BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015F11 622 bp,

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002309001.2|  hypothetical protein POPTR_0006s07240g             302   4e-92   Populus trichocarpa [western balsam poplar]
ref|XP_002518263.1|  cation-transporting atpase plant, putative         298   1e-90   Ricinus communis
ref|XP_006366962.1|  PREDICTED: calcium-transporting ATPase 8, pl...    298   1e-90   
ref|XP_011020086.1|  PREDICTED: calcium-transporting ATPase 10, p...    296   5e-90   Populus euphratica
ref|XP_011020078.1|  PREDICTED: calcium-transporting ATPase 10, p...    296   6e-90   Populus euphratica
ref|XP_010323145.1|  PREDICTED: auto-inhibited Ca2 -transporting ...    296   8e-90   Solanum lycopersicum
ref|NP_001234817.1|  auto-inhibited Ca2 -transporting ATPase 10         296   8e-90   Solanum lycopersicum
emb|CDP12667.1|  unnamed protein product                                291   4e-89   Coffea canephora [robusta coffee]
ref|XP_009601429.1|  PREDICTED: calcium-transporting ATPase 8, pl...    293   5e-89   Nicotiana tomentosiformis
gb|KDO61969.1|  hypothetical protein CISIN_1g0433051mg                  285   2e-88   Citrus sinensis [Valencia orange]
gb|KDP30671.1|  hypothetical protein JCGZ_16227                         291   6e-88   Jatropha curcas
ref|XP_011017707.1|  PREDICTED: calcium-transporting ATPase 10, p...    289   2e-87   Populus euphratica
ref|XP_009757245.1|  PREDICTED: calcium-transporting ATPase 10, p...    289   2e-87   Nicotiana sylvestris
ref|XP_011017705.1|  PREDICTED: calcium-transporting ATPase 10, p...    289   2e-87   Populus euphratica
ref|XP_011017704.1|  PREDICTED: calcium-transporting ATPase 10, p...    289   2e-87   Populus euphratica
ref|XP_006372180.1|  hypothetical protein POPTR_0018s13650g             286   1e-86   Populus trichocarpa [western balsam poplar]
gb|EYU18198.1|  hypothetical protein MIMGU_mgv1a000743mg                285   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_006600472.1|  PREDICTED: calcium-transporting ATPase 8, pl...    283   3e-86   
ref|XP_002325251.2|  Calcium-transporting ATPase 8 family protein       286   4e-86   Populus trichocarpa [western balsam poplar]
ref|XP_006600468.1|  PREDICTED: calcium-transporting ATPase 8, pl...    284   1e-85   Glycine max [soybeans]
gb|KHN17641.1|  Calcium-transporting ATPase 10, plasma membrane-type    284   1e-85   Glycine soja [wild soybean]
ref|XP_007154697.1|  hypothetical protein PHAVU_003G140200g             284   1e-85   Phaseolus vulgaris [French bean]
ref|XP_003549287.1|  PREDICTED: calcium-transporting ATPase 8, pl...    284   2e-85   Glycine max [soybeans]
ref|XP_010094240.1|  Calcium-transporting ATPase 10, plasma membr...    284   2e-85   Morus notabilis
gb|KHN22652.1|  Calcium-transporting ATPase 8, plasma membrane-type     283   2e-85   Glycine soja [wild soybean]
ref|XP_011094123.1|  PREDICTED: calcium-transporting ATPase 10, p...    283   3e-85   Sesamum indicum [beniseed]
ref|XP_011094128.1|  PREDICTED: calcium-transporting ATPase 10, p...    283   3e-85   Sesamum indicum [beniseed]
ref|XP_006593507.1|  PREDICTED: calcium-transporting ATPase 8, pl...    281   8e-85   Glycine max [soybeans]
ref|XP_003543731.1|  PREDICTED: calcium-transporting ATPase 8, pl...    281   1e-84   Glycine max [soybeans]
gb|KCW80852.1|  hypothetical protein EUGRSUZ_C02215                     281   2e-84   Eucalyptus grandis [rose gum]
ref|XP_006453219.1|  hypothetical protein CICLE_v10007305mg             281   2e-84   Citrus clementina
ref|XP_010048572.1|  PREDICTED: calcium-transporting ATPase 10, p...    280   3e-84   Eucalyptus grandis [rose gum]
ref|XP_010048570.1|  PREDICTED: calcium-transporting ATPase 10, p...    280   3e-84   Eucalyptus grandis [rose gum]
ref|XP_010046911.1|  PREDICTED: calcium-transporting ATPase 8, pl...    280   4e-84   Eucalyptus grandis [rose gum]
ref|XP_010687432.1|  PREDICTED: calcium-transporting ATPase 10, p...    278   2e-83   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010687434.1|  PREDICTED: calcium-transporting ATPase 10, p...    278   3e-83   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008223854.1|  PREDICTED: calcium-transporting ATPase 10, p...    277   4e-83   Prunus mume [ume]
gb|KCW77157.1|  hypothetical protein EUGRSUZ_D01503                     277   4e-83   Eucalyptus grandis [rose gum]
ref|XP_010536881.1|  PREDICTED: calcium-transporting ATPase 8, pl...    276   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_010046915.1|  PREDICTED: calcium-transporting ATPase 8, pl...    275   2e-82   Eucalyptus grandis [rose gum]
ref|XP_003533744.1|  PREDICTED: calcium-transporting ATPase 8, pl...    275   2e-82   Glycine max [soybeans]
ref|XP_007227032.1|  hypothetical protein PRUPE_ppa000670mg             275   2e-82   Prunus persica
emb|CBI17890.3|  unnamed protein product                                275   2e-82   Vitis vinifera
ref|XP_002262829.2|  PREDICTED: calcium-transporting ATPase 10, p...    275   2e-82   Vitis vinifera
ref|XP_007227033.1|  hypothetical protein PRUPE_ppa000670mg             275   3e-82   Prunus persica
ref|XP_007014494.1|  Autoinhibited Ca(2+)-ATPase 10 isoform 1           275   3e-82   Theobroma cacao [chocolate]
ref|XP_006585663.1|  PREDICTED: calcium-transporting ATPase 9, pl...    274   6e-82   Glycine max [soybeans]
gb|KHN38078.1|  Calcium-transporting ATPase 9, plasma membrane-type     273   8e-82   Glycine soja [wild soybean]
ref|XP_006597086.1|  PREDICTED: calcium-transporting ATPase 9, pl...    273   9e-82   Glycine max [soybeans]
ref|XP_004486584.1|  PREDICTED: calcium-transporting ATPase 9, pl...    273   2e-81   Cicer arietinum [garbanzo]
ref|XP_006595201.1|  PREDICTED: calcium-transporting ATPase 9, pl...    272   3e-81   Glycine max [soybeans]
gb|KEH39694.1|  calcium-transporting ATPase 9, plasma membrane-ty...    270   4e-81   Medicago truncatula
ref|XP_006598389.1|  PREDICTED: calcium-transporting ATPase 8, pl...    271   4e-81   
gb|KHN31858.1|  Calcium-transporting ATPase 9, plasma membrane-type     271   5e-81   Glycine soja [wild soybean]
ref|XP_010048692.1|  PREDICTED: calcium-transporting ATPase 8, pl...    270   7e-81   Eucalyptus grandis [rose gum]
gb|KJB21987.1|  hypothetical protein B456_004G024800                    270   1e-80   Gossypium raimondii
gb|KHN22385.1|  Calcium-transporting ATPase 9, plasma membrane-type     273   1e-80   Glycine soja [wild soybean]
ref|XP_010276717.1|  PREDICTED: calcium-transporting ATPase 10, p...    270   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_008227946.1|  PREDICTED: calcium-transporting ATPase 9, pl...    270   2e-80   Prunus mume [ume]
gb|KJB21991.1|  hypothetical protein B456_004G024800                    269   2e-80   Gossypium raimondii
gb|EPS66913.1|  hypothetical protein M569_07863                         270   2e-80   Genlisea aurea
ref|XP_004167733.1|  PREDICTED: calcium-transporting ATPase 8, pl...    268   2e-80   
gb|KJB21985.1|  hypothetical protein B456_004G024800                    269   3e-80   Gossypium raimondii
gb|KJB21986.1|  hypothetical protein B456_004G024800                    269   3e-80   Gossypium raimondii
gb|KJB21990.1|  hypothetical protein B456_004G024800                    269   3e-80   Gossypium raimondii
gb|KJB21993.1|  hypothetical protein B456_004G024800                    269   4e-80   Gossypium raimondii
ref|XP_008227947.1|  PREDICTED: calcium-transporting ATPase 9, pl...    266   6e-80   
gb|AES65356.2|  calcium-transporting ATPase 8, plasma membrane-ty...    268   7e-80   Medicago truncatula
ref|XP_004150387.1|  PREDICTED: calcium-transporting ATPase 10, p...    268   1e-79   Cucumis sativus [cucumbers]
gb|AES65357.2|  calcium-transporting ATPase 8, plasma membrane-ty...    267   1e-79   Medicago truncatula
ref|XP_008450934.1|  PREDICTED: calcium-transporting ATPase 10, p...    267   1e-79   Cucumis melo [Oriental melon]
ref|XP_007142130.1|  hypothetical protein PHAVU_008G255200g             267   2e-79   Phaseolus vulgaris [French bean]
gb|KJB21984.1|  hypothetical protein B456_004G024800                    266   2e-79   Gossypium raimondii
gb|KJB21983.1|  hypothetical protein B456_004G024800                    266   2e-79   Gossypium raimondii
ref|XP_003595106.1|  Plasma membrane calcium-transporting ATPase        267   3e-79   
ref|XP_003595105.1|  Plasma membrane calcium-transporting ATPase        266   3e-79   
