWDTRTNYAQWASAATFRAGDRLVFRYSPAAHDVVEV-TKAGYDACSAA  85

Query  245  SPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            SP+ +F+ G+D V L   G+RYF CG  GHC  GMKL V
Sbjct  86   SPIATFNSGDDTVPLAAVGTRYFICGFPGHCAAGMKLAV  124



>gb|EAZ05532.1| hypothetical protein OsI_27748 [Oryza sativa Indica Group]
Length=190

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +2

Query  68   AAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTS  244
            A  + VG   G WD  T++  WAS  TF+ GD+LVFRY+P  H VVE+ +++ Y +C  +
Sbjct  27   ATTYTVGAPAGSWDTRTNYAQWASAATFRAGDRLVFRYSPAAHDVVEV-TKAGYDACSAA  85

Query  245  SPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            SP+ +F+ G+D V L   G+RYF CG  GHC  GMKL V
Sbjct  86   SPIATFNSGDDTVPLAAVGTRYFICGFPGHCAAGMKLAV  124



>gb|ACN28394.1| unknown [Zea mays]
 tpg|DAA60662.1| TPA: blue copper protein [Zea mays]
Length=174

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVIGA-VMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R  LV V  A V++   +AA + VG   G WD  T++ +W S   F  GDQ VF+Y+P  
Sbjct  5    RLALVSVFAAAVLLGMASAATYNVGEPAGSWDLRTNYGTWVSSKRFHPGDQTVFKYSPQA  64

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H VVE+ +++ Y SC  +SPV + + GND + L  PG+RYF CG  GHC+ GMK+++  +
Sbjct  65   HDVVEV-NKADYDSCSIASPVATHNSGNDAIALASPGTRYFICGFPGHCDAGMKIQINVV  123



>gb|EMT06002.1| Mavicyanin [Aegilops tauschii]
Length=175

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + ++++ +   M+  V  A H VG   G WD  T++  WAS   F +GD+L F+Y+  +H
Sbjct  4    KVLILITVAVGMLGMVLGASHTVGAPAGSWDLQTNYTLWASRTRFTIGDELQFQYSTTMH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +VVE+  ++ Y +C++SSP+ +F  GNDVV L   G+RYF C   GHC  GMK +V
Sbjct  64   NVVEV-RKAGYDACNSSSPITTFLTGNDVVPLAAIGTRYFICSVPGHCAAGMKAQV  118



>gb|EAZ41457.1| hypothetical protein OsJ_25979 [Oryza sativa Japonica Group]
Length=190

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +2

Query  68   AAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTS  244
            A  + VG   G WD  T++  WAS  TF+ GD+LVFRY+P  H VVE+ +++ Y +C  +
Sbjct  27   ATTYTVGAPAGSWDTRTNYAQWASAATFRAGDRLVFRYSPAAHDVVEV-TKAGYDACSAA  85

Query  245  SPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            SP+ +F+ G+D V L   G+RYF CG  GHC  GMKL V
Sbjct  86   SPIATFNSGDDTVPLAAVGTRYFICGFPGHCAAGMKLAV  124



>gb|EMS56686.1| Mavicyanin [Triticum urartu]
Length=175

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + ++++ +   M+  V  A H VG   G W+  T++  W S   F +GD+L F+Y+  +H
Sbjct  4    KVLILITVAVAMLRMVIGASHTVGVPAGSWNLQTNYTLWVSSTRFTIGDELQFQYSTTVH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +VVE+  ++ Y +C++SSP+ +F  GNDVV L   G+RYF CG  GHC  GMK++V
Sbjct  64   NVVEV-RKAGYDACNSSSPIATFLTGNDVVPLAAIGTRYFICGVPGHCGAGMKVQV  118



>gb|KJB19644.1| hypothetical protein B456_003G111800 [Gossypium raimondii]
Length=184

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = +2

Query  68   AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            AA +VVG + GWD STD DSWA+  TF VGD L+F+Y+   HSV E+  ES +++C+T++
Sbjct  21   AATYVVGDTSGWDISTDIDSWATNKTFNVGDVLLFQYSSS-HSVSEVNKES-FETCNTTN  78

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             + +FS GN  V L+  G RYF CG   HC  GMKL+V  L
Sbjct  79   SLTTFSNGNTTVTLSNAGKRYFVCGNKLHCLGGMKLQVNVL  119



>ref|XP_010424736.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=198

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+   L ++ G V+I +  A  + VG S GWD S+D +SW SG  F  GD L+F+Y+   
Sbjct  8    LFLLNLCIIFGTVVIRRCNATTYFVGDSSGWDISSDLESWTSGKRFSPGDVLMFQYS-ST  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  ++ Y++C+++  + +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  67   HSVYEV-DKNNYQNCNSTDAIRTFTNGNTTVSLSKPGDRFFVCGNRLHCFAGMRLRV  122



>gb|AFK47720.1| unknown [Medicago truncatula]
Length=228

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 74/123 (60%), Gaps = 3/123 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            ++  +L V   A++I+   A  H+VGG  G WD +++  SW S   F VGD L+F+Y P 
Sbjct  3    VHEIILRVSFVAMLIKLAMATNHIVGGPIGGWDTNSNLQSWTSSQQFSVGDNLIFQYPPN  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H VVE+ +++ Y SC  ++P+ S++ G   + L   G RYF CGT GHC QGMK+++ T
Sbjct  63   -HDVVEV-TKADYDSCQQTNPIQSYNDGATSIPLTSTGKRYFICGTIGHCSQGMKVEIDT  120

Query  368  LTG  376
               
Sbjct  121  FAA  123



>ref|XP_009402874.1| PREDICTED: mavicyanin-like [Musa acuminata subsp. malaccensis]
Length=212

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   HVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
            + VGGS+G WD STD  +WAS  TF  GD L F Y P  H VVE+ +++ Y +C  S P+
Sbjct  26   YTVGGSEGGWDLSTDLQTWASAQTFVPGDSLSFAYAPS-HDVVEV-TKAEYDACTASRPI  83

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             S++GG+ V+KL+ PG R+F CG AGHC  GMKL+V
Sbjct  84   QSYTGGSTVIKLSAPGKRHFICGIAGHCTAGMKLEV  119



>ref|XP_009602744.1| PREDICTED: uclacyanin-3-like [Nicotiana tomentosiformis]
Length=227

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + R +L +   A+++    AA H VGG+ GW +  D+ +WA+  TF VGD L+F Y  GL
Sbjct  3    MLRTLLSLAAIAMVLNSAMAANHTVGGNGGWSQGADYKTWAASETFLVGDNLIFSY--GL  60

Query  191  -HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+ +++ Y SC T++ +++  GG  V+ L+  G RYF CGT GHC  GMKL+V T
Sbjct  61   SHDVLEV-TKANYDSCATTNAISTNGGGMTVIALSSLGRRYFICGTGGHCASGMKLEVNT  119

Query  368  L  370
            +
Sbjct  120  I  120



>ref|XP_006662866.1| PREDICTED: chemocyanin-like [Oryza brachyantha]
Length=123

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 61/100 (61%), Gaps = 1/100 (1%)
 Frame = +2

Query  62   VAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDT  241
            V A  HVVG S+GWD S  FDSWA G  F  GD LVF Y PG H+V+ + + + Y+SC  
Sbjct  22   VMAETHVVGDSKGWDYSVSFDSWADGKVFATGDTLVFNYKPGAHNVLAVDAAT-YRSCKV  80

Query  242  SSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            SSP +  +       L K G+ YF CG AGHC  GMKL+V
Sbjct  81   SSPDSVAAATGTASFLLKKGANYFICGVAGHCAAGMKLRV  120



>emb|CDX81058.1| BnaC03g03120D [Brassica napus]
Length=194

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+   L ++ G ++  +  A  + VG + GWD S+D +SW  G  F VGD L+F+Y+   
Sbjct  8    LFIFNLCIIFGILVTRRCNATTYFVGDTSGWDISSDLESWPLGKRFSVGDVLMFQYS-ST  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  ++ ++SC+T+ P+ +F+ GN  + L+KPG R+F CG   HC  GM+L+V
Sbjct  67   HSVYEVAKDN-FQSCNTTDPIRTFTNGNTTIALSKPGDRFFVCGNRLHCFAGMRLQV  122



>gb|AAR15487.1| Cu2+ plastocyanin-like [Arabidopsis arenosa]
Length=192

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            L ++ G V+I +  A  + VG S GWD S+D D+W SG  F  GD L+F+Y+   HSV E
Sbjct  13   LCIIFGIVVIRRCNATTYFVGDSSGWDISSDLDTWTSGKRFSPGDVLMFQYS-STHSVYE  71

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +  ++ Y++C+T+  + +F+ GN  V L+KPG R+F CG+  HC  GM+L V
Sbjct  72   VAKDN-YQNCNTTDAIRTFTNGNTTVALSKPGDRFFVCGSRLHCFAGMRLLV  122



>ref|XP_002873311.1| hypothetical protein ARALYDRAFT_487581 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49570.1| hypothetical protein ARALYDRAFT_487581 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            L ++ G V+I +  A  + VG S GWD S+D D+W SG  F  GD L+F+Y+   HSV E
Sbjct  13   LCIIFGIVVIRRCNATTYFVGDSSGWDISSDLDTWTSGKRFSPGDVLLFQYS-STHSVYE  71

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +  ++ Y+ C+T+  + +F+ GN  V L+KPG R+F CG+  HC  GM+L V
Sbjct  72   VAKDN-YQKCNTTDAIRTFTNGNTTVALSKPGDRFFVCGSRLHCFAGMRLLV  122



>dbj|BAD03006.1| putative blue copper binding protein [Oryza sativa Japonica Group]
 dbj|BAD03083.1| putative blue copper binding protein [Oryza sativa Japonica Group]
Length=195

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +2

Query  83   VGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPVNS  259
            VG   G WD  T++  W S  TF+VGDQLVF+Y+P  H VVE+ +++ Y SC +S PV +
Sbjct  31   VGAPAGSWDTRTNYAQWVSAVTFRVGDQLVFKYSPAAHDVVEV-TKAGYDSCSSSGPVAT  89

Query  260  FSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            F+ G+D V L   G+RYF CG  GHC  GMK+ V
Sbjct  90   FNSGDDTVPLTATGTRYFMCGFPGHCAAGMKIAV  123



>ref|XP_008793738.1| PREDICTED: blue copper protein-like [Phoenix dactylifera]
Length=261

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            R  + V   A +++        VGG  G WD ST+  +WA+   F VGD L F Y    H
Sbjct  5    RTFIGVATIAALVQVAIGGSFTVGGQNGGWDLSTNLAAWAAAQKFNVGDTLTFNYA-SAH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             V+E+ S++ Y +C TS P NS++GG+ VVKL+ PG RYF CG  GHC QGMK+++
Sbjct  64   DVLEV-SKADYDACATSKPTNSYTGGSTVVKLSSPGKRYFICGIPGHCSQGMKVEI  118