ref|XP_007217082.1|  hypothetical protein PRUPE_ppa000581mg             266   4e-79   Prunus persica
ref|XP_008227944.1|  PREDICTED: calcium-transporting ATPase 9, pl...    266   5e-79   Prunus mume [ume]
dbj|BAF00961.1|  Ca2+-transporting ATPase like protein                  259   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488018.1|  PREDICTED: calcium-transporting ATPase 8, pl...    265   1e-78   Cicer arietinum [garbanzo]
ref|XP_009333971.1|  PREDICTED: calcium-transporting ATPase 9, pl...    264   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_009340519.1|  PREDICTED: calcium-transporting ATPase 9, pl...    264   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_006582993.1|  PREDICTED: calcium-transporting ATPase 9, pl...    264   2e-78   Glycine max [soybeans]
gb|KHN39354.1|  Calcium-transporting ATPase 9, plasma membrane-type     264   2e-78   Glycine soja [wild soybean]
ref|XP_011467548.1|  PREDICTED: calcium-transporting ATPase 9, pl...    264   3e-78   Fragaria vesca subsp. vesca
gb|KEH28612.1|  calcium-transporting ATPase 8, plasma membrane-ty...    262   9e-78   Medicago truncatula
gb|KEH28611.1|  calcium-transporting ATPase 8, plasma membrane-ty...    261   1e-77   Medicago truncatula
ref|XP_009343847.1|  PREDICTED: calcium-transporting ATPase 10, p...    261   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_010913722.1|  PREDICTED: calcium-transporting ATPase 8, pl...    261   2e-77   Elaeis guineensis
ref|XP_010913719.1|  PREDICTED: calcium-transporting ATPase 8, pl...    261   2e-77   Elaeis guineensis
ref|XP_010545613.1|  PREDICTED: calcium-transporting ATPase 9, pl...    261   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_006281735.1|  hypothetical protein CARUB_v10027891mg             261   2e-77   Capsella rubella
ref|XP_006427751.1|  hypothetical protein CICLE_v10024770mg             261   3e-77   Citrus clementina
ref|XP_009340518.1|  PREDICTED: calcium-transporting ATPase 9, pl...    261   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_009359960.1|  PREDICTED: calcium-transporting ATPase 10, p...    261   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_009333970.1|  PREDICTED: calcium-transporting ATPase 9, pl...    261   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_007138755.1|  hypothetical protein PHAVU_009G234600g             260   4e-77   Phaseolus vulgaris [French bean]
ref|XP_009359959.1|  PREDICTED: calcium-transporting ATPase 10, p...    260   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_006427752.1|  hypothetical protein CICLE_v10024770mg             260   6e-77   Citrus clementina
gb|KCW44504.1|  hypothetical protein EUGRSUZ_L019901                    248   7e-77   Eucalyptus grandis [rose gum]
ref|NP_194719.1|  calcium-transporting ATPase 10                        259   7e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033032.1|  PREDICTED: calcium-transporting ATPase 9, pl...    259   8e-77   Populus euphratica
ref|XP_011033031.1|  PREDICTED: calcium-transporting ATPase 9, pl...    259   1e-76   Populus euphratica
ref|XP_008360507.1|  PREDICTED: calcium-transporting ATPase 8, pl...    258   1e-76   
ref|XP_009349647.1|  PREDICTED: calcium-transporting ATPase 9, pl...    259   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_002867382.1|  autoinhibited Ca2+-ATPase 10                       258   2e-76   Arabidopsis lyrata subsp. lyrata
ref|XP_008391559.1|  PREDICTED: calcium-transporting ATPase 10, p...    258   2e-76   Malus domestica [apple tree]
ref|XP_008380287.1|  PREDICTED: calcium-transporting ATPase 9, pl...    258   2e-76   Malus domestica [apple tree]
gb|KCW44503.1|  hypothetical protein EUGRSUZ_L019901                    248   3e-76   Eucalyptus grandis [rose gum]
ref|XP_008342501.1|  PREDICTED: calcium-transporting ATPase 9, pl...    257   3e-76   Malus domestica [apple tree]
ref|XP_002315383.2|  an N-terminal calmodulin binding autoinhibit...    258   3e-76   Populus trichocarpa [western balsam poplar]
ref|XP_008781797.1|  PREDICTED: calcium-transporting ATPase 8, pl...    258   4e-76   Phoenix dactylifera
emb|CDY46716.1|  BnaC07g42210D                                          258   4e-76   Brassica napus [oilseed rape]
ref|XP_010451807.1|  PREDICTED: calcium-transporting ATPase 8, pl...    257   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_004507012.1|  PREDICTED: calcium-transporting ATPase 9, pl...    257   6e-76   
ref|XP_002866184.1|  predicted protein                                  257   7e-76   Arabidopsis lyrata subsp. lyrata
ref|XP_010483208.1|  PREDICTED: calcium-transporting ATPase 8, pl...    256   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010443383.1|  PREDICTED: calcium-transporting ATPase 8, pl...    256   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002310944.2|  an N-terminal calmodulin binding autoinhibit...    256   8e-76   Populus trichocarpa [western balsam poplar]
emb|CDY43534.1|  BnaA01g07100D                                          256   1e-75   Brassica napus [oilseed rape]
gb|KCW44502.1|  hypothetical protein EUGRSUZ_L019901                    248   1e-75   Eucalyptus grandis [rose gum]
emb|CDY20693.1|  BnaA02g08330D                                          256   1e-75   Brassica napus [oilseed rape]
ref|XP_006492040.1|  PREDICTED: calcium-transporting ATPase 9, pl...    256   1e-75   Citrus sinensis [Valencia orange]
ref|XP_006401244.1|  hypothetical protein EUTSA_v10012523mg             256   2e-75   Eutrema salsugineum
ref|XP_006401243.1|  hypothetical protein EUTSA_v10012523mg             255   2e-75   Eutrema salsugineum
ref|XP_009126900.1|  PREDICTED: calcium-transporting ATPase 8, pl...    256   2e-75   Brassica rapa
emb|CDY30184.1|  BnaA03g49860D                                          255   2e-75   Brassica napus [oilseed rape]
dbj|BAH20100.1|  AT5G57110                                              255   2e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CAB43665.1|  Ca2+-transporting ATPase-like protein                  255   2e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68595.1|  BnaC01g08580D                                          255   2e-75   Brassica napus [oilseed rape]
ref|XP_009137874.1|  PREDICTED: calcium-transporting ATPase 10, p...    255   2e-75   Brassica rapa
ref|XP_009349648.1|  PREDICTED: calcium-transporting ATPase 9, pl...    255   3e-75   Pyrus x bretschneideri [bai li]
ref|NP_851200.1|  calcium-transporting ATPase 8                         255   3e-75   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66449.1|  hypothetical protein M569_08327                         250   3e-75   Genlisea aurea
dbj|BAA97361.1|  Ca2+-transporting ATPase-like protein                  255   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299792.1|  PREDICTED: calcium-transporting ATPase 8, pl...    255   3e-75   Fragaria vesca subsp. vesca
ref|XP_010929325.1|  PREDICTED: calcium-transporting ATPase 8, pl...    254   3e-75   Elaeis guineensis
gb|KDP34443.1|  hypothetical protein JCGZ_11914                         254   4e-75   Jatropha curcas
ref|XP_002275074.2|  PREDICTED: calcium-transporting ATPase 9, pl...    254   5e-75   Vitis vinifera
ref|XP_010655160.1|  PREDICTED: calcium-transporting ATPase 9, pl...    254   5e-75   Vitis vinifera
ref|XP_010109302.1|  Calcium-transporting ATPase 9, plasma membra...    254   6e-75   Morus notabilis
ref|XP_010655162.1|  PREDICTED: calcium-transporting ATPase 9, pl...    254   6e-75   Vitis vinifera
ref|NP_001169407.1|  uncharacterized protein LOC100383276               249   7e-75   Zea mays [maize]
ref|XP_008801513.1|  PREDICTED: calcium-transporting ATPase 8, pl...    252   7e-75   Phoenix dactylifera
ref|XP_009128358.1|  PREDICTED: calcium-transporting ATPase 10, p...    253   1e-74   Brassica rapa
ref|XP_010928700.1|  PREDICTED: calcium-transporting ATPase 8, pl...    253   1e-74   Elaeis guineensis
ref|XP_002514375.1|  cation-transporting atpase plant, putative         253   1e-74   
emb|CBI25301.3|  unnamed protein product                                253   1e-74   Vitis vinifera
emb|CDY32902.1|  BnaC02g11860D                                          253   1e-74   Brassica napus [oilseed rape]
ref|XP_002325252.2|  hypothetical protein POPTR_0018s13660g             253   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_007023813.1|  Autoinhibited Ca(2+)-ATPase 9 isoform 4            253   2e-74   Theobroma cacao [chocolate]
ref|XP_009128366.1|  PREDICTED: calcium-transporting ATPase 10, p...    253   2e-74   Brassica rapa
ref|XP_009128346.1|  PREDICTED: calcium-transporting ATPase 10, p...    253   2e-74   Brassica rapa
ref|XP_008801512.1|  PREDICTED: calcium-transporting ATPase 8, pl...    253   2e-74   Phoenix dactylifera
ref|XP_007023810.1|  Autoinhibited Ca(2+)-ATPase 9 isoform 1            253   2e-74   Theobroma cacao [chocolate]
ref|XP_007023812.1|  Autoinhibited Ca(2+)-ATPase 9 isoform 3            253   2e-74   Theobroma cacao [chocolate]
ref|XP_010927267.1|  PREDICTED: calcium-transporting ATPase 8, pl...    252   2e-74   Elaeis guineensis
ref|XP_009385903.1|  PREDICTED: calcium-transporting ATPase 10, p...    252   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927266.1|  PREDICTED: calcium-transporting ATPase 8, pl...    252   3e-74   Elaeis guineensis
emb|CDY19574.1|  BnaA05g19820D                                          246   4e-74   Brassica napus [oilseed rape]
gb|KDO47130.1|  hypothetical protein CISIN_1g04209132mg                 241   4e-74   Citrus sinensis [Valencia orange]
ref|XP_010433051.1|  PREDICTED: calcium-transporting ATPase 10, p...    251   5e-74   Camelina sativa [gold-of-pleasure]
emb|CDY38264.1|  BnaA10g11120D                                          251   6e-74   Brassica napus [oilseed rape]
ref|XP_009120228.1|  PREDICTED: calcium-transporting ATPase 8, pl...    251   6e-74   Brassica rapa
gb|KJB56395.1|  hypothetical protein B456_009G118300                    250   7e-74   Gossypium raimondii
gb|KJB56394.1|  hypothetical protein B456_009G118300                    249   9e-74   Gossypium raimondii
ref|XP_010041252.1|  PREDICTED: calcium-transporting ATPase 9, pl...    248   1e-73   Eucalyptus grandis [rose gum]
gb|KJB56396.1|  hypothetical protein B456_009G118300                    249   2e-73   Gossypium raimondii
ref|XP_006285159.1|  hypothetical protein CARUB_v10006503mg             249   2e-73   Capsella rubella
gb|KJB56391.1|  hypothetical protein B456_009G118300                    249   3e-73   Gossypium raimondii
ref|XP_010541090.1|  PREDICTED: calcium-transporting ATPase 10, p...    249   4e-73   Tarenaya hassleriana [spider flower]
ref|XP_006412795.1|  hypothetical protein EUTSA_v10024281mg             249   5e-73   Eutrema salsugineum
ref|XP_009414910.1|  PREDICTED: calcium-transporting ATPase 8, pl...    249   5e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412793.1|  hypothetical protein EUTSA_v10024281mg             249   5e-73   Eutrema salsugineum
tpg|DAA48121.1|  TPA: hypothetical protein ZEAMMB73_416489              249   6e-73   Zea mays [maize]
ref|XP_010447798.1|  PREDICTED: calcium-transporting ATPase 10, p...    248   7e-73   Camelina sativa [gold-of-pleasure]
ref|XP_011072737.1|  PREDICTED: calcium-transporting ATPase 9, pl...    248   7e-73   Sesamum indicum [beniseed]
ref|XP_006406305.1|  hypothetical protein EUTSA_v10019954mg             248   1e-72   Eutrema salsugineum
ref|XP_008799456.1|  PREDICTED: calcium-transporting ATPase 8, pl...    247   1e-72   Phoenix dactylifera
emb|CDY53981.1|  BnaC09g53480D                                          248   1e-72   Brassica napus [oilseed rape]
emb|CDY37311.1|  BnaA01g25310D                                          248   1e-72   Brassica napus [oilseed rape]
ref|XP_009109767.1|  PREDICTED: calcium-transporting ATPase 9, pl...    248   1e-72   Brassica rapa
emb|CDY50072.1|  BnaC05g30810D                                          247   2e-72   Brassica napus [oilseed rape]
emb|CDY19575.1|  BnaA05g19830D                                          247   2e-72   Brassica napus [oilseed rape]
emb|CDX82212.1|  BnaA03g36090D                                          247   2e-72   Brassica napus [oilseed rape]
gb|EYU21222.1|  hypothetical protein MIMGU_mgv1a000501mg                247   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_008799453.1|  PREDICTED: calcium-transporting ATPase 8, pl...    247   2e-72   Phoenix dactylifera
ref|XP_010696088.1|  PREDICTED: calcium-transporting ATPase 9, pl...    247   3e-72   Beta vulgaris subsp. vulgaris [Swiss chard]
tpg|DAA36132.1|  TPA: hypothetical protein ZEAMMB73_748084              246   3e-72   Zea mays [maize]
tpg|DAA36133.1|  TPA: hypothetical protein ZEAMMB73_748084              246   3e-72   Zea mays [maize]
ref|XP_009145511.1|  PREDICTED: calcium-transporting ATPase 9, pl...    246   3e-72   Brassica rapa
ref|XP_009135736.1|  PREDICTED: calcium-transporting ATPase 9, pl...    246   4e-72   Brassica rapa
ref|XP_010445063.1|  PREDICTED: calcium-transporting ATPase 10, p...    238   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009135735.1|  PREDICTED: calcium-transporting ATPase 9, pl...    246   4e-72   Brassica rapa
ref|XP_002883291.1|  Ca2+-transporting ATPase                           246   4e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_002445842.1|  hypothetical protein SORBIDRAFT_07g026810          246   5e-72   Sorghum bicolor [broomcorn]
ref|XP_006296870.1|  hypothetical protein CARUB_v10012867mg             246   6e-72   Capsella rubella
ref|XP_010488101.1|  PREDICTED: calcium-transporting ATPase 9, pl...    246   6e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008789606.1|  PREDICTED: calcium-transporting ATPase 8, pl...    245   6e-72   Phoenix dactylifera
ref|XP_008668924.1|  PREDICTED: calcium-transporting ATPase 8, pl...    245   8e-72   Zea mays [maize]
ref|XP_010466338.1|  PREDICTED: calcium-transporting ATPase 9, pl...    245   8e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010509827.1|  PREDICTED: calcium-transporting ATPase 9, pl...    245   8e-72   Camelina sativa [gold-of-pleasure]
emb|CDY27537.1|  BnaC01g32200D                                          245   9e-72   Brassica napus [oilseed rape]
gb|KGN45423.1|  Autoinhibited calcium ATPase                            245   1e-71   Cucumis sativus [cucumbers]
emb|CDY32412.1|  BnaC03g41960D                                          245   1e-71   Brassica napus [oilseed rape]
ref|XP_004141743.1|  PREDICTED: calcium-transporting ATPase 9, pl...    245   1e-71   
ref|XP_004159010.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-tran...    245   1e-71   
ref|XP_009386789.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-tran...    243   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845776.1|  hypothetical protein AMTR_s00019p00251600          244   2e-71   
gb|KCW53956.1|  hypothetical protein EUGRSUZ_J031612                    240   2e-71   Eucalyptus grandis [rose gum]
ref|NP_188755.2|  calcium-transporting ATPase 9                         244   3e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01709.1|  Ca2+-transporting ATPase                               243   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010063652.1|  PREDICTED: calcium-transporting ATPase 9, pl...    243   4e-71   Eucalyptus grandis [rose gum]
gb|KCW70887.1|  hypothetical protein EUGRSUZ_F04017                     243   4e-71   Eucalyptus grandis [rose gum]
gb|KFK39423.1|  hypothetical protein AALP_AA3G243100                    243   5e-71   Arabis alpina [alpine rockcress]
ref|XP_010063651.1|  PREDICTED: calcium-transporting ATPase 9, pl...    243   6e-71   Eucalyptus grandis [rose gum]
ref|XP_010063650.1|  PREDICTED: calcium-transporting ATPase 9, pl...    243   6e-71   Eucalyptus grandis [rose gum]
ref|XP_008663568.1|  PREDICTED: calcium-transporting ATPase 8, pl...    243   7e-71   Zea mays [maize]
ref|XP_009594203.1|  PREDICTED: calcium-transporting ATPase 9, pl...    241   2e-70   Nicotiana tomentosiformis
ref|XP_004973946.1|  PREDICTED: calcium-transporting ATPase 9, pl...    241   2e-70   
ref|XP_004976722.1|  PREDICTED: calcium-transporting ATPase 8, pl...    241   2e-70   Setaria italica
ref|XP_009786114.1|  PREDICTED: calcium-transporting ATPase 9, pl...    241   4e-70   Nicotiana sylvestris
gb|EMT28209.1|  Calcium-transporting ATPase 9, plasma membrane-type     239   5e-70   Aegilops tauschii
ref|XP_010034879.1|  PREDICTED: calcium-transporting ATPase 9, pl...    240   6e-70   Eucalyptus grandis [rose gum]
ref|XP_002448481.1|  hypothetical protein SORBIDRAFT_06g027770          240   8e-70   Sorghum bicolor [broomcorn]