>ref|XP_010528834.1| PREDICTED: mavicyanin-like [Tarenaya hassleriana]
Length=143

 Score =   102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            L  ++ A +I       H VGGS+GW    D+  W +   F+VGD L+F Y+   H V E
Sbjct  11   LFTLVAATLIAGCMGMTHKVGGSEGWAPGVDYYDWVTSRHFQVGDSLLFAYDKNFHDVTE  70

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            L S   ++ CD SS    +  GNDVV L +PG  YF CG  GHC  G +  +
Sbjct  71   LASPLGFEFCDMSSATARYKTGNDVVNLTRPGRYYFVCGAPGHCHAGQRFDI  122



>ref|XP_009763857.1| PREDICTED: uclacyanin-3-like [Nicotiana sylvestris]
Length=239

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 78/121 (64%), Gaps = 4/121 (3%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            + R +L +   +++     AA H VGG+ GW +  D+ +WA+  TF VGD L+F Y  GL
Sbjct  3    MLRTLLSLAAISMVFGSAMAANHTVGGNSGWRQGADYKTWAASETFLVGDNLIFSY--GL  60

Query  191  -HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
             H V+E+ +++ Y SC+T++ +++ +GG  V+ L+  G RYF CGT GHC  GMKL+V T
Sbjct  61   SHDVLEV-TKANYDSCETTNAISTNAGGMTVITLSSLGKRYFICGTGGHCASGMKLEVNT  119

Query  368  L  370
            +
Sbjct  120  I  120



>ref|XP_011014141.1| PREDICTED: mavicyanin-like [Populus euphratica]
Length=168

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R  +++ I AV +  + A +H+VG  +GW    ++ SWA G  F VGD+LVF+Y PG H+
Sbjct  5    RIFMIIAIVAVFVPSILATEHMVGDQKGWTLGFNYQSWAQGKAFYVGDKLVFKYTPGAHN  64

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQG-MKLKVTTLT  373
            V+ +   + ++ C  +  +   + GNDV+ L+ PG +++ C   GHCE G  KL +T L+
Sbjct  65   VLSVNG-TGFEECKAADDIVPLTTGNDVIPLSTPGKKWYICSVPGHCESGNQKLFITVLS  123



>ref|NP_680152.1| cupredoxin superfamily protein [Arabidopsis thaliana]
 gb|AAQ22659.1| At5g07475 [Arabidopsis thaliana]
 dbj|BAF00061.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91163.1| cupredoxin superfamily protein [Arabidopsis thaliana]
Length=192

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            L ++ G V+I +  A  + VG S GWD S+D +SW SG  F  GD L+F+Y+   HSV E
Sbjct  13   LCIIFGVVVIRRCNATTYFVGDSSGWDISSDLESWTSGKRFSPGDVLMFQYS-STHSVYE  71

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +  ++ Y++C+T+  + +F+ GN  V L+KPG+R+F CG   HC  GM+L V
Sbjct  72   VAKDN-YQNCNTTDAIRTFTNGNTTVALSKPGNRFFVCGNRLHCFAGMRLLV  122



>gb|EMT26024.1| Blue copper protein [Aegilops tauschii]
Length=171

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +2

Query  5    ANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNP  184
            A +   +L++ + AV+    AA+ +V      WD +T++ +WAS   F+  DQ+VF+Y+P
Sbjct  2    AAMRLSLLIMAVMAVLSTTSAASYNVGEPGGAWDLNTNYGTWASSRKFQPSDQIVFKYSP  61

Query  185  GLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
              H+V+E+ S++ Y SC T +P+ + + GND+V L   G+RYF CG  GHC  GMK+K+
Sbjct  62   QAHNVLEV-SKADYDSCSTVNPIATLNSGNDIVTLTAVGTRYFICGFPGHCTGGMKVKI  119



>ref|XP_003575447.1| PREDICTED: mavicyanin-like [Brachypodium distachyon]
Length=190

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +2

Query  71   AQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            A H VG   G WD  T+   WAS   F+ GDQLVF+Y+   H+VVE+ S++ Y +C  SS
Sbjct  22   ASHTVGAPGGSWDLRTNHGQWASSIKFRAGDQLVFKYSRAAHNVVEV-SKADYDACSGSS  80

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            P+ SF  GNDVV L   G+RYF CG  GHC+ GMK++V
Sbjct  81   PLASFQTGNDVVPLPAAGTRYFICGVPGHCDAGMKVRV  118



>gb|EAZ05531.1| hypothetical protein OsI_27747 [Oryza sativa Indica Group]
Length=195

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +2

Query  101  WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPVNSFSGGNDV  280
            WD  T++  W S  TF+VGDQLVF+Y+P  H VVE+ +++ Y SC +S PV +F+ G+D 
Sbjct  38   WDTRTNYAQWVSAVTFRVGDQLVFKYSPAAHDVVEV-TKAGYDSCSSSGPVATFNSGDDT  96

Query  281  VKLNKPGSRYFACGTAGHCEQGMKLKV  361
            V L   G+RYF CG  GHC  GMK+ V
Sbjct  97   VPLTATGTRYFMCGFPGHCAAGMKIAV  123



>gb|ABU56004.1| blue copper-binding protein [Dasypyrum villosum]
Length=178

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            + V  I AV++   +AA + VG   G W  STD+ +W +   F VGD++VF+Y+P  H V
Sbjct  9    LAVAAISAVLLGTASAATYGVGEPAGAWTLSTDYSTWVADKKFNVGDEIVFKYSPSSHDV  68

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCE  340
            VE+ S++ Y SC T+  +N+F  GNDV+ LN  G+RYF CG  GHC 
Sbjct  69   VEV-SKAGYDSCSTAGAINTFKTGNDVIPLNVTGTRYFICGITGHCS  114



>ref|XP_011023908.1| PREDICTED: basic blue protein-like [Populus euphratica]
Length=168

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R  +++ I AV +  + A +H+VG  +GW    ++ SWA G  F VGD+LVF+Y PG H+
Sbjct  5    RIFMIIAIVAVFVPSILATEHMVGDQKGWTLGFNYQSWAQGKAFYVGDKLVFKYTPGAHN  64

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQG-MKLKVTTLT  373
            V+ +   + ++ C  +  +   + GNDV+ L+ PG +++ C   GHCE G  KL +T L+
Sbjct  65   VLSVNG-TGFEECKAADDIVPLTTGNDVITLSTPGKKWYICSVPGHCESGNQKLFITVLS  123



>emb|CDX70043.1| BnaA10g23920D [Brassica napus]
Length=197

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+   L ++ G  +I +  A  + VG + GWD S+D +SW  G  F VGD L+F+Y+   
Sbjct  8    LFLFYLCIIFGISVITRCNATTYFVGDTSGWDISSDLESWTLGKRFSVGDVLMFQYS-ST  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  ++ ++SC+++ P+ +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  67   HSVYEVAKDN-FQSCNSTDPIRTFTNGNTTVALSKPGDRFFLCGNRLHCFAGMRLQV  122



>gb|AAR15473.1| Cu2+ plastocyanin-like [Olimarabidopsis pumila]
Length=191

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            L ++ G ++I +  A  + VG S GWD S+D +SW SG  F  GD L+F+Y    HSV E
Sbjct  13   LCIIFGILVIRRCNATTYFVGDSSGWDISSDLESWTSGKRFSPGDVLMFQY-ASTHSVYE  71

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +  ++ Y+SC+T+  + +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  72   VAKDN-YQSCNTTEAIRTFTNGNTTVALSKPGDRFFVCGNRLHCFGGMRLQV  122



>ref|XP_002459878.1| hypothetical protein SORBIDRAFT_02g012920 [Sorghum bicolor]
 gb|EER96399.1| hypothetical protein SORBIDRAFT_02g012920 [Sorghum bicolor]
Length=172

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = +2

Query  62   VAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCD  238
             +AA + VG   G WD  T++D+W S   F  GDQ+VF+Y+P  H VVE+ S++ Y SC 
Sbjct  22   ASAATYNVGEPSGSWDLRTNYDTWVSSKRFHPGDQIVFKYSPQAHDVVEV-SKADYDSCS  80

Query  239  TSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             +SP+ + + GND + L  PG+RYF CG +GHC  GMK+++
Sbjct  81   NASPIATHNSGNDAIALASPGTRYFICGFSGHCTGGMKIQI  121



>ref|XP_010491367.1| PREDICTED: stellacyanin-like [Camelina sativa]
Length=194

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+   L ++ G V+I +  A  + VG S GWD S+D +SW SG  F  GD L+F+Y+   
Sbjct  8    LFLLNLCIISGIVVIRRCNATTYFVGDSSGWDISSDLESWTSGKRFSSGDVLMFQYS-ST  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  ++ Y++C+++  + +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  67   HSVYEV-DKNNYQNCNSTDAIRTFTNGNTTVSLSKPGDRFFVCGNRLHCFSGMRLRV  122



>ref|XP_003620297.1| Blue copper protein [Medicago truncatula]
 ref|XP_003620306.1| Blue copper protein [Medicago truncatula]
 gb|AES76515.1| plastocyanin-like domain protein [Medicago truncatula]
Length=210

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + M VVV+ +++   V    H VGG+  WD  ++   WAS  +F VGD LVF Y P L+ 
Sbjct  8    KAMFVVVLASILFRCVCGGNHTVGGASAWDLESNMQDWASTESFNVGDDLVFTYTP-LYD  66

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            V+E+ ++  Y +C  ++ +++ + G  V+ L + G+RYF CG  GHC+QG+KL+V
Sbjct  67   VIEV-NQQGYNTCTIANAISTHNTGETVIHLTESGTRYFVCGRMGHCQQGLKLEV  120



>ref|XP_010035616.1| PREDICTED: blue copper protein-like [Eucalyptus grandis]
Length=248

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = +2

Query  68   AAQHVVGG-SQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTS  244
            A  +VVGG + GWD +TD  +WAS  TF VGD L F+Y+PG H V E+ +++ Y SC  +
Sbjct  23   ATNYVVGGLNGGWDTNTDQATWASSQTFLVGDNLTFQYSPG-HDVSEV-TKADYDSCQAT  80

Query  245  SPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            S + +++ G+ V+ L  PG RYF C + GHC  GMKL++ TLT 
Sbjct  81   SAIQTYTSGSTVIPLTSPGKRYFICSSPGHCAAGMKLQINTLTA  124



>emb|CBI28975.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 3/102 (3%)
 Frame = +2