ref|XP_010447799.1|  PREDICTED: calcium-transporting ATPase 10, p...    239   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010447795.1|  PREDICTED: calcium-transporting ATPase 10, p...    239   1e-69   Camelina sativa [gold-of-pleasure]
emb|CDO97752.1|  unnamed protein product                                239   1e-69   Coffea canephora [robusta coffee]
ref|XP_008462221.1|  PREDICTED: calcium-transporting ATPase 9, pl...    239   1e-69   
ref|XP_008663567.1|  PREDICTED: calcium-transporting ATPase 8, pl...    239   1e-69   Zea mays [maize]
ref|XP_008462219.1|  PREDICTED: calcium-transporting ATPase 9, pl...    239   2e-69   Cucumis melo [Oriental melon]
ref|XP_006342864.1|  PREDICTED: calcium-transporting ATPase 9, pl...    238   3e-69   Solanum tuberosum [potatoes]
gb|EMS62084.1|  Calcium-transporting ATPase 9, plasma membrane-type     240   4e-69   Triticum urartu
ref|XP_009385964.1|  PREDICTED: calcium-transporting ATPase 10, p...    238   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385965.1|  PREDICTED: calcium-transporting ATPase 10, p...    238   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976721.1|  PREDICTED: calcium-transporting ATPase 8, pl...    238   5e-69   
emb|CAC40035.1|  P-type ATPase                                          232   5e-69   Hordeum vulgare [barley]
gb|KJB70754.1|  hypothetical protein B456_011G090300                    236   8e-69   Gossypium raimondii
ref|XP_010318441.1|  PREDICTED: calcium-transporting ATPase 9, pl...    236   1e-68   Solanum lycopersicum
ref|NP_001053795.1|  Os04g0605500                                       236   2e-68   
gb|AGW24530.1|  type IIB Ca2+ATPase                                     236   2e-68   Oryza sativa [red rice]
ref|XP_010318439.1|  PREDICTED: calcium-transporting ATPase 9, pl...    235   3e-68   Solanum lycopersicum
gb|KJB70750.1|  hypothetical protein B456_011G090300                    235   3e-68   Gossypium raimondii
ref|XP_004235507.1|  PREDICTED: calcium-transporting ATPase 9, pl...    235   3e-68   Solanum lycopersicum
ref|XP_006652779.1|  PREDICTED: calcium-transporting ATPase 8, pl...    235   3e-68   Oryza brachyantha
ref|XP_003580413.1|  PREDICTED: calcium-transporting ATPase 8, pl...    234   6e-68   Brachypodium distachyon [annual false brome]
ref|XP_009395465.1|  PREDICTED: calcium-transporting ATPase 8, pl...    233   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG22770.1|  Calcium-transporting ATPase 9, plasma membrane-type     233   2e-67   Gossypium arboreum [tree cotton]
gb|KHG22771.1|  Calcium-transporting ATPase 9, plasma membrane-type     233   2e-67   Gossypium arboreum [tree cotton]
gb|EEE68995.1|  hypothetical protein OsJ_27935                          233   2e-67   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83883.1|  hypothetical protein OsI_29887                          233   2e-67   Oryza sativa Indica Group [Indian rice]
gb|EMT10847.1|  Calcium-transporting ATPase 8, plasma membrane-type     233   3e-67   Aegilops tauschii
gb|EPS71825.1|  hypothetical protein M569_02931                         233   5e-67   Genlisea aurea
ref|XP_010235324.1|  PREDICTED: calcium-transporting ATPase 8, pl...    230   3e-66   Brachypodium distachyon [annual false brome]
ref|XP_006660796.1|  PREDICTED: calcium-transporting ATPase 9, pl...    226   7e-66   
ref|XP_006660797.1|  PREDICTED: calcium-transporting ATPase 9, pl...    226   8e-66   
ref|XP_006659616.1|  PREDICTED: calcium-transporting ATPase 8, pl...    228   1e-65   Oryza brachyantha
ref|XP_002460472.1|  hypothetical protein SORBIDRAFT_02g028935          228   1e-65   Sorghum bicolor [broomcorn]
dbj|BAD09972.1|  putative calcium-transporting ATPase 8, plasma m...    226   6e-65   Oryza sativa Japonica Group [Japonica rice]
gb|AFW59361.1|  hypothetical protein ZEAMMB73_703991                    224   1e-64   Zea mays [maize]
gb|KJB70755.1|  hypothetical protein B456_011G090300                    222   2e-64   Gossypium raimondii
ref|XP_010034881.1|  PREDICTED: calcium-transporting ATPase 9, pl...    221   3e-64   Eucalyptus grandis [rose gum]
ref|XP_008652882.1|  PREDICTED: calcium-transporting ATPase 9, pl...    222   5e-64   Zea mays [maize]
gb|KCW53959.1|  hypothetical protein EUGRSUZ_J03164                     220   8e-64   Eucalyptus grandis [rose gum]
tpg|DAA62117.1|  TPA: hypothetical protein ZEAMMB73_938570              222   1e-63   Zea mays [maize]
ref|XP_008652881.1|  PREDICTED: calcium-transporting ATPase 9, pl...    223   1e-63   Zea mays [maize]
gb|EMS63749.1|  Calcium-transporting ATPase 8, plasma membrane-type     220   6e-63   Triticum urartu
ref|XP_002453386.1|  hypothetical protein SORBIDRAFT_04g005130          218   8e-63   Sorghum bicolor [broomcorn]
gb|EMS49508.1|  Calcium-transporting ATPase 8, plasma membrane-type     220   1e-62   Triticum urartu
gb|EMT00880.1|  Calcium-transporting ATPase 9, plasma membrane-type     219   2e-62   Aegilops tauschii
gb|EEE56425.1|  hypothetical protein OsJ_05593                          216   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046064.2|  Os02g0176700                                       216   2e-61   
dbj|BAD27978.1|  putative calcium-transporting ATPase                   216   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648366.1|  PREDICTED: calcium-transporting ATPase 8, pl...    215   7e-61   Oryza brachyantha
emb|CAC40036.1|  P-type ATPase                                          209   2e-60   Hordeum vulgare [barley]
dbj|BAK02901.1|  predicted protein                                      211   2e-59   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008645303.1|  PREDICTED: calcium-transporting ATPase 8, pl...    210   5e-59   Zea mays [maize]
ref|XP_010233900.1|  PREDICTED: calcium-transporting ATPase 8, pl...    209   6e-59   
ref|XP_010233899.1|  PREDICTED: calcium-transporting ATPase 8, pl...    209   2e-58   Brachypodium distachyon [annual false brome]
ref|XP_004951726.1|  PREDICTED: calcium-transporting ATPase 8, pl...    209   2e-58   
gb|KHN24634.1|  Calcium-transporting ATPase 8, plasma membrane-type     206   5e-58   
ref|XP_006595202.1|  PREDICTED: calcium-transporting ATPase 9, pl...    204   4e-57   
gb|EEC72600.1|  hypothetical protein OsI_06071                          196   4e-54   
ref|XP_010446073.1|  PREDICTED: calcium-transporting ATPase 8, pl...    194   1e-53   
ref|XP_010474072.1|  PREDICTED: calcium-transporting ATPase 8, pl...    191   2e-52   
ref|XP_002973134.1|  hypothetical protein SELMODRAFT_451600             191   3e-52   
ref|NP_200113.3|  putative calcium-transporting ATPase                  189   1e-51   
dbj|BAA97141.1|  Ca2+-transporting ATPase-like protein                  189   1e-51   
ref|XP_002976723.1|  hypothetical protein SELMODRAFT_451372             189   1e-51   
emb|CDX94386.1|  BnaC01g17980D                                          189   2e-51   
ref|XP_010445448.1|  PREDICTED: calcium-transporting ATPase 8, pl...    188   3e-51   
ref|XP_010445455.1|  PREDICTED: calcium-transporting ATPase 8, pl...    188   4e-51   
emb|CDY38720.1|  BnaC03g15290D                                          186   7e-51   
ref|XP_002865948.1|  hypothetical protein ARALYDRAFT_918363             185   9e-51   
emb|CDY38719.1|  BnaC03g15300D                                          185   2e-50   
ref|XP_010054676.1|  PREDICTED: calcium-transporting ATPase 8, pl...    183   2e-50   
emb|CDX94389.1|  BnaC01g17950D                                          182   3e-49   
ref|XP_009139813.1|  PREDICTED: calcium-transporting ATPase 8, pl...    182   4e-49   
ref|XP_009139820.1|  PREDICTED: calcium-transporting ATPase 8, pl...    180   2e-48   
emb|CDX89375.1|  BnaA01g15180D                                          180   2e-48   
emb|CAD67615.1|  putative P-type II calcium ATPase                      179   7e-48   
ref|XP_001780927.1|  predicted protein                                  178   8e-48   
ref|XP_002865945.1|  hypothetical protein ARALYDRAFT_918356             178   1e-47   
ref|XP_002865949.1|  hypothetical protein ARALYDRAFT_918364             174   1e-46   
gb|AAP92715.1|  calcium-transporting ATPase 1                           175   1e-46   
ref|XP_009139804.1|  PREDICTED: calcium-transporting ATPase 8, pl...    174   2e-46   
ref|XP_009139793.1|  PREDICTED: calcium-transporting ATPase 8, pl...    173   4e-46   
ref|XP_009139779.1|  PREDICTED: calcium-transporting ATPase 8, pl...    173   6e-46   