Query  68   AAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTS  244
            AA + VGG  G WD S++  +WAS  TF VGD L+F++ P  H V+E+ S++ Y SC TS
Sbjct  2    AANYTVGGPNGGWDTSSNLQTWASAQTFIVGDNLIFQFTPN-HDVLEV-SKADYDSCSTS  59

Query  245  SPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            +P  ++S    V+ L+ PG R F CG AGHC QGMK+++ TL
Sbjct  60   NPTQTYSSSPAVIPLSSPGKRCFICGMAGHCSQGMKIELDTL  101



>ref|XP_006653637.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=135

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +2

Query  62   VAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDT  241
             +A  + VG S GW    D+ +WA G  F VGD+L+F+YN   HSV E+ S + + SC  
Sbjct  23   ASARDYTVGDSSGWTTGVDYTAWARGKAFTVGDRLLFQYNSDRHSVAEV-SAADHGSCSP  81

Query  242  SSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            S+P+ S+  G   V L  PG+RYF CG++GHC  GMKL VT
Sbjct  82   SNPLRSYRDGTAAVALTSPGTRYFICGSSGHCASGMKLTVT  122



>gb|ADV57636.1| copper binding protein 1 [Gossypium hirsutum]
 gb|KJB57834.1| hypothetical protein B456_009G182800 [Gossypium raimondii]
Length=171

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQ--HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            M VV++ A +  ++ AAQ  HVVGG +GWD S+D  SW+SG +F+VGD++ F Y     S
Sbjct  8    MAVVIMAATLGGKLGAAQVHHVVGGDRGWDLSSDVASWSSGRSFRVGDKIWFAYAAAQES  67

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            + E+ S   Y+SCD S+P+  ++ G D + L+  G RYF  G    C+ G+KL V  +
Sbjct  68   IAEVNSPEEYESCDVSNPIRMYTDGIDGIPLDGEGIRYFVSGKEESCKNGLKLHVEVM  125



>ref|XP_009122335.1| PREDICTED: blue copper protein [Brassica rapa]
Length=224

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+   L ++ G  +I +  A  + VG + GWD S+D +SW  G  F VGD L+F+Y+   
Sbjct  8    LFLFYLCIIFGISVITRCNATTYFVGDTSGWDISSDLESWTLGKRFSVGDVLMFQYS-ST  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  ++ ++SC+++ P+ +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  67   HSVYEVAKDN-FQSCNSTDPIRTFTNGNTTVALSKPGDRFFLCGNRLHCFAGMRLQV  122



>ref|XP_010270093.1| PREDICTED: mavicyanin-like [Nelumbo nucifera]
Length=186

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 0/103 (0%)
 Frame = +2

Query  62   VAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDT  241
            VA   HVVG  +GWD S+D  +W+SG  F+VGD L F Y+    S+VEL S+   +SCD 
Sbjct  28   VAQVHHVVGDDRGWDSSSDIGAWSSGRIFRVGDNLWFAYSIAQESIVELRSKEELESCDV  87

Query  242  SSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            S+P+  ++ G D V L+  G+RYF  G   +C+QG+KL V  L
Sbjct  88   SNPIRMYTNGLDSVSLDVEGTRYFTSGRPENCKQGLKLNVEVL  130



>gb|EEC82872.1| hypothetical protein OsI_27745 [Oryza sativa Indica Group]
Length=177

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = +2

Query  38   IGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGS  214
            + A ++     A + VG   G WD  T++D W S   F+ GDQ+VF+Y+P  H VVE+ +
Sbjct  1    MAAAVLGTALGATYTVGAPSGSWDLRTNYDQWVSNINFRAGDQIVFKYSPAAHDVVEV-N  59

Query  215  ESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            ++ Y SC +SSP+ +F+ G+D + L   G+RYF CG  GHC  GMK+ V
Sbjct  60   KADYDSCSSSSPIATFNSGDDTIPLTAAGTRYFICGFNGHCTGGMKVAV  108



>gb|EEE68013.1| hypothetical protein OsJ_25976 [Oryza sativa Japonica Group]
Length=177

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = +2

Query  38   IGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGS  214
            + A ++     A + VG   G WD  T++D W S   F+ GDQ+VF+Y+P  H VVE+ +
Sbjct  1    MAAAVLGTALGATYTVGAPSGSWDLRTNYDQWVSNINFRAGDQIVFKYSPAAHDVVEV-N  59

Query  215  ESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            ++ Y SC +SSP+ +F+ G+D + L   G+RYF CG  GHC  GMK+ V
Sbjct  60   KADYDSCSSSSPIATFNSGDDTIPLTATGTRYFICGFNGHCTGGMKVAV  108



>gb|ADV57637.1| copper binding protein 2 [Gossypium hirsutum]
Length=171

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQ--HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            M VV++ A +  ++ AAQ  HVVGG +GWD S+D  SW+SG +F+VGD++ F Y     S
Sbjct  8    MAVVIMAASLGGKLGAAQVHHVVGGDRGWDVSSDVASWSSGRSFRVGDKIWFAYAAAQES  67

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            + E+ S   Y+SCD S+P+  ++ G D + L+  G RYF  G    C+ G+KL V  +
Sbjct  68   IAEVNSPEEYESCDVSNPIRMYTDGIDGIPLDGEGIRYFVSGKEESCKNGLKLHVEVM  125



>gb|KHG23308.1| hypothetical protein F383_28880 [Gossypium arboreum]
Length=171

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQ--HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            M VV++ A +  ++ AAQ  HVVGG +GWD S+D  SW+SG +F+VGD++ F Y     S
Sbjct  8    MAVVIMAASLGGKLGAAQVHHVVGGDRGWDVSSDVASWSSGRSFRVGDKIWFAYAAAQES  67

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            + E+ S   Y+SCD S+P+  ++ G D + L+  G RYF  G    C+ G+KL V  +
Sbjct  68   IAEVNSPEEYESCDVSNPIRMYTDGIDGIPLDGEGIRYFVSGKEESCKNGLKLHVEVM  125



>emb|CAD41463.3| OSJNBa0079A21.7 [Oryza sativa Japonica Group]
 gb|EAZ31523.1| hypothetical protein OsJ_15663 [Oryza sativa Japonica Group]
Length=181

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 63/100 (63%), Gaps = 1/100 (1%)
 Frame = +2

Query  74   QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
             + VG S GW    D+ +WA G TF +GD L+F+Y    HSVVE+ SE+ + SC  ++P+
Sbjct  25   DYTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPL  83

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
             S+  G  +V L + G+RYF CG+ GHC  GMKL VT  T
Sbjct  84   RSYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVTVAT  123



>gb|EMT06003.1| Stellacyanin [Aegilops tauschii]
Length=301

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 73/116 (63%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + ++++ +   M+     A H VG   G WD  T++  W S   F +GD+L F+Y+  +H
Sbjct  4    KALILITVVIAMLGMALGASHTVGAPDGSWDLRTNYSQWVSRIRFTIGDELKFQYSTAVH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +VVE+ S++ Y SC+ SSP+ SF  GNDVV L   G+RYF CG + HC+ GMK++V
Sbjct  64   NVVEV-SKTGYDSCNDSSPIASFPTGNDVVPLATVGTRYFICGVSRHCDAGMKVEV  118


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +2

Query  89   GSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPVNSFSG  268
            GS G D  +    WAS   F  GD+L F+Y+  +H+VVE+ S++ + SC+ SSPV +   
Sbjct  187  GSTGGD--SHVSQWASRIRFTTGDELKFQYSAAVHNVVEV-SKTEHDSCNGSSPVATSPT  243

Query  269  GNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            GNDVV L   G RYF CG  G C  GMK++V
Sbjct  244  GNDVVPLAAVGIRYFICGIPGCCNAGMKVEV  274



>ref|NP_001053468.1| Os04g0545600 [Oryza sativa Japonica Group]
 dbj|BAF15382.1| Os04g0545600 [Oryza sativa Japonica Group]
 dbj|BAG99604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=191

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +2

Query  77   HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPVN  256
            + VG S GW    D+ +WA G TF +GD L+F+Y    HSVVE+ SE+ + SC  ++P+ 
Sbjct  36   YTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPLR  94

Query  257  SFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLT  373
            S+  G  +V L + G+RYF CG+ GHC  GMKL VT  T
Sbjct  95   SYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVTVAT  133



>gb|EMS56683.1| Blue copper protein [Triticum urartu]
Length=128

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + ++V+ +   M+     A   VG   G WD  T++  W S   F  G +L F+Y+  +H
Sbjct  4    KALIVITVALTMLGTALGASRTVGAPDGSWDLQTNYSQWVSRIRFTTGGELKFQYSAAVH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            S+VE+ S++ Y SC+ S+P+ +F  GNDVV L   G+RYF CG +GHC+ GMK++V
Sbjct  64   SMVEV-SKTGYDSCNGSNPIATFPTGNDVVPLANVGTRYFICGVSGHCDAGMKVEV  118



>dbj|BAJ99404.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=168

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 76/114 (67%), Gaps = 2/114 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            +L +   AV+I   +AA + VG   G WD  T++D+WAS   F   DQ++F+Y+P  H++
Sbjct  8    LLALAAMAVVISTASAAIYNVGEPGGAWDLGTNYDAWASSRNFHTDDQIMFKYSPQAHNL  67

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +++ S++ Y SC+T+SP+ +++ GN +V L+   +RYF CG  GHC  GMK+K+
Sbjct  68   LQV-SKADYDSCNTASPLATYTSGNVIVTLSNNSTRYFICGFPGHCAGGMKVKI  120



>ref|XP_009130995.1| PREDICTED: mavicyanin-like [Brassica rapa]
 emb|CDX78296.1| BnaA03g02080D [Brassica napus]
Length=194

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+   L +  G ++  +  A  + VG + GWD S+D +SW  G  F VGD L+F+Y+   
Sbjct  8    LFIFNLCINFGILVTRRCNATTYFVGDTSGWDISSDLESWPLGKRFSVGDVLMFQYSSS-  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  ++ ++SC+T+ P+ +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  67   HSVYEVAKDN-FQSCNTTDPIRTFTNGNTTVALSKPGDRFFVCGNRLHCFAGMRLQV  122



>ref|XP_002319042.1| hypothetical protein POPTR_0013s03090g [Populus trichocarpa]
 ref|XP_006387480.1| hypothetical protein POPTR_0986s00200g [Populus trichocarpa]
 gb|EEE94965.1| hypothetical protein POPTR_0013s03090g [Populus trichocarpa]
 gb|ERP46394.1| hypothetical protein POPTR_0986s00200g [Populus trichocarpa]
Length=168

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R  +++ I AV +  + A +H+VG  +GW    ++ +WA G  F VGD LVF+Y PG H+
Sbjct  5    RIFMIIAIVAVFVPSILATEHMVGDKKGWTLGFNYQTWAQGKAFYVGDTLVFKYTPGAHN  64