ref|XP_001767354.1|  predicted protein                                  172   9e-46   
ref|XP_006401756.1|  hypothetical protein EUTSA_v10012578mg             169   2e-44   
ref|XP_011458602.1|  PREDICTED: calcium-transporting ATPase 12, p...    167   1e-43   
ref|XP_001753347.1|  predicted protein                                  165   4e-43   
ref|XP_002279593.1|  PREDICTED: putative calcium-transporting ATP...    164   5e-43   
gb|AAL17950.1|  type IIB calcium ATPase                                 164   8e-43   
ref|XP_002279629.1|  PREDICTED: putative calcium-transporting ATP...    163   2e-42   
ref|XP_002279443.2|  PREDICTED: putative calcium-transporting ATP...    162   2e-42   
ref|XP_010279284.1|  PREDICTED: calcium-transporting ATPase 12, p...    162   2e-42   
gb|KDP21394.1|  hypothetical protein JCGZ_21865                         162   4e-42   
emb|CAN67182.1|  hypothetical protein VITISV_002535                     159   6e-42   
ref|XP_002520952.1|  cation-transporting atpase plant, putative         160   1e-41   
ref|XP_010650037.1|  PREDICTED: putative calcium-transporting ATP...    160   1e-41   
ref|XP_002274787.1|  PREDICTED: calcium-transporting ATPase 12, p...    160   2e-41   
ref|XP_008235352.1|  PREDICTED: calcium-transporting ATPase 12, p...    160   2e-41   
gb|KCW61610.1|  hypothetical protein EUGRSUZ_H04346                     160   2e-41   
ref|XP_008235351.1|  PREDICTED: calcium-transporting ATPase 12, p...    160   2e-41   
gb|KCW61622.1|  hypothetical protein EUGRSUZ_H04360                     159   2e-41   
gb|EMT05411.1|  Calcium-transporting ATPase 8, plasma membrane-type     160   3e-41   
ref|XP_010027199.1|  PREDICTED: calcium-transporting ATPase 12, p...    160   3e-41   
gb|KCW61620.1|  hypothetical protein EUGRSUZ_H04358                     159   4e-41   
ref|XP_010027202.1|  PREDICTED: calcium-transporting ATPase 12, p...    159   4e-41   
ref|XP_007199695.1|  hypothetical protein PRUPE_ppa000727mg             159   4e-41   
gb|KCW61616.1|  hypothetical protein EUGRSUZ_H04353                     158   8e-41   
gb|KCW61614.1|  hypothetical protein EUGRSUZ_H04351                     158   9e-41   
ref|XP_010027201.1|  PREDICTED: calcium-transporting ATPase 12, p...    158   1e-40   
ref|XP_004493726.1|  PREDICTED: calcium-transporting ATPase 12, p...    158   1e-40   
ref|XP_010025026.1|  PREDICTED: calcium-transporting ATPase 12, p...    158   1e-40   
emb|CAN69357.1|  hypothetical protein VITISV_014915                     155   1e-40   
gb|KCW61608.1|  hypothetical protein EUGRSUZ_H04342                     158   1e-40   
gb|KDO68619.1|  hypothetical protein CISIN_1g001616mg                   157   1e-40   
gb|KCW61621.1|  hypothetical protein EUGRSUZ_H04359                     157   2e-40   
ref|XP_008355820.1|  PREDICTED: calcium-transporting ATPase 12, p...    157   2e-40   
ref|XP_006443965.1|  hypothetical protein CICLE_v10018645mg             157   2e-40   
ref|XP_011462472.1|  PREDICTED: putative calcium-transporting ATP...    157   2e-40   
ref|XP_010027204.1|  PREDICTED: calcium-transporting ATPase 12, p...    157   2e-40   
ref|XP_010025023.1|  PREDICTED: calcium-transporting ATPase 12, p...    157   2e-40   
gb|EMS48814.1|  Calcium-transporting ATPase 8, plasma membrane-type     157   3e-40   
ref|XP_010279282.1|  PREDICTED: calcium-transporting ATPase 12, p...    157   3e-40   
ref|XP_002279818.1|  PREDICTED: putative calcium-transporting ATP...    156   5e-40   
gb|KCW61612.1|  hypothetical protein EUGRSUZ_H04349                     156   5e-40   
ref|XP_010027205.1|  PREDICTED: calcium-transporting ATPase 12, p...    156   6e-40   
ref|XP_010025024.1|  PREDICTED: calcium-transporting ATPase 12, p...    156   6e-40   
emb|CAN71613.1|  hypothetical protein VITISV_016249                     153   6e-40   
ref|XP_006443966.1|  hypothetical protein CICLE_v10018645mg             155   7e-40   
gb|KDO68618.1|  hypothetical protein CISIN_1g001616mg                   155   7e-40   
ref|XP_010649968.1|  PREDICTED: putative calcium-transporting ATP...    155   8e-40   
ref|XP_006420055.1|  hypothetical protein CICLE_v10006602mg             153   9e-40   
ref|XP_002279498.1|  PREDICTED: putative calcium-transporting ATP...    155   1e-39   
ref|XP_010539136.1|  PREDICTED: calcium-transporting ATPase 8, pl...    154   1e-39   
ref|XP_009370751.1|  PREDICTED: calcium-transporting ATPase 12, p...    155   1e-39   
ref|XP_011079983.1|  PREDICTED: calcium-transporting ATPase 12, p...    155   2e-39   
ref|XP_010659882.1|  PREDICTED: calcium-transporting ATPase 12, p...    154   2e-39   
ref|XP_002283579.1|  PREDICTED: putative calcium-transporting ATP...    154   2e-39   
ref|XP_007050467.1|  ATPase E1-E2 type family protein / haloacid ...    154   2e-39   
ref|XP_007160386.1|  hypothetical protein PHAVU_002G317400g             154   2e-39   
gb|KCW61615.1|  hypothetical protein EUGRSUZ_H04352                     154   2e-39   
emb|CDY40822.1|  BnaC01g31340D                                          154   3e-39   
ref|XP_010025025.1|  PREDICTED: calcium-transporting ATPase 12, p...    154   3e-39   
ref|XP_002279888.1|  PREDICTED: putative calcium-transporting ATP...    154   3e-39   
emb|CAN81891.1|  hypothetical protein VITISV_023611                     154   3e-39   
ref|XP_010278086.1|  PREDICTED: putative calcium-transporting ATP...    154   4e-39   
emb|CDP07947.1|  unnamed protein product                                150   6e-39   
ref|XP_010107728.1|  Putative calcium-transporting ATPase 13, pla...    153   7e-39   
ref|XP_006489476.1|  PREDICTED: putative calcium-transporting ATP...    152   8e-39   
emb|CAN83227.1|  hypothetical protein VITISV_029568                     149   1e-38   
ref|XP_006362197.1|  PREDICTED: putative calcium-transporting ATP...    151   1e-38   
ref|XP_009108561.1|  PREDICTED: putative calcium-transporting ATP...    152   1e-38   
ref|XP_010259161.1|  PREDICTED: LOW QUALITY PROTEIN: putative cal...    152   1e-38   
gb|KHN02549.1|  Calcium-transporting ATPase 12, plasma membrane-type    152   2e-38   
ref|XP_007030587.1|  Autoinhibited calcium ATPase                       149   2e-38   
ref|XP_002312557.1|  putative calcium-transporting ATPase 13 fami...    151   2e-38   
ref|XP_006420049.1|  hypothetical protein CICLE_v10006833mg             150   2e-38   
gb|KCW78627.1|  hypothetical protein EUGRSUZ_C000942                    147   2e-38   
ref|XP_006382786.1|  hypothetical protein POPTR_0005s05420g             151   2e-38   
ref|XP_002279567.2|  PREDICTED: putative calcium-transporting ATP...    151   2e-38   
ref|XP_002274001.1|  PREDICTED: calcium-transporting ATPase 12, p...    151   2e-38   
ref|XP_002885529.1|  hypothetical protein ARALYDRAFT_898774             151   2e-38   
emb|CAN63793.1|  hypothetical protein VITISV_002789                     151   2e-38   
gb|KDP40247.1|  hypothetical protein JCGZ_02245                         151   2e-38   
ref|XP_008368699.1|  PREDICTED: calcium-transporting ATPase 12, p...    151   2e-38   
gb|KCW78625.1|  hypothetical protein EUGRSUZ_C000942                    148   2e-38   
ref|XP_002279528.1|  PREDICTED: putative calcium-transporting ATP...    151   3e-38   
emb|CDY34219.1|  BnaA01g24360D                                          151   3e-38   
ref|XP_006604467.1|  PREDICTED: calcium-transporting ATPase 12, p...    151   3e-38   
ref|XP_010488324.1|  PREDICTED: putative calcium-transporting ATP...    151   3e-38   
ref|XP_002300816.2|  hypothetical protein POPTR_0002s04840g             151   3e-38   
gb|KJB22597.1|  hypothetical protein B456_004G056600                    150   4e-38   
ref|XP_010490048.1|  PREDICTED: putative calcium-transporting ATP...    150   6e-38   
ref|XP_010279281.1|  PREDICTED: calcium-transporting ATPase 12, p...    151   6e-38   
ref|XP_002279864.1|  PREDICTED: putative calcium-transporting ATP...    150   8e-38   
ref|XP_011026092.1|  PREDICTED: calcium-transporting ATPase 12, p...    150   8e-38   
ref|XP_006299865.1|  hypothetical protein CARUB_v10016069mg             149   1e-37   
emb|CAN83242.1|  hypothetical protein VITISV_000815                     149   1e-37   
ref|XP_009349561.1|  PREDICTED: putative calcium-transporting ATP...    149   1e-37   
ref|XP_011004262.1|  PREDICTED: calcium-transporting ATPase 12, p...    149   2e-37   
ref|XP_009337268.1|  PREDICTED: putative calcium-transporting ATP...    149   2e-37   
ref|XP_002517056.1|  cation-transporting atpase plant, putative         149   2e-37   
ref|XP_010644140.1|  PREDICTED: putative calcium-transporting ATP...    148   2e-37   
ref|XP_010511883.1|  PREDICTED: putative calcium-transporting ATP...    148   2e-37   
ref|XP_010259206.1|  PREDICTED: calcium-transporting ATPase 12, p...    149   3e-37   
ref|XP_011032414.1|  PREDICTED: calcium-transporting ATPase 12, p...    148   3e-37   
ref|NP_188931.1|  putative calcium-transporting ATPase 13               148   3e-37   
emb|CDY10319.1|  BnaC05g29600D                                          148   3e-37   
ref|XP_007162471.1|  hypothetical protein PHAVU_001G155200g             148   3e-37   
ref|XP_009396673.1|  PREDICTED: calcium-transporting ATPase 12, p...    148   3e-37   
gb|KHN10695.1|  Calcium-transporting ATPase 12, plasma membrane-type    147   4e-37   
ref|XP_003521262.1|  PREDICTED: calcium-transporting ATPase 12, p...    148   4e-37   
ref|XP_010674825.1|  PREDICTED: putative calcium-transporting ATP...    147   4e-37   
ref|XP_010466584.1|  PREDICTED: LOW QUALITY PROTEIN: putative cal...    147   4e-37   
ref|XP_007030588.1|  ATPase E1-E2 type family protein / haloacid ...    147   5e-37   
ref|XP_002517055.1|  cation-transporting atpase plant, putative         147   5e-37   
ref|XP_006375913.1|  hypothetical protein POPTR_0013s05960g             147   6e-37   
ref|XP_008386410.1|  PREDICTED: calcium-transporting ATPase 12, p...    147   6e-37   
emb|CDY10680.1|  BnaA05g16820D                                          147   7e-37   
ref|XP_010696566.1|  PREDICTED: putative calcium-transporting ATP...    147   1e-36   
gb|AGX27512.1|  ACA13                                                   147   1e-36   
ref|XP_006363455.1|  PREDICTED: putative calcium-transporting ATP...    147   1e-36   
ref|XP_007030586.1|  Autoinhibited calcium ATPase                       146   1e-36   
ref|XP_004146962.1|  PREDICTED: calcium-transporting ATPase 12, p...    146   2e-36   
ref|XP_009145252.1|  PREDICTED: putative calcium-transporting ATP...    146   2e-36   
ref|XP_006347758.1|  PREDICTED: calcium-transporting ATPase 12, p...    145   2e-36   
ref|XP_010532587.1|  PREDICTED: putative calcium-transporting ATP...    145   2e-36   
ref|XP_008451291.1|  PREDICTED: calcium-transporting ATPase 12, p...    145   3e-36   
ref|XP_007030589.1|  ATPase E1-E2 type family protein / haloacid ...    145   3e-36   
emb|CDX93910.1|  BnaC04g20690D                                          145   4e-36   
ref|XP_002983625.1|  hypothetical protein SELMODRAFT_118764             145   4e-36   
ref|XP_004296594.1|  PREDICTED: putative calcium-transporting ATP...    145   4e-36   
ref|XP_011032627.1|  PREDICTED: calcium-transporting ATPase 12, p...    145   5e-36   
ref|XP_002307612.2|  hypothetical protein POPTR_0005s23710g             144   6e-36   
ref|XP_010667778.1|  PREDICTED: putative calcium-transporting ATP...    144   6e-36   
ref|XP_002961828.1|  hypothetical protein SELMODRAFT_266601             144   6e-36   
ref|XP_011090652.1|  PREDICTED: putative calcium-transporting ATP...    144   7e-36   
ref|XP_004231233.2|  PREDICTED: putative calcium-transporting ATP...    144   7e-36   
ref|XP_006375832.1|  hypothetical protein POPTR_0013s03760g             144   7e-36   
gb|KJB44881.1|  hypothetical protein B456_007G277600                    144   8e-36   
ref|XP_010025937.1|  PREDICTED: putative calcium-transporting ATP...    144   8e-36   
ref|XP_010545103.1|  PREDICTED: calcium-transporting ATPase 12, p...    144   8e-36   
gb|KCW57761.1|  hypothetical protein EUGRSUZ_H00511                     144   9e-36   
ref|XP_002990585.1|  hypothetical protein SELMODRAFT_451597             144   9e-36   
ref|XP_001758854.1|  predicted protein                                  144   1e-35   
ref|XP_011027295.1|  PREDICTED: putative calcium-transporting ATP...    144   1e-35   
ref|XP_002980822.1|  hypothetical protein SELMODRAFT_154134             143   1e-35   
gb|KFK35492.1|  hypothetical protein AALP_AA5G291700                    143   1e-35   
gb|KCW57769.1|  hypothetical protein EUGRSUZ_H00527                     142   1e-35   
ref|XP_008388676.1|  PREDICTED: calcium-transporting ATPase 12, p...    143   1e-35   
ref|XP_010695757.1|  PREDICTED: putative calcium-transporting ATP...    143   1e-35   
gb|KDP40246.1|  hypothetical protein JCGZ_02244                         143   1e-35   
ref|XP_010038673.1|  PREDICTED: calcium-transporting ATPase 12, p...    143   2e-35   
gb|EYU46530.1|  hypothetical protein MIMGU_mgv1a020656mg                143   2e-35   
ref|XP_009349566.1|  PREDICTED: putative calcium-transporting ATP...    142   3e-35   
ref|XP_010087108.1|  Calcium-transporting ATPase 12, plasma membr...    142   3e-35   
ref|XP_010025936.1|  PREDICTED: putative calcium-transporting ATP...    142   3e-35   
ref|XP_010069416.1|  PREDICTED: putative calcium-transporting ATP...    142   3e-35   
ref|XP_009364513.1|  PREDICTED: calcium-transporting ATPase 12, p...    142   3e-35   
gb|KHN30766.1|  Putative calcium-transporting ATPase 13, plasma m...    142   3e-35   
gb|KJB44880.1|  hypothetical protein B456_007G277500                    142   4e-35   
gb|KCW78631.1|  hypothetical protein EUGRSUZ_C00095                     140   4e-35   
ref|XP_010025938.1|  PREDICTED: putative calcium-transporting ATP...    142   4e-35   
ref|XP_008792678.1|  PREDICTED: calcium-transporting ATPase 1, pl...    142   4e-35   
ref|XP_008792677.1|  PREDICTED: calcium-transporting ATPase 1, pl...    142   5e-35   
ref|XP_008792679.1|  PREDICTED: calcium-transporting ATPase 1, pl...    142   5e-35   
ref|XP_003554951.1|  PREDICTED: putative calcium-transporting ATP...    142   5e-35   
ref|XP_009359439.1|  PREDICTED: putative calcium-transporting ATP...    142   5e-35   
gb|KFK39573.1|  hypothetical protein AALP_AA3G261900                    142   5e-35   
ref|XP_010679135.1|  PREDICTED: calcium-transporting ATPase 12, p...    141   6e-35   
ref|XP_002878514.1|  hypothetical protein ARALYDRAFT_486846             141   7e-35   
ref|XP_010468854.1|  PREDICTED: calcium-transporting ATPase 12, p...    141   7e-35   
ref|XP_002512214.1|  cation-transporting atpase plant, putative         141   7e-35   
ref|XP_010917644.1|  PREDICTED: putative calcium-transporting ATP...    141   7e-35   
gb|KDP40244.1|  hypothetical protein JCGZ_02242                         141   1e-34   
ref|XP_010512754.1|  PREDICTED: calcium-transporting ATPase 12, p...    140   1e-34   
ref|XP_010413156.1|  PREDICTED: calcium-transporting ATPase 12, p...    140   1e-34   
ref|XP_004162190.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-tran...    140   1e-34   
emb|CDP11311.1|  unnamed protein product                                140   2e-34   
gb|AFW70362.1|  hypothetical protein ZEAMMB73_750559                    137   2e-34   
gb|AAF24958.1|AC012375_21  T22C5.23                                     140   2e-34   
gb|AAD10211.1|  envelope Ca2+-ATPase                                    140   2e-34   
gb|KCW57762.1|  hypothetical protein EUGRSUZ_H00512                     140   2e-34   
gb|AAD10212.1|  envelope Ca2+-ATPase                                    140   2e-34   
ref|XP_006849321.1|  hypothetical protein AMTR_s00164p00023490          140   2e-34   
ref|NP_849716.1|  autoinhibited Ca2+-ATPase 1                           140   2e-34   
dbj|BAC41935.1|  putative Ca2+-transporting ATPase                      140   2e-34   
ref|NP_191897.1|  putative calcium-transporting ATPase 12               140   2e-34   
gb|ACT21100.1|  plasma membrane Ca2+-ATPase                             134   3e-34   
gb|KJB38240.1|  hypothetical protein B456_006G243500                    140   3e-34   
ref|XP_010923516.1|  PREDICTED: putative calcium-transporting ATP...    139   3e-34   
ref|XP_004973832.1|  PREDICTED: calcium-transporting ATPase 2, pl...    139   4e-34   
ref|XP_008231999.1|  PREDICTED: putative calcium-transporting ATP...    139   4e-34   
ref|XP_010478131.1|  PREDICTED: calcium-transporting ATPase 1, ch...    139   5e-34   
ref|XP_006406116.1|  hypothetical protein EUTSA_v10022129mg             139   5e-34   
ref|XP_002445927.1|  hypothetical protein SORBIDRAFT_07g028160          139   6e-34   