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQG-MKLKVTTL  370
            V+ + + + ++ C  +  +   + GNDV+ L+ PG +++ C   GHCE G  KL +T L
Sbjct  65   VLSV-NGTGFEECKAADDIVPLTTGNDVITLSTPGKKWYICSVPGHCESGNQKLFITVL  122



>ref|NP_001060957.1| Os08g0137800 [Oryza sativa Japonica Group]
 dbj|BAF22871.1| Os08g0137800 [Oryza sativa Japonica Group]
 dbj|BAG88529.1| unnamed protein product [Oryza sativa Japonica Group]
Length=190

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +2

Query  71   AQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            A + VG   G WD  T++D W S   F+ GDQ+VF+Y+P  H VVE+ +++ Y SC +SS
Sbjct  25   ATYTVGAPSGSWDLRTNYDQWVSNINFRAGDQIVFKYSPAAHDVVEV-NKADYDSCSSSS  83

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            P+ +F+ G+D + L   G+RYF CG  GHC  GMK+ V
Sbjct  84   PIATFNSGDDTIPLTATGTRYFICGFNGHCTGGMKVAV  121



>ref|XP_004239759.1| PREDICTED: stellacyanin-like [Solanum lycopersicum]
Length=185

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
             +V+++ +++I   +A  ++VG + GWD STD D+W  G  FK+GD LVF+Y+  LHSV 
Sbjct  8    FVVLILISLIICSSSATNYIVGDNSGWDISTDLDTWLLGKKFKIGDVLVFQYS-SLHSVS  66

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            E+  E+ +  C+TS+ ++S   GN    L KPG RYF CG   HC  GMKL V
Sbjct  67   EVTKEN-FMGCNTSNVLDSSKNGNTTFILTKPGDRYFVCGNRLHCLGGMKLHV  118



>ref|XP_007026253.1| Copper binding protein 9, putative [Theobroma cacao]
 gb|EOY28875.1| Copper binding protein 9, putative [Theobroma cacao]
Length=183

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 74/118 (63%), Gaps = 2/118 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQ--HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            M +V++ A +  +   AQ  HVVGG +GWD S+D  SW+SG +F+VGD++ F Y+    S
Sbjct  8    MALVIMAASLGGKWVGAQVHHVVGGDRGWDPSSDVASWSSGRSFRVGDKIWFAYSAAQES  67

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            ++EL S+  Y+SCD S+P+  ++ G D + L+  G+RYF       C+ G+K+ V  L
Sbjct  68   IIELKSQDEYESCDVSNPIRMYTDGLDGIPLDGEGTRYFVSSKPESCKNGLKVNVEVL  125



>ref|XP_009612608.1| PREDICTED: uclacyanin-2-like [Nicotiana tomentosiformis]
Length=276

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 75/124 (60%), Gaps = 3/124 (2%)
 Frame = +2

Query  2    EANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRY  178
            E  + R +  + + A+++    A  + VG   G WD+++D  SWA+   F VGD++ F Y
Sbjct  11   EMAMLRLLSSLAVIAMVLGSAMATDYTVGSPNGGWDQTSDLQSWAASQKFFVGDKITFSY  70

Query  179  NPGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLK  358
             P  H+V+E+ +++ Y SCD ++P+  +SGG  V+ L   G RYF CGT GHC  GMKL+
Sbjct  71   APS-HTVLEV-TKAQYDSCDNTNPIAIYSGGMTVITLASVGKRYFICGTGGHCSSGMKLE  128

Query  359  VTTL  370
            V  L
Sbjct  129  VNIL  132



>emb|CAH67255.1| OSIGBa0101C23.7 [Oryza sativa Indica Group]
Length=181

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  74   QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
             + VG S GW    D+ +WA G TF +GD L+F+Y    HSVVE+ SE+ + SC  ++P+
Sbjct  25   DYTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPL  83

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
             S+  G  +V L + G+RYF CG+ GHC  GMKL VT
Sbjct  84   RSYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVT  120



>ref|XP_010513176.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=196

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = +2

Query  2    EANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYN  181
            ++N++  +L++V  A+    +    H VG S+GW  S D+D+WAS  TF VGD LVF Y 
Sbjct  5    KSNVFFTLLILV--ALFGGAIGRTVHKVGDSKGWTISVDYDAWASSKTFHVGDSLVFEYT  62

Query  182  PGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             G H V E+ + + ++ C+TS+P+  +  G+D + L KPG + F CG   HC+ G KL++
Sbjct  63   KGSHDVTEV-THNDFQLCETSNPLTRYETGSDTIVLTKPGLQQFICGIPSHCDFGQKLQI  121

Query  362  TTL  370
              L
Sbjct  122  HVL  124



>ref|XP_006447468.1| hypothetical protein CICLE_v10018339mg [Citrus clementina]
 gb|ESR60708.1| hypothetical protein CICLE_v10018339mg [Citrus clementina]
Length=221

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 3/102 (3%)
 Frame = +2

Query  68   AAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTS  244
            AA + VGG  G WD +TD  +WA+   F VGD L+F+Y P  H V E+ S+  Y SC TS
Sbjct  2    AANYTVGGPNGGWDTATDLRTWATSQKFLVGDNLIFQY-PSSHDVTEV-SKPDYDSCQTS  59

Query  245  SPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            + + S++ GN V+ L+ PG RYF CG  GHC  GMK+++  L
Sbjct  60   NKIQSYTDGNTVIPLSSPGKRYFICGAPGHCTVGMKVEIDAL  101



>gb|EAY95049.1| hypothetical protein OsI_16864 [Oryza sativa Indica Group]
Length=181

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  74   QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
             + VG S GW    D+ +WA G TF +GD L+F+Y    HSVVE+ SE+ + SC  ++P+
Sbjct  25   DYTVGDSSGWTTGVDYTAWARGKTFNIGDTLLFQYTSAGHSVVEV-SEADHTSCSAANPL  83

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
             S+  G  +V L + G+RYF CG+ GHC  GMKL VT
Sbjct  84   RSYKDGTTIVTLTRSGTRYFICGSTGHCGAGMKLTVT  120



>ref|XP_004133765.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 ref|XP_004155201.1| PREDICTED: blue copper protein-like [Cucumis sativus]
 gb|KGN56342.1| hypothetical protein Csa_3G116790 [Cucumis sativus]
Length=171

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = +2

Query  32   VVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELG  211
            V +  + +  V  A  +VGG+ GW +  D+D+WA+G  F VGD LVF Y  G HSV E+ 
Sbjct  8    VFVVLIAVRAVYGADIIVGGNSGWSQGVDYDTWAAGQKFNVGDALVFNYG-GSHSVDEV-  65

Query  212  SESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             E+ Y +C +SS + S +GG   + L+  G RYF C T GHC  GMKL+V  L
Sbjct  66   KEADYTACSSSSVIKSHTGGTTSIPLSAVGPRYFICSTIGHCASGMKLQVNVL  118



>dbj|BAD03003.1| putative blue copper binding protein [Oryza sativa Japonica Group]
 dbj|BAD03080.1| putative blue copper binding protein [Oryza sativa Japonica Group]
Length=187

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +2

Query  71   AQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            A + VG   G WD  T++D W S   F+ GDQ+VF+Y+P  H VVE+ +++ Y SC +SS
Sbjct  22   ATYTVGAPSGSWDLRTNYDQWVSNINFRAGDQIVFKYSPAAHDVVEV-NKADYDSCSSSS  80

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            P+ +F+ G+D + L   G+RYF CG  GHC  GMK+ V
Sbjct  81   PIATFNSGDDTIPLTATGTRYFICGFNGHCTGGMKVAV  118



>ref|XP_006445439.1| hypothetical protein CICLE_v10022525mg [Citrus clementina]
 ref|XP_006464835.1| PREDICTED: uclacyanin-2-like [Citrus sinensis]
 gb|ESR58679.1| hypothetical protein CICLE_v10022525mg [Citrus clementina]
 gb|KDO85490.1| hypothetical protein CISIN_1g030594mg [Citrus sinensis]
Length=175

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +2

Query  32   VVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELG  211
            ++I  ++   V A ++ VG + GW +  D+ SW SG TFKVGD LVF Y  GLH V  + 
Sbjct  5    LLILLLVAPAVYAVEYTVGDTSGWTQGFDYTSWVSGKTFKVGDVLVFNYG-GLHKVDRV-  62

Query  212  SESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            SES Y +C +S+ + S   GN  + L  PG++YF C TAGHC  GMKL VT +
Sbjct  63   SESDYNNCASSNALESHDDGNTRINLKAPGTQYFICPTAGHCPGGMKLAVTVV  115



>ref|XP_010484775.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=188

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+  +L++V  A+    V    H VG S GW +  D+D+WAS  TF+VGD L+F YN   
Sbjct  9    LFTSLLILV--ALFGVAVGGTIHKVGDSNGWTKMGDYDAWASSRTFQVGDSLLFTYNNNF  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H V E+ + + ++ C++S P+  ++ G+D + L KPG + F CG  GHC+ G KL++  L
Sbjct  67   HDVTEV-TYNDFEMCESSKPLMKYTSGSDSISLTKPGLKQFICGVPGHCKSGQKLQIHVL  125



>gb|EMT03203.1| Blue copper protein [Aegilops tauschii]
Length=176

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 1/113 (1%)
 Frame = +2

Query  5    ANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNP  184
            A +   +L V   AV++   +A  + VG   GW  STD+ SW SG  F VGD +VF+Y+ 
Sbjct  2    AAMKITLLAVAAMAVLLGTASAVTYNVGDQGGWTLSTDYSSWVSGKKFNVGDDIVFKYST  61

Query  185  GLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQ  343
              H++VE+ S++ Y SC T   +N+ + GNDV+ LN  G+RYF CG   HC  
Sbjct  62   PAHNLVEV-SKAGYDSCSTDGAINTLASGNDVITLNATGTRYFICGVPSHCSP  113



>gb|EMS56685.1| Mavicyanin [Triticum urartu]
Length=175

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLH  193
            + ++++ +   M+     A   VG   G WD  T++  W S      GD+L F+Y+  +H
Sbjct  4    KALILITVALTMLGTALGASRTVGAPDGSWDLQTNYSQWVSRIRLTTGDELKFQYSAAVH  63

Query  194  SVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            +VVE+ S++ Y SC+ SSP+ +F  GNDVV L   G+RYF CG +GHC+ GMK++V
Sbjct  64   NVVEV-SKTGYDSCNGSSPIATFPIGNDVVPLANVGTRYFICGVSGHCDAGMKVEV  118