>ref|XP_002309001.2| hypothetical protein POPTR_0006s07240g [Populus trichocarpa]
 gb|EEE92524.2| hypothetical protein POPTR_0006s07240g [Populus trichocarpa]
Length=1082

 Score =   302 bits (773),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GG++I+PPD KSQLP  +  LL+EGIAQNTTGSVFVPEGG  PE+SGSPTEKAIL 
Sbjct  503  EAYSGGQKIDPPDSKSQLPPILSSLLMEGIAQNTTGSVFVPEGGGDPEISGSPTEKAILG  562

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFDA+RSESSIIH FPFNSEKK+GGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  563  WAVKLGMNFDAVRSESSIIHVFPFNSEKKKGGVALQLPDSQVHIHWKGAAEIVLASCTEY  622

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            I+A+  +VPLD+++ + FKK+IEDMA  SLRCVA+AY +YDMDK+P  E++ ++WELP+ 
Sbjct  623  INASGKIVPLDQDKVLFFKKSIEDMAASSLRCVAIAYRTYDMDKVPADEQQKTQWELPQD  682

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  683  DLVLLAIVGIKDPCRPGVR  701



>ref|XP_002518263.1| cation-transporting atpase plant, putative [Ricinus communis]
 gb|EEF44149.1| cation-transporting atpase plant, putative [Ricinus communis]
Length=1075

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 173/199 (87%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            DAY+GGK+I+PPD+KSQL   +  LL+EG++QNT GSVF+PE GG  EVSGSPTEKAIL 
Sbjct  496  DAYVGGKKIDPPDNKSQLSPNLFSLLIEGVSQNTNGSVFIPEDGGETEVSGSPTEKAILV  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF A RSES+IIH FPFNS+KKRGGVA++L DSEVHIHWKGAAEIVL+ CT Y
Sbjct  556  WGVKLGMNFQAARSESTIIHVFPFNSQKKRGGVALQLPDSEVHIHWKGAAEIVLASCTTY  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND +VPLD+ +A+ FKK+IEDMA  SLRC+A+AY  Y+MDKIP +E++L++W+LPE 
Sbjct  616  MDGNDQLVPLDDEKALFFKKSIEDMAAHSLRCIAIAYRPYEMDKIPVNEQDLTQWQLPED  675

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+G+KDPCRPGV+
Sbjct  676  NLVLLAIVGLKDPCRPGVK  694



>ref|XP_006366962.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366963.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006366964.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Solanum tuberosum]
Length=1081

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 172/198 (87%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AYI GK+I+PPDD+S++P  V+ LL EG+  NTTGSVFVP+GG   E+SGSPTEKAILQ
Sbjct  504  EAYISGKKIDPPDDRSEVPPTVLSLLHEGVGLNTTGSVFVPQGGAAVEISGSPTEKAILQ  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+ LG+NFDA+RSE+SIIHAFPFNSEKKRGGVAVKLDSEVH+HWKGAAEIVLSCCT +I
Sbjct  564  WGLNLGMNFDAVRSEASIIHAFPFNSEKKRGGVAVKLDSEVHLHWKGAAEIVLSCCTSFI  623

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N +VVPL +++   FK+AI +MA  SLRCVA+AY  Y+++K+P +EEE+  WE+PEGD
Sbjct  624  DENGSVVPLGDDKMSLFKEAIGNMAASSLRCVAIAYRPYEVEKVP-TEEEIDHWEIPEGD  682

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+GIKDPCRPGVR
Sbjct  683  LILLAIVGIKDPCRPGVR  700



>ref|XP_011020086.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Populus euphratica]
Length=1078

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GG++I+P D KSQLP  +  LL+EGIAQNTTG VFVPEGG  PE+SGSPTEKAIL 
Sbjct  503  EAYSGGQKIDPADSKSQLPSILSSLLMEGIAQNTTGCVFVPEGGGDPEISGSPTEKAILG  562

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RSESSIIH FPFNSEKK+GGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  563  WAIKLGMNFDAVRSESSIIHVFPFNSEKKKGGVALQLPDSQVHIHWKGAAEIVLASCTKY  622

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            I+A+  +VPLD+++ + FKKAIEDMA  SLRCVA+AY +YDMDK+P  E++ ++W LP+ 
Sbjct  623  INASGKIVPLDQDKVLFFKKAIEDMAASSLRCVAIAYRTYDMDKVPADEQQKTQWALPQD  682

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  683  DLVLLAIVGIKDPCRPGVR  701



>ref|XP_011020078.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020079.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020080.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020082.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020083.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020084.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
 ref|XP_011020085.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
Length=1082

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GG++I+P D KSQLP  +  LL+EGIAQNTTG VFVPEGG  PE+SGSPTEKAIL 
Sbjct  503  EAYSGGQKIDPADSKSQLPSILSSLLMEGIAQNTTGCVFVPEGGGDPEISGSPTEKAILG  562

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RSESSIIH FPFNSEKK+GGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  563  WAIKLGMNFDAVRSESSIIHVFPFNSEKKKGGVALQLPDSQVHIHWKGAAEIVLASCTKY  622

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            I+A+  +VPLD+++ + FKKAIEDMA  SLRCVA+AY +YDMDK+P  E++ ++W LP+ 
Sbjct  623  INASGKIVPLDQDKVLFFKKAIEDMAASSLRCVAIAYRTYDMDKVPADEQQKTQWALPQD  682

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  683  DLVLLAIVGIKDPCRPGVR  701



>ref|XP_010323145.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323146.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323147.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323148.1| PREDICTED: auto-inhibited Ca2 -transporting ATPase 10 isoform 
X1 [Solanum lycopersicum]
Length=1081

 Score =   296 bits (757),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 170/198 (86%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            + YI GK+I+PPDD+S++P  V+ LL EG+  NTTGSVFVP+GG   E+SGSPTEKAILQ
Sbjct  504  EVYISGKKIDPPDDRSEVPPTVLSLLHEGVGLNTTGSVFVPQGGGAVEISGSPTEKAILQ  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+ LG+NFDA+RSE+SIIHAFPFNSEKKRGGVAVKLDSEVH+HWKGAAEIVLSCCT +I
Sbjct  564  WGLNLGMNFDAVRSEASIIHAFPFNSEKKRGGVAVKLDSEVHLHWKGAAEIVLSCCTSFI  623

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N +VVPL +++    K+AI +MA  SLRCVA+AY  Y++DK+P +EEE+  WE+PEGD
Sbjct  624  DENGSVVPLGDDKMSLLKEAISNMAASSLRCVAIAYRPYEVDKVP-TEEEIDHWEIPEGD  682

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+GIKDPCRPGVR
Sbjct  683  LILLAIVGIKDPCRPGVR  700



>ref|NP_001234817.1| auto-inhibited Ca2 -transporting ATPase 10 [Solanum lycopersicum]
 gb|AEO12147.1| auto-inhibited Ca2+-transporting ATPase 10 [Solanum lycopersicum]
Length=1081

 Score =   296 bits (757),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 170/198 (86%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            + YI GK+I+PPDD+S++P  V+ LL EG+  NTTGSVFVP+GG   E+SGSPTEKAILQ
Sbjct  504  EVYISGKKIDPPDDRSEVPPTVLSLLHEGVGLNTTGSVFVPQGGGAVEISGSPTEKAILQ  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+ LG+NFDA+RSE+SIIHAFPFNSEKKRGGVAVKLDSEVH+HWKGAAEIVLSCCT +I
Sbjct  564  WGLNLGMNFDAVRSEASIIHAFPFNSEKKRGGVAVKLDSEVHLHWKGAAEIVLSCCTSFI  623

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N +VVPL +++    K+AI +MA  SLRCVA+AY  Y++DK+P +EEE+  WE+PEGD
Sbjct  624  DENGSVVPLGDDKMSLLKEAISNMAASSLRCVAIAYRPYEVDKVP-TEEEIDHWEIPEGD  682

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+GIKDPCRPGVR
Sbjct  683  LILLAIVGIKDPCRPGVR  700



>emb|CDP12667.1| unnamed protein product [Coffea canephora]
Length=864

 Score =   291 bits (744),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 168/199 (84%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY+GGK+++PPDDKS LP K+  LL EGIAQN+TGSVF+PEGG   EVSGSPTEKAILQ
Sbjct  270  EAYVGGKKVDPPDDKSLLPPKLTSLLTEGIAQNSTGSVFLPEGGGDAEVSGSPTEKAILQ  329

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+ LG+NFD IRS SSIIHAFPFNSEKKRGGVAVKL DS++H+HWKGAAEIVL+ CT Y
Sbjct  330  WGLNLGMNFDVIRSSSSIIHAFPFNSEKKRGGVAVKLPDSDIHVHWKGAAEIVLASCTAY  389

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND + P++E + + FK AIEDMA  SLRCVA+AY  ++   +P +EEELS W+LPEG
Sbjct  390  MDENDGIQPIEE-KVLDFKTAIEDMAARSLRCVAIAYRHHEGKDVPTNEEELSNWQLPEG  448

Query  535  DLILLAILGIKDPCRPGVR  591
             L+LLAI+GIKDPCRPGVR
Sbjct  449  QLVLLAIVGIKDPCRPGVR  467



>ref|XP_009601429.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009601430.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009601431.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009601433.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Nicotiana tomentosiformis]
Length=1087

 Score =   293 bits (751),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 172/199 (86%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY+ GK+I+PPDD+S +P  V+ LL EG+  NTTGS+FVP+GG   E+SGSPTEKAILQ
Sbjct  509  EAYVCGKKIDPPDDRSAVPPTVLSLLHEGVGLNTTGSIFVPQGGAAAEISGSPTEKAILQ  568

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GV LG+NFDA+RS++SIIHAFPFNSEKKRGGVAVKL DSEVH+HWKGAAEIVLSCCT +
Sbjct  569  WGVNLGMNFDAVRSKASIIHAFPFNSEKKRGGVAVKLHDSEVHLHWKGAAEIVLSCCTSF  628

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID N +VVPL +++   FK++I DMA  SLRCVA+AY  YD++K+P +EEE+ +W++PEG
Sbjct  629  IDENGSVVPLGDDKVSHFKQSINDMAASSLRCVAIAYRQYDVEKVP-NEEEVEQWQIPEG  687

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  688  DLVLLAIVGIKDPCRPGVR  706



>gb|KDO61969.1| hypothetical protein CISIN_1g0433051mg, partial [Citrus sinensis]
Length=657

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 168/199 (84%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+GG+++NP D  SQL   V  LL+EGIAQNTTGSV++P  GG  EVSGSPTEKAILQ
Sbjct  102  EAYVGGRKMNPTDSNSQLSPMVTSLLVEGIAQNTTGSVYLPPNGGEAEVSGSPTEKAILQ  161

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+A+RSE S++H FPFNS KKRGGVAV+L +SEVHIHWKGAAEIVL  CT Y
Sbjct  162  WGMKLGMNFEAVRSECSVLHVFPFNSLKKRGGVAVQLPNSEVHIHWKGAAEIVLDSCTGY  221

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID +D +V +DE++ ++FKKAIEDMA+ SLRCVA+AY +Y+ ++IP  EEELSRW LPE 
Sbjct  222  IDTDDRLVQMDEDKLLTFKKAIEDMASSSLRCVAIAYRTYERERIP-DEEELSRWALPED  280

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  281  DLVLLAIVGIKDPCRPSVK  299



>gb|KDP30671.1| hypothetical protein JCGZ_16227 [Jatropha curcas]
Length=1089

 Score =   291 bits (744),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 172/211 (82%), Gaps = 14/211 (7%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GGK+I+ P+ KS+L  K+  LL+EGIAQNT GSVF+PE GG  EVSGSPTEKAIL 
Sbjct  498  EAYVGGKKIDSPESKSELSPKLSSLLIEGIAQNTNGSVFIPENGGDLEVSGSPTEKAILV  557

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NFDA+RSES+IIH FPFNS+KKRGGVAV+  DSEVHIHWKGAAEIVL+ CT Y
Sbjct  558  WGVKLGMNFDAVRSESAIIHVFPFNSQKKRGGVAVQRPDSEVHIHWKGAAEIVLASCTAY  617

Query  355  IDANDNVVPLDEN------------EAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKS  498
            ID ND +VPL +             +++ FKKAIEDMA  SLRC+A+AY SY+MDK+P +
Sbjct  618  IDGNDQIVPLTDEKRIPGSEKSYYLQSLFFKKAIEDMAAGSLRCIAIAYRSYEMDKVPTN  677

Query  499  EEELSRWELPEGDLILLAILGIKDPCRPGVR  591
            EE LS+WELPE DLILLAI+G+KDPCRPGV+
Sbjct  678  EEALSQWELPEDDLILLAIIGLKDPCRPGVK  708



>ref|XP_011017707.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Populus euphratica]
Length=1079

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A+ GGK+++ P+ KSQLP  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ 
Sbjct  502  EAFSGGKKMDLPESKSQLPPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMG  561

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RSES++IH FPFNSEKK+GGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  562  WAIKLGMNFDAVRSESNVIHVFPFNSEKKKGGVALQLPDSQVHIHWKGAAEIVLASCTKY  621

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+ N VPLD+++ + FKKAIEDMA  SLRCV++AY +YDMDK+P  E++L++W +P+ 
Sbjct  622  VDASGNTVPLDQDKVLFFKKAIEDMACSSLRCVSIAYRTYDMDKVPADEQQLTQWVIPQD  681

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  682  DLVLLAIIGIKDPCRPGVR  700



>ref|XP_009757245.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757246.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757247.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757248.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757249.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757250.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009757251.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nicotiana sylvestris]
Length=1087

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 171/199 (86%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +AY+ GK+I+PPDD+S +P  V+ LL EG+  NTTGS+FVP+GG   E+SGSPTEKAILQ
Sbjct  509  EAYVCGKKIDPPDDRSAVPPTVLSLLHEGVGLNTTGSIFVPQGGGAAEISGSPTEKAILQ  568

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + V LG+NFDA++SE+SIIHAFPFNSEKKRGGVAVKL DSEVH+HWKGAAEIVLSCCT +
Sbjct  569  WAVNLGMNFDAVQSEASIIHAFPFNSEKKRGGVAVKLHDSEVHLHWKGAAEIVLSCCTSF  628

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID N +VVPL +++   FK++I DMA  SLRCVA+AY  +D++K+P +EEE+ +W++PEG
Sbjct  629  IDENGSVVPLGDDKVSHFKQSINDMAASSLRCVAIAYRQFDVEKVP-NEEEVEQWQIPEG  687

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  688  DLVLLAIVGIKDPCRPGVR  706



>ref|XP_011017705.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Populus euphratica]
Length=1095

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A+ GGK+++ P+ KSQLP  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ 
Sbjct  502  EAFSGGKKMDLPESKSQLPPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMG  561

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RSES++IH FPFNSEKK+GGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  562  WAIKLGMNFDAVRSESNVIHVFPFNSEKKKGGVALQLPDSQVHIHWKGAAEIVLASCTKY  621

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+ N VPLD+++ + FKKAIEDMA  SLRCV++AY +YDMDK+P  E++L++W +P+ 
Sbjct  622  VDASGNTVPLDQDKVLFFKKAIEDMACSSLRCVSIAYRTYDMDKVPADEQQLTQWVIPQD  681

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  682  DLVLLAIIGIKDPCRPGVR  700



>ref|XP_011017704.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Populus euphratica]
Length=1098

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A+ GGK+++ P+ KSQLP  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ 
Sbjct  502  EAFSGGKKMDLPESKSQLPPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMG  561

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RSES++IH FPFNSEKK+GGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  562  WAIKLGMNFDAVRSESNVIHVFPFNSEKKKGGVALQLPDSQVHIHWKGAAEIVLASCTKY  621

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+ N VPLD+++ + FKKAIEDMA  SLRCV++AY +YDMDK+P  E++L++W +P+ 
Sbjct  622  VDASGNTVPLDQDKVLFFKKAIEDMACSSLRCVSIAYRTYDMDKVPADEQQLTQWVIPQD  681

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  682  DLVLLAIIGIKDPCRPGVR  700



>ref|XP_006372180.1| hypothetical protein POPTR_0018s13650g [Populus trichocarpa]
 gb|ERP49977.1| hypothetical protein POPTR_0018s13650g [Populus trichocarpa]
Length=972

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A+ GGK+++ P+ KSQLP  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ 
Sbjct  515  EAFSGGKKMDLPESKSQLPPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMG  574

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RSES++IH FPFNSEKK+GGVA++L +S+VHIHWKGAAEIVL+ CT Y
Sbjct  575  WAIKLGMNFDAVRSESNVIHVFPFNSEKKKGGVALQLPNSQVHIHWKGAAEIVLASCTKY  634

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+ N VPLD+++   FKKAIEDMA  SLRCV++AY +YDMDK+P  E++L++W +P+ 
Sbjct  635  VDASGNTVPLDQDKVSFFKKAIEDMACSSLRCVSIAYRTYDMDKVPADEQQLAQWVIPQD  694

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  695  DLVLLAIIGIKDPCRPGVR  713



>gb|EYU18198.1| hypothetical protein MIMGU_mgv1a000743mg [Erythranthe guttata]
Length=997

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 169/199 (85%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            + Y  G +++ P++KS +P +VI LL+EGIAQN+TGSVFVPEGG   E+SGSPTEKAILQ
Sbjct  412  EVYACGNKMDSPENKSLVPPRVISLLIEGIAQNSTGSVFVPEGGGALEISGSPTEKAILQ  471

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + + LG++F + RS+S IIHAFPFNSEKKRGGVAVKL +SEVH+HWKGAAE+VL+ CT Y
Sbjct  472  WAINLGMDFGSARSDSVIIHAFPFNSEKKRGGVAVKLSNSEVHVHWKGAAEMVLASCTSY  531

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            IDANDNVV +DE++   FKKAIEDMA  SLRCVA+AY + +M+K+P ++EEL +W+LPE 
Sbjct  532  IDANDNVVQMDEDKVAYFKKAIEDMAVGSLRCVAIAYRTCEMEKVPTNDEELEKWQLPED  591

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGVR
Sbjct  592  DLILLAIVGIKDPCRPGVR  610



>ref|XP_006600472.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X6 [Glycine max]
Length=887

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGG-KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +A+IGG K+I  P D SQ  + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL
Sbjct  313  EAWIGGGKKIADPHDVSQFSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAIL  372

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            ++GVKLG+NFD  RS+SSIIH FPFNS+KKRGGVA  + DSEVHIHWKGAAEIVL+CCT 
Sbjct  373  EWGVKLGMNFDTARSKSSIIHVFPFNSDKKRGGVATWVSDSEVHIHWKGAAEIVLACCTR  432

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y DAND +V +DE +  +FKKAIEDMA +SLRCVA+AY SY+M  +P SEEEL+ W LPE
Sbjct