>ref|XP_008653633.1| PREDICTED: mavicyanin-like [Zea mays]
Length=169

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +2

Query  68   AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            AA  +VG SQGW  + D+D WA G  F VGD LVF+Y  G H+VV+  + +++ +C  S+
Sbjct  30   AADLLVGDSQGWRLNVDYDEWADGKDFIVGDTLVFKYAKGQHTVVQ-ATAASFAACSQSN  88

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             + +++ G+D V LN  G  +F CG AGHCEQGMK  VT L
Sbjct  89   SLGTWASGDDRVPLNTSGQWWFFCGVAGHCEQGMKFGVTVL  129



>tpg|DAA36598.1| TPA: hypothetical protein ZEAMMB73_027469 [Zea mays]
Length=188

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R +L+V++  V +   +A  ++VG S GW    D+ +WA G  F +GD L F+Y+   HS
Sbjct  7    RRLLLVIVPLVAVVPASAKDYMVGDSSGWKSGVDYAAWAKGKPFAIGDTLSFQYS-SAHS  65

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            V+E+ SE+ + +C  S+P+ S  G +  + L K G+RYF CG  GHC  GMK+ +T
Sbjct  66   VLEV-SEADHGACSASNPLRSHQGQSTTIPLTKAGTRYFICGAPGHCASGMKVAIT  120



>ref|XP_002319041.1| hypothetical protein POPTR_0013s03110g [Populus trichocarpa]
 gb|EEE94964.1| hypothetical protein POPTR_0013s03110g [Populus trichocarpa]
Length=168

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R  +++ I AV +  + A +H+VG   GW    ++ +WA G  F VGD LVF+Y PG H+
Sbjct  5    RIFMIIAIVAVFVPSILATEHMVGDKTGWTLGFNYQTWAQGKAFYVGDTLVFKYTPGAHN  64

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQG-MKLKVTTL  370
            V+ + + + ++ C  +  +   + GNDV+ L+ PG +++ C   GHCE G  KL +T L
Sbjct  65   VLSV-NGTGFEECKAADDIVPLTTGNDVITLSTPGKKWYICSVPGHCESGNQKLFITVL  122



>gb|EMT28687.1| Mavicyanin [Aegilops tauschii]
Length=163

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +2

Query  50   MIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAY  226
            M+  V  A H VG   G WD  T++  WAS   F  GD+L F+Y+  +H+VVE+  ++ Y
Sbjct  3    MLGMVLGASHTVGAPAGSWDLQTNYTLWASRTRFTTGDELQFQYSTTVHNVVEV-RKAGY  61

Query  227  KSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             SC++SSP+ +F  G DVV L   G+RYF CG  GHC  GMK++V
Sbjct  62   DSCNSSSPIATFLTGKDVVPLAAIGTRYFICGVPGHCVAGMKVQV  106



>ref|XP_011021555.1| PREDICTED: mavicyanin [Populus euphratica]
Length=185

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 76/124 (61%), Gaps = 3/124 (2%)
 Frame = +2

Query  5    ANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDES--TDFDSWASGNTFKVGDQLVFRY  178
            A + R + ++    +M+E + AA + VGGS GW  S   D+  W++  TF+VGD ++F Y
Sbjct  2    ALVIRAVALLTAMTLMLELIHAAVYKVGGSAGWTASGNIDYKQWSATKTFQVGDVILFEY  61

Query  179  NPGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLK  358
            N   H+V+ + + + YK+C+TS+P+ +++ GND + +   G  +F CG  GHC+ G K+ 
Sbjct  62   NAQFHNVMRV-THAMYKACNTSAPIATYTTGNDSITIKTRGHHFFFCGVPGHCQAGQKVD  120

Query  359  VTTL  370
            +  L
Sbjct  121  INVL  124



>ref|NP_001149787.1| blue copper protein precursor [Zea mays]
 gb|ACG36799.1| blue copper protein precursor [Zea mays]
Length=192

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            R +L+V++  V +   +A  ++VG S GW    D+ +WA G  F +GD L F+Y+   HS
Sbjct  7    RRLLLVIVPLVAVVPASAKDYMVGDSSGWKSGVDYAAWAKGKPFAIGDTLSFQYS-SAHS  65

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            V+E+ SE+ + +C  S+P+ S  G +  + L K G+RYF CG  GHC  GMK+ +T
Sbjct  66   VLEV-SEADHGACSASNPLRSHQGQSTTIPLTKAGTRYFICGAPGHCASGMKVAIT  120



>ref|XP_009421430.1| PREDICTED: mavicyanin-like [Musa acuminata subsp. malaccensis]
Length=177

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  83   VGGSQGWDES--TDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPVN  256
            VGGS GW E     ++SWA  N F+V D L+F+YNPG  SV+ + +E+AYKSC+ +SP+ 
Sbjct  26   VGGSHGWVEHHHEKYNSWAERNRFQVNDTLLFKYNPGKDSVLVV-TETAYKSCNVTSPIQ  84

Query  257  SFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            S++ GN + K N  G  YF  G AGHC +G +L V  L
Sbjct  85   SYTDGNTIFKFNHSGPFYFISGAAGHCNRGQRLIVVVL  122



>ref|XP_007149946.1| hypothetical protein PHAVU_005G112600g [Phaseolus vulgaris]
 gb|ESW21940.1| hypothetical protein PHAVU_005G112600g [Phaseolus vulgaris]
Length=215

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = +2

Query  77   HVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
            ++VGG  G WD +++  SWAS   F VGD LVF+Y P  H VVE+ +++ Y SC  ++P+
Sbjct  25   YIVGGPNGGWDTNSNLQSWASSQIFSVGDSLVFQYPPN-HDVVEV-TKADYDSCQPTNPI  82

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             S++ G   + L  PG RYF CGT GHC QGMK++V
Sbjct  83   QSYNDGATAIPLTSPGQRYFICGTIGHCSQGMKVEV  118



>ref|XP_006449853.1| hypothetical protein CICLE_v10018260mg, partial [Citrus clementina]
 gb|ESR63093.1| hypothetical protein CICLE_v10018260mg, partial [Citrus clementina]
Length=126

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 65/101 (64%), Gaps = 2/101 (2%)
 Frame = +2

Query  59   QVAAAQ--HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKS  232
            Q AAAQ  HVVGG +GWD S+D  SW++G  F+ GD++   Y+P   S+ EL S+  Y+S
Sbjct  25   QWAAAQVHHVVGGDRGWDSSSDVASWSAGRVFRAGDKIWLAYSPAQESIAELQSKEEYES  84

Query  233  CDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKL  355
            CD S+P+  ++ G DV+ L+  G RYFA     +C+ G+ L
Sbjct  85   CDVSNPIRMYTDGLDVIPLDGEGIRYFASSKYDNCKNGLTL  125



>gb|KDP28869.1| hypothetical protein JCGZ_14640 [Jatropha curcas]
Length=192

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +2

Query  32   VVIGAVMIEQVAAAQHVVGGSQGWDE-STDFDSWASGNTFKVGDQLVFRYNPGLHSVVEL  208
            ++I  + I    AAQ++VG S GW     D+ +WASG TF VGD LVF Y+   H V E+
Sbjct  8    LLILLMAIPAAYAAQYIVGDSSGWTNFGVDYSTWASGKTFTVGDTLVFNYDGSTHKVDEV  67

Query  209  GSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             S+S Y SC +S+ + S   G+  +KL+K G+ YF C TAGHC  GMKL V
Sbjct  68   -SQSDYNSCSSSNAIESHDDGSTTIKLSKTGTIYFICPTAGHCSGGMKLAV  117



>ref|XP_004953983.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=220

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 60/103 (58%), Gaps = 1/103 (1%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
               AA+ + VG   GW    D+ SW +  TFKVGD LVF Y  GLH+VVE+ S + Y +C
Sbjct  22   STAAASSYTVGDGSGWTTGVDYTSWTASKTFKVGDSLVFNYAKGLHTVVEV-SAAEYMAC  80

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
              ++P+ S S G   V L  PG+ YF C   GHC  GMKL VT
Sbjct  81   TAANPLGSDSSGATTVPLKTPGTHYFVCSITGHCGAGMKLAVT  123



>ref|XP_009764625.1| PREDICTED: uclacyanin-3-like [Nicotiana sylvestris]
Length=276

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 75/125 (60%), Gaps = 3/125 (2%)
 Frame = +2

Query  2    EANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRY  178
            E  + R +  + + A+++    A  + VG   G WD+++D  SW +   F VGD++ F Y
Sbjct  11   EMAMLRLLSSLAVIAMVLGSAMATDYTVGSPNGGWDQTSDLQSWVASQKFFVGDKITFSY  70

Query  179  NPGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLK  358
             P  H+V+E+ +++ Y SCD ++P+  +SGG  V+ L   G RYF CGT GHC  GMKL+
Sbjct  71   APS-HTVLEV-TKAQYDSCDNTNPIAIYSGGMTVITLASVGKRYFICGTGGHCGSGMKLE  128

Query  359  VTTLT  373
            V  LT
Sbjct  129  VNILT  133



>ref|XP_008373105.1| PREDICTED: blue copper protein [Malus domestica]
Length=184

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVE  205
            LV+V+  VM+ +  A  + VG S GW    D+ +W SG TFKVGD LVF Y  G H+V E
Sbjct  7    LVLVVAMVMMPRCLATVYTVGDSSGWASGVDYSTWTSGKTFKVGDSLVFNYGSG-HTVDE  65

Query  206  LGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTLTG  376
            + ++S YK+C   + + S S G   + L   G+  + CG+ GHC  GMKL VT  +G
Sbjct  66   V-TDSDYKTCTVGNSITSDSSGTTTIPLKTAGTHNYICGSVGHCTMGMKLSVTVASG  121



>ref|XP_006360596.1| PREDICTED: early nodulin-20-like [Solanum tuberosum]
Length=257

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 79/122 (65%), Gaps = 4/122 (3%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            + + ++ +   A+++    A  + VGG  G WD+STD  +WA+  TF VGD L+F Y+P 
Sbjct  3    MLKMLMSLAAIAMLLGSAMATNYTVGGPNGGWDQSTDAQAWAASKTFFVGDNLIFSYSPS  62

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQ-GMKLKVT  364
             HSV+E+ +++++++C  ++P+  ++GG  V+ L   G RYF CGT GHC   GMKL++ 
Sbjct  63   -HSVLEV-TKASFETCQITAPIAIYTGGMTVITLASVGKRYFICGTGGHCNVGGMKLEIN  120

Query  365  TL  370
            TL
Sbjct  121  TL  122



>gb|EMT12765.1| Mavicyanin [Aegilops tauschii]
Length=163

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +2

Query  50   MIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAY  226
            M+     A H VG   G WD  T++  W S   F  GD+L F+Y+  + +VVE+ S++ Y
Sbjct  3    MLGTALGASHTVGEPDGSWDLQTNYSQWVSRIRFTTGDELKFQYSTAVRNVVEV-SKTGY  61

Query  227  KSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             SC+ SSP+ +F  GNDVV L   G+RYF CG +GHC+ GMK+KV
Sbjct  62   DSCNCSSPIATFPTGNDVVPLAIAGTRYFICGVSGHCDAGMKVKV  106



>gb|EMS59213.1| Blue copper protein [Triticum urartu]
Length=176

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 1/107 (1%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +L V   AV++   +A  + VG   GW  STD+ +W SG  F VGD +VF+Y+   H VV
Sbjct  8    LLAVAAMAVLLGSASAVTYNVGDQGGWALSTDYSNWVSGKKFNVGDDIVFKYSTPTHDVV  67

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQ  343
            E+ S++ Y SC T   +N+ + GNDV+ LN  G+RYF CG   HC  
Sbjct  68   EV-SKAGYDSCSTDGAINTLTSGNDVISLNATGTRYFICGVPNHCSP  113



>gb|AAR15424.1| Cu2+ plastocyanin-like [Sisymbrium irio]
Length=195

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 71/117 (61%), Gaps = 2/117 (2%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+     ++ G  +  +  A  + VG + GWD S+D +SW SG  F VGD L+F+Y+   
Sbjct  8    LFLFNFCIIFGISVTRRCNATTYFVGDTSGWDISSDLESWTSGKRFAVGDVLMFQYS-ST  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  +  +++C+T+ P+ +F+ GN  V L+KPG R+F C    HC  GMKL+V
Sbjct  67   HSVYEVAKDK-FQNCNTTDPIRTFTNGNTTVALSKPGDRFFVCRNRLHCFSGMKLQV  122



>gb|ACN54192.1| blue copper protein [Triticum aestivum]
Length=176

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 66/113 (58%), Gaps = 1/113 (1%)
 Frame = +2

Query  5    ANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNP  184
            A +   +L V   AV++   +A  + VG   GW  STD+ +W SG  F VGD +VF+Y+ 
Sbjct  2    AAMKITLLAVAAMAVLLGSASAVTYNVGDQGGWALSTDYSNWVSGKKFNVGDDIVFKYST  61

Query  185  GLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQ  343
              H VVE+ S++ Y SC T   +N+ + GNDV+ LN  G+RYF CG   HC  
Sbjct  62   PTHDVVEV-SKAGYDSCSTDGAINTLTSGNDVISLNATGTRYFICGVPNHCSP  113



>ref|XP_004252640.1| PREDICTED: mavicyanin-like [Solanum lycopersicum]
Length=153

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L   ++ +++  ++I    +  H VG  QGW    D+++WA    F VGD+L+F+Y  G 
Sbjct  3    LKALLVAIIVVNMVIVPTMSTDHFVGDDQGWKLKFDYNAWAESKEFHVGDKLIFKYKEGA  62

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H+V      +A++SC   + V   + GNDV+ L  PG +++ CG   HCEQGMK+ V  L
Sbjct  63   HNVYR-ADLAAFQSCVPGANVEPLTSGNDVIDLKTPGKKWYFCGINNHCEQGMKVSVNVL  121



>ref|XP_007038255.1| Cupredoxin superfamily protein, putative [Theobroma cacao]
 gb|EOY22756.1| Cupredoxin superfamily protein, putative [Theobroma cacao]
Length=293

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +2

Query  68   AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            AA +V+G + GWD STD DSWAS  +FKVGD L F+Y+   HSV E+  + +++ C+T+ 
Sbjct  131  AATYVIGDTSGWDISTDLDSWASDKSFKVGDVLSFQYS-SYHSVCEV-RKGSFERCNTTD  188

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             + +FS GN  V L+K G+RYF CG   HC  GMKL+V
Sbjct  189  TLKTFSNGNTTVTLSKAGARYFVCGNQLHCLGGMKLQV  226



>ref|NP_001047603.2| Os02g0653200 [Oryza sativa Japonica Group]
 dbj|BAD24983.1| putative uclacyanin 3 [Oryza sativa Japonica Group]
 gb|EAY86924.1| hypothetical protein OsI_08309 [Oryza sativa Indica Group]
 gb|EAZ24035.1| hypothetical protein OsJ_07765 [Oryza sativa Japonica Group]
 dbj|BAF09517.2| Os02g0653200 [Oryza sativa Japonica Group]
Length=202

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = +2

Query  74   QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPV  253
             + VG + GW    D+D+WA   TF VGD LVF+Y+  +H+V E+ S + Y +C  S+ +
Sbjct  27   DYTVGDTSGWSSGVDYDTWAKSKTFSVGDSLVFQYSM-MHTVAEV-SSADYSACSASNSI  84

Query  254  NSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
             S+S  N  + L KPG+RYF CGT+GHC  GMKL VT
Sbjct  85   QSYSDQNTKIALTKPGTRYFICGTSGHCSGGMKLAVT  121



>ref|XP_006467342.1| PREDICTED: early nodulin-like protein 2-like [Citrus sinensis]
 gb|KDO78430.1| hypothetical protein CISIN_1g030047mg [Citrus sinensis]
Length=183

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 7/121 (6%)
 Frame = +2

Query  29   VVVIGAVMIE-----QVAAAQ--HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPG  187
            +V+I AV +      Q AAAQ  HVVGG +GWD S+D  SW++G  F+ GD+++  Y+P 
Sbjct  10   LVMIMAVALSLGLGGQWAAAQVHHVVGGDRGWDSSSDVASWSAGRVFRAGDKILLAYSPA  69

Query  188  LHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
              S+ EL S+  Y+SC+ S+P+  ++ G DV+ L+  G  YF      +C+ G+KL V  
Sbjct  70   QESIAELQSKEEYESCNVSNPIRMYTDGLDVIPLDGEGIHYFVSSKYDNCKNGLKLHVNV  129

Query  368  L  370
            L
Sbjct  130  L  130



>ref|XP_010419426.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=188

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+  +L++V  A+    V    H VG S+GW    D+++WAS  TF+VGD LVF YN   
Sbjct  9    LFTSLLILV--ALFGVTVGGTVHKVGDSKGWTMMGDYETWASSRTFQVGDTLVFAYNNNF  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H V E+ + + ++ C++S P+  ++ G+D + L KPG + F CG  GHC  G KL++  L
Sbjct  67   HDVTEV-THNDFEKCESSKPLMKYTSGSDSISLTKPGLQQFICGVPGHCTSGQKLQIHVL  125



>ref|XP_003570004.1| PREDICTED: mavicyanin [Brachypodium distachyon]
Length=201

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = +2

Query  68   AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            A  H VG S GW    D+ +WAS  TFKVGD LVF+Y    H+V E+GS   Y +C  S+
Sbjct  22   AVDHTVGDSSGWASGVDYTTWASDKTFKVGDTLVFQYGAS-HNVAEVGSAD-YSACSASN  79

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             + SFS  +  + L KPG+RYF CG  GHC  GMKL V
Sbjct  80   SIQSFSDQDTKITLTKPGTRYFICGVTGHCAGGMKLAV  117



>dbj|BAK00233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=168

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  44   AVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSES  220
            AV+I   +AA + VG   G WD  T++D+WAS   F   DQ++F+Y+P  H+++++ S++
Sbjct  15   AVVISTASAAIYNVGEPGGAWDLGTNYDAWASSRNFHTDDQIMFKYSPQAHNLLQV-SKA  73

Query  221  AYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             Y SC+T+SP+ +++ GN +V L+   +RYF CG  GHC  GMK+K+
Sbjct  74   DYDSCNTASPLATYTSGNVIVTLSNNSTRYFICGFPGHCAGGMKVKI  120



>emb|CDY65237.1| BnaC09g47900D [Brassica napus]
Length=195

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
             Y C    +IG  +I +  A  + VG + GWD S+D +SW  G  F VGD L+F+Y+   
Sbjct  11   FYLC----IIGISVITRCNATTYFVGDTSGWDISSDLESWTLGKRFSVGDVLMFQYS-ST  65

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            HSV E+  ++ ++ C+++ P+ +F+ GN  V L+KPG R+F CG   HC  GM+L+V
Sbjct  66   HSVYEVAKDN-FQRCNSTDPIRTFTNGNTTVALSKPGDRFFLCGNRLHCFAGMRLQV  121



>gb|KFK26413.1| hypothetical protein AALP_AA8G245300 [Arabis alpina]
Length=180

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = +2

Query  26   LVVVIGAVMIEQVAAAQHVVGGSQGWDE--STDFDSWASGNTFKVGDQLVFRYNPGLHSV  199
            +VV +  VM+    AA + VG S GW    + D+  WAS  TF +GD + F YNP  H+V
Sbjct  5    IVVALAVVMLRLSEAAVYKVGDSAGWTTIANVDYKLWASTKTFHIGDTVKFEYNPQFHNV  64

Query  200  VELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            + + +   ++SC+TS+P+++F+ GND + L   G  +F CG  GHC  G KL +  L
Sbjct  65   MRV-THPMFRSCNTSNPISTFTTGNDSITLTNHGHHFFFCGVPGHCLAGQKLDLNVL  120



>ref|XP_010940769.1| PREDICTED: mavicyanin-like [Elaeis guineensis]
Length=169

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 64/113 (57%), Gaps = 1/113 (1%)
 Frame = +2

Query  32   VVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELG  211
            +V  A ++    A ++VVG   GW    +   WA G  F+VGD LVFRYNPG H V+ + 
Sbjct  14   MVAMATLLAMARATEYVVGDDMGWGLQVNCTDWARGKVFRVGDSLVFRYNPGNHHVLRVR  73

Query  212  SESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
                +++C+  S     + G+D V L+ PG R++ CG A HCE G KL +T L
Sbjct  74   GPD-FQACNKVSEKEPLASGDDAVPLSSPGKRWYVCGKAAHCESGQKLVITVL  125



>ref|XP_010523261.1| PREDICTED: stellacyanin [Tarenaya hassleriana]
Length=187

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            + ++ + A  I     A + VG   GWD STD DSW  G  F VGD LVF+Y+   HSV 
Sbjct  11   LWIICVIAATISICNGATYFVGDGSGWDISTDLDSWLLGKAFNVGDVLVFQYS-SPHSVY  69

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            E+ +   ++SC+T+ P+ +FSGGN  V L++ G R+F CG   HC  GM+L V
Sbjct  70   EV-TRDEFQSCNTTKPLRTFSGGNTTVSLSESGDRFFVCGNRLHCFAGMRLPV  121



>ref|XP_006347977.1| PREDICTED: uclacyanin-2-like [Solanum tuberosum]
Length=189

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +2

Query  68   AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            AA HVVGGS GW +S D+ +WA+  TF VGD LVF Y  G H V ++ S+  Y++C+T +
Sbjct  21   AANHVVGGSGGWTQSGDYTTWAAAETFTVGDTLVFNYG-GSHGV-DVISKDDYENCNTGN  78

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             + S+S G   +KL+K G  YF+C T GHC+ GMKL V
Sbjct  79   AIESYSDGATTIKLSKSGPMYFSCPTFGHCQSGMKLSV  116



>ref|XP_007152571.1| hypothetical protein PHAVU_004G141300g [Phaseolus vulgaris]
 ref|XP_007152572.1| hypothetical protein PHAVU_004G141300g [Phaseolus vulgaris]
 gb|ESW24565.1| hypothetical protein PHAVU_004G141300g [Phaseolus vulgaris]
 gb|ESW24566.1| hypothetical protein PHAVU_004G141300g [Phaseolus vulgaris]
Length=212

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + ++V++  +++   V    H VGG+ GWD  ++  +W+S  TF +GD LVF Y P +H 
Sbjct  11   KAIIVIIFTSILFRCVCGENHTVGGASGWDLRSNIQAWSSTTTFNIGDDLVFSYTP-VHD  69

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            VVE+ ++  Y +C  ++ + ++  G  V+ L   G+RYF CG  GHC+QG+KL V  L
Sbjct  70   VVEV-NQVGYDTCMIANALATYDDGETVIHLGGAGTRYFVCGRMGHCQQGLKLLVQVL  126



>ref|XP_010252614.1| PREDICTED: early nodulin-like protein 1 [Nelumbo nucifera]
Length=178

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQ--HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            +L+++I  ++ E+  AAQ  HVVG   GWD S++  +W+SG  F+VGD++ F Y+    S
Sbjct  13   LLMIIISVIVGEKRIAAQVHHVVGDDHGWDPSSNIGAWSSGRIFRVGDKIWFAYSVAQES  72

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            + EL S+  + SCDTS+P+  ++ G D +  +  G+ YF  G    C++G+K  V  L
Sbjct  73   IAELKSKEEFDSCDTSNPIRMYTDGLDSISFDAEGTHYFTSGRPESCKKGLKFNVEVL  130



>gb|ADE76474.1| unknown [Picea sitchensis]
Length=191

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
            E+ +A QH+VG  +GWD  ++F  WAS   F+VGD L F Y  G  SV+EL S   +++C
Sbjct  28   EECSAVQHLVGDDKGWDPHSNFHGWASRKIFRVGDNLWFAYASGDQSVLELKSRDEWEAC  87

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTT  367
            D S+P+  + GG D V L   GSR+F+ G    C+ GMKL +  
Sbjct  88   DISNPIRLYKGGVDSVPLANVGSRFFSSGRVEDCQNGMKLHINV  131



>ref|XP_010473933.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=197

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 5/116 (4%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVV  202
            +LV   G  + E V    H VG S+GW  S D+D+WAS  TF VGD LVF Y  G H V 
Sbjct  15   ILVARFGGAIGETV----HKVGDSKGWTISVDYDAWASSKTFHVGDSLVFEYTKGSHDVT  70

Query  203  ELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            E+ + + ++ C+TS+P+  +  G+D + L KPG + F CG   HC+ G KL++  L
Sbjct  71   EV-THNDFQLCETSNPLTRYETGSDTIVLTKPGLQQFLCGIPSHCDLGQKLQIHVL  125



>ref|XP_010513354.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=188

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L+  +L++V  A+    V    H VG S GW    D+++WAS  TF+VGD LVF YN   
Sbjct  9    LFTSLLILV--ALFGVAVGGTIHKVGDSNGWTMMGDYETWASSRTFQVGDSLVFAYNNNF  66

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H V E+ + + ++ C++S P+  ++ G+D + L KPG + F CG  GHC+ G KL++  L
Sbjct  67   HDVTEV-THNDFEMCESSKPLMRYTSGSDSITLTKPGLQQFICGVPGHCKSGQKLQIHVL  125



>ref|XP_002303545.1| hypothetical protein POPTR_0003s11780g [Populus trichocarpa]
 gb|EEE78524.1| hypothetical protein POPTR_0003s11780g [Populus trichocarpa]
Length=167

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            +  +++ I AV +  + A +H+VG + GW    D+ +WA+G  F VGD LVF+Y  G H+
Sbjct  6    KMFMIIAIVAVSVPSILATEHLVGDATGWKPGFDYGAWANGKEFHVGDTLVFKYRAGAHN  65

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQG-MKLKVTTL  370
            V+ +   + ++ C  +      S GNDV+ L+ PG +++ CG A HCE G  KL +T L
Sbjct  66   VLRVNG-TGFQECKAADDTVPLSSGNDVISLSTPGKKWYICGFAEHCESGNQKLAITVL  123



>ref|XP_010418740.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=197

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 74/123 (60%), Gaps = 2/123 (2%)
 Frame = +2

Query  2    EANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYN  181
            ++N++   L++++ A+    +    H VG S+GW  S D+D+WAS  TF VGD LVF Y 
Sbjct  5    KSNVFFTSLLILV-ALFGGAIGGTVHKVGDSKGWTISVDYDAWASSKTFHVGDSLVFEYT  63

Query  182  PGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             G H V E+ + + ++ C+TS+P+  +  G+D + L KPG + F CG   HC  G KL++
Sbjct  64   KGSHDVTEV-THNDFQLCETSNPLTRYETGSDTIVLTKPGLQQFLCGIPSHCYLGQKLQI  122

Query  362  TTL  370
              L
Sbjct  123  HVL  125



>ref|NP_001168456.1| uncharacterized protein LOC100382230 precursor [Zea mays]
 gb|ACN28286.1| unknown [Zea mays]
 gb|AFW64389.1| hypothetical protein ZEAMMB73_344098 [Zea mays]
Length=205

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
               AA  + VG   GW    D+ SWA+   FKVGD LVF Y  GLH+VVE+ S + Y +C
Sbjct  23   STAAATSYTVGDGSGWTTGVDYTSWAASKNFKVGDNLVFNYAKGLHTVVEV-SAAEYMAC  81

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
              ++P+ S S G   V L  PG+ YF C   GHC  GMKL VT
Sbjct  82   TAANPLGSDSSGATTVALRTPGTHYFVCSITGHCGAGMKLAVT  124



>ref|XP_002452517.1| hypothetical protein SORBIDRAFT_04g027290 [Sorghum bicolor]
 gb|EES05493.1| hypothetical protein SORBIDRAFT_04g027290 [Sorghum bicolor]
Length=218

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +2

Query  56   EQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSC  235
               AA  + VG   GW    D+ SWA+   FKVGD LVF Y  GLH+VVE+ S + Y +C
Sbjct  22   STAAATSYTVGDGSGWTTGVDYTSWAASKNFKVGDNLVFNYAKGLHTVVEV-SAAEYMAC  80

Query  236  DTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
              ++P+ S S G   V L  PG+ YF C   GHC  GMKL VT
Sbjct  81   TAANPLGSDSSGATTVALKTPGTHYFVCSITGHCGAGMKLAVT  123



>ref|XP_009386091.1| PREDICTED: mavicyanin-like [Musa acuminata subsp. malaccensis]
Length=193

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +2

Query  77   HVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPVN  256
            + VG  QGW    D+ +WASG TF V + L F+YN GLH++ E+G E+ YK+C  S+ + 
Sbjct  23   YTVGDLQGWVSGVDYTAWASGKTFNVDETLFFQYN-GLHTLAEVG-EADYKACSASNSIQ  80

Query  257  SFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            +++  +  + L +PGSRYF CGT GHC  GMKL VT
Sbjct  81   TYTDQSTKITLTRPGSRYFICGTPGHCSSGMKLAVT  116



>ref|XP_008437773.1| PREDICTED: basic blue protein [Cucumis melo]
Length=169

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +2

Query  32   VVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELG  211
            V +  + +  V  A  +VGGS GW++  ++D+WA+   F VGD LVF Y  G HSV E+ 
Sbjct  8    VFVVLIAVRAVYGADIIVGGSSGWNQGFNYDTWATQQKFTVGDTLVFDYG-GSHSVDEV-  65

Query  212  SESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            +E++Y +C +SS + S +GG   + L+  G RYF C T GHC  GMKL+V  L
Sbjct  66   NEASYTACSSSSVIKSHTGGTTSIPLSAVGPRYFICSTPGHCASGMKLQVNVL  118



>gb|EMT06001.1| Mavicyanin [Aegilops tauschii]
Length=225

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = +2

Query  50   MIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAY  226
            M+  V  A H VG   G WD  T++  WAS   F  GD+L F+Y+  +H+VVE+  ++ Y
Sbjct  3    MLGMVLGASHTVGAPAGSWDLQTNYTLWASRTRFTTGDELQFQYSTTVHNVVEV-RKAGY  61

Query  227  KSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
             SC++S+P+ +F  GNDVV L   G+RYF CG  GHC  GMK++V
Sbjct  62   DSCNSSNPIATFLTGNDVVPLAAIGTRYFICGVPGHCVAGMKVQV  106



>ref|XP_006647616.1| PREDICTED: blue copper protein-like [Oryza brachyantha]
Length=204

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +2

Query  68   AAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            A  + VG + GW    D+ +WA G +F VGD LVF+Y+  +H+V E+ S + Y +C  S+
Sbjct  24   AVDYTVGDTSGWTSGVDYGTWAKGKSFSVGDSLVFQYSM-MHTVAEV-SSADYSACSASN  81

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
             + S+S  N  + L KPG+RYF CGT+GHC  GMKL VT
Sbjct  82   SIQSYSDQNTKIALTKPGTRYFICGTSGHCSGGMKLAVT  120



>ref|XP_011101849.1| PREDICTED: mavicyanin-like [Sesamum indicum]
Length=186

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +2

Query  65   AAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTS  244
            AA  H VGG +GW+    +D WAS  TF  GD L+F Y+   H+V E+ +E+ Y+SC ++
Sbjct  19   AATTHTVGGLRGWNTGVKYDDWASEQTFATGDSLLFIYDIS-HTVDEV-TEADYQSCSSA  76

Query  245  SPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVT  364
            +P+NS+      V LN  G+RYF C  + HC QGMKL VT
Sbjct  77   NPINSYPSSPTTVPLNATGTRYFICPRSNHCSQGMKLTVT  116



>ref|XP_002466248.1| hypothetical protein SORBIDRAFT_01g004320 [Sorghum bicolor]
 gb|EER93246.1| hypothetical protein SORBIDRAFT_01g004320 [Sorghum bicolor]
Length=216

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 3/123 (2%)
 Frame = +2

Query  8    NLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWD--ESTDFDSWASGNTFKVGDQLVFRYN  181
            ++ +C+LV+ +G  M    +A  + VG + GW    + ++  W S   F+VGD + F Y 
Sbjct  5    DMKKCLLVLTLGLAMAATSSAVIYKVGDTSGWTILGNINYTDWTSKKNFRVGDTIEFTYP  64

Query  182  PGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            PG+H+V+E+  ++ Y SC  S+P+ + + G+D + +  PG R+F CG  GHC  G KL +
Sbjct  65   PGIHNVLEV-KKADYDSCTNSTPIATHTSGDDKIVIKSPGHRFFICGVPGHCAAGQKLNI  123

Query  362  TTL  370
              L
Sbjct  124  RVL  126



>ref|NP_001060959.1| Os08g0138400 [Oryza sativa Japonica Group]
 dbj|BAD03010.1| putative blue copper binding protein [Oryza sativa Japonica Group]
 dbj|BAF22873.1| Os08g0138400 [Oryza sativa Japonica Group]
 gb|EAZ05533.1| hypothetical protein OsI_27749 [Oryza sativa Indica Group]
Length=190

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 60/91 (66%), Gaps = 1/91 (1%)
 Frame = +2

Query  98   GWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSSPVNSFSGGND  277
            GWD  T++ SWAS  TF++ D+LVF+Y+   H VVE+ ++  Y SC  SSP+     G D
Sbjct  30   GWDLQTNYTSWASSITFRLDDKLVFKYSAAAHDVVEV-TKDGYLSCSASSPIAVHRTGED  88

Query  278  VVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
             V+L + G RYF CG  GHC+ GMKL+V TL
Sbjct  89   AVELGRLGRRYFICGVPGHCDAGMKLEVRTL  119



>ref|XP_009617386.1| PREDICTED: mavicyanin-like isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 6/121 (5%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAA------QHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRY  178
            + +LVV + A++      A       HVVG  +GWD S+D  SW+SG  F+VGD++ F Y
Sbjct  4    KKLLVVAVAAILFTAAMVAGADDQVHHVVGEDRGWDPSSDVASWSSGRVFRVGDKIWFTY  63

Query  179  NPGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLK  358
            +    SVVEL +E    SCD ++P+  ++ G D + L   G RYFA G    C+ G+K+ 
Sbjct  64   SAAQESVVELRNEEELASCDVTNPIKMYTDGLDKISLEGEGIRYFASGNTESCKNGLKIP  123

Query  359  V  361
            V
Sbjct  124  V  124



>gb|EAY92135.1| hypothetical protein OsI_13846 [Oryza sativa Indica Group]
Length=172

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +2

Query  62   VAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDT  241
             AA +H+VG   GW    D+ +WA+   F+VGD LVFRY    H+VVE+G    +K+C+ 
Sbjct  25   AAATEHMVGDGNGWILGFDYAAWAATKQFRVGDTLVFRYKGTNHTVVEVGGAD-FKACNK  83

Query  242  SSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            ++  N +S G D V L+K G R+F CG   HC + MKLK+T L
Sbjct  84   TASANEWSSGEDRVALDKEGRRWFFCGVGDHCAKNMKLKITVL  126



>dbj|BAK00909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = +2

Query  17   RCMLVVVIG-AVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            R +LV  +  A +      A + VG   G WD  T++  W S   F  GD+L F+Y    
Sbjct  6    RALLVAALTTAALFGTALGASYTVGAPAGSWDLRTNYTQWTSSIRFYTGDELRFQYPAAT  65

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H+VVE+ +++AY +C +SSP+ +F  GNDV+ L   G+RYF CG  GHC  GMK++V
Sbjct  66   HNVVEV-TKTAYDNCSSSSPIATFPSGNDVIPLAAVGTRYFICGLPGHCAGGMKIQV  121



>ref|XP_010242081.1| PREDICTED: uclacyanin-2-like [Nelumbo nucifera]
Length=271

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGLHS  196
            + + V+V+  ++   V+A  H VG + GW+  TD   W+S   F  GD LVF Y    H+
Sbjct  27   KAIFVIVLLLILFRCVSATDHTVGENAGWELGTDMQKWSSSRNFFTGDNLVFIYKQN-HN  85

Query  197  VVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            V+E+  E A+  C  + PV++++    V+ L++PG+RYF CG  GHC  G+K++V  L
Sbjct  86   VIEV-KEGAFTDCQITDPVHTYNDARTVIPLDRPGTRYFICGMPGHCALGLKIQVDVL  142



>ref|XP_008449431.1| PREDICTED: mavicyanin-like [Cucumis melo]
Length=183

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = +2

Query  44   AVMIEQVAAAQHVVGGSQGWDE--STDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSE  217
            A+    VAA  H VG S GW      D+  WAS   F VGD L+F+YN   H+V+++  E
Sbjct  17   ALFTLSVAATVHQVGDSSGWTTLIPVDYAKWASSQKFHVGDSLLFKYNNTFHNVLQVTQE  76

Query  218  SAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
              +K+C++SSP  S++ G D + L +PG+ YF CG  GHC+ G K++V
Sbjct  77   Q-FKACNSSSPAASYNSGADSIPLKRPGTFYFLCGFPGHCQLGQKVEV  123



>ref|XP_010513178.1| PREDICTED: mavicyanin-like [Camelina sativa]
Length=197

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 2/123 (2%)
 Frame = +2

Query  2    EANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYN  181
            ++N++   L++++ A+    +    H VG S+GW  S D+D+WAS  TF VGD LVF Y 
Sbjct  5    KSNVFFTSLLILV-ALFGGAIGGTVHKVGDSKGWTISVDYDAWASSKTFHVGDSLVFEYT  63

Query  182  PGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
               H V E+ + + +K C+ S P++ +  G+D + L KPG ++F CG   HC  G KL++
Sbjct  64   KDFHDVTEV-THNDFKLCEASKPLSRYQTGSDTIALTKPGIQHFICGFPRHCNFGQKLQI  122

Query  362  TTL  370
              L
Sbjct  123  HVL  125



>ref|NP_001053467.1| Os04g0545400 [Oryza sativa Japonica Group]
 emb|CAE04353.2| OSJNBb0038F03.17 [Oryza sativa Japonica Group]
 emb|CAD41462.3| OSJNBa0079A21.6 [Oryza sativa Japonica Group]
 dbj|BAF15381.1| Os04g0545400 [Oryza sativa Japonica Group]
 emb|CAH67254.1| OSIGBa0101C23.6 [Oryza sativa Indica Group]
Length=185

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 71/117 (61%), Gaps = 4/117 (3%)
 Frame = +2

Query  11   LYRCMLVVVIGAVMIEQVAAAQHVVGGSQGWDESTDFDSWASGNTFKVGDQLVFRYNPGL  190
            L  C+L+V  GA  + +  AA + VG S GWD S DF SW  G +F VGD LVF+Y+   
Sbjct  8    LAVCVLLVHGGAARVAE--AASYNVGNSAGWDISADFPSWLDGKSFFVGDTLVFQYSK-Y  64

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            H++ E+  E+ Y++C T+S V S S GN  V L  PG RYF CG   HC  GM+L V
Sbjct  65   HTLSEV-DEAGYRNCSTASAVLSSSDGNTTVALTAPGDRYFVCGNELHCLGGMRLHV  120



>ref|XP_010238910.1| PREDICTED: uncharacterized protein LOC100829219 [Brachypodium 
distachyon]
Length=340

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +2

Query  71   AQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYNPGLHSVVELGSESAYKSCDTSS  247
            A H VG   G WD  T+   WAS   F+ GDQLVF+Y    H+V+E+ S++ Y +C  SS
Sbjct  22   ATHTVGAPGGSWDLQTNHGQWASTVKFRAGDQLVFKYARAAHNVLEV-SKADYDACSNSS  80

Query  248  PVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
            P+ SF  GNDVV L   G+RYF CG  GHC+ GMK++V
Sbjct  81   PLASFHTGNDVVPLPAAGNRYFICGVPGHCDGGMKVRV  118



>ref|XP_002874308.1| hypothetical protein ARALYDRAFT_489473 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50567.1| hypothetical protein ARALYDRAFT_489473 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = +2

Query  17   RCMLVVVIGAVMIEQVAAAQHVVGGSQGWDE--STDFDSWASGNTFKVGDQLVFRYNPGL  190
            R +  +    VM+    AA + VG S GW    + D+  WAS  TF +GD ++F YNP  
Sbjct  4    RIVAALACMVVMLRLSEAAVYKVGDSAGWTTIANVDYKLWASTKTFHIGDTVLFEYNPQF  63

Query  191  HSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKVTTL  370
            H+V+ + +   Y+SC+TS P+++F+ GND + L   G  +F CG  GHC  G KL +  L
Sbjct  64   HNVMRV-THPMYRSCNTSKPISTFTTGNDSITLTNHGHHFFFCGVPGHCLAGQKLDLNVL  122



>ref|XP_004970211.1| PREDICTED: blue copper protein-like [Setaria italica]
Length=265

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +2

Query  5    ANLYRCMLVVVIGAVMIEQVAAAQHVVGGSQG-WDESTDFDSWASGNTFKVGDQLVFRYN  181
            A +   ++ V +   +I  V AA +VVG   G WD  TD+ SWA+  TF  GD L F YN
Sbjct  8    AEMKALLVCVTVALSLIHAVTAADYVVGNPAGGWDGRTDYKSWAAAQTFGPGDTLTFNYN  67

Query  182  PGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQGMKLKV  361
               H+V+E+ ++ A+++C T++P+   + G+  V L  PG+RYF CG  GHC  GMK+++
Sbjct  68   -SYHNVLEV-TKDAFEACTTTNPITFDNSGSTTVVLTMPGTRYFICGAPGHCLGGMKMEI  125



>ref|XP_002528414.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
 gb|EEF33956.1| Cucumber peeling cupredoxin, putative [Ricinus communis]
Length=183

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 72/128 (56%), Gaps = 12/128 (9%)
 Frame = +2

Query  23   MLVVVIGAVMIEQVAAAQ------------HVVGGSQGWDESTDFDSWASGNTFKVGDQL  166
            M V+ +G V+I  V+  +            HVVGG +GWD STD  SW++  TF+VGD++
Sbjct  7    MTVLALGVVLISVVSGGKWVEAADNNRVTHHVVGGDRGWDSSTDMGSWSAARTFRVGDRI  66

Query  167  VFRYNPGLHSVVELGSESAYKSCDTSSPVNSFSGGNDVVKLNKPGSRYFACGTAGHCEQG  346
             F Y+     + EL ++  Y+SCD S+P+  ++ G D + L + G RYF    +  C+ G
Sbjct  67   WFTYSMVQGRIAELRTKEEYESCDVSNPIRMYTDGLDAISLEQEGIRYFVSSDSNSCKNG  126

Query  347  MKLKVTTL  370
            +KL V  L
Sbjct  127  LKLHVEVL  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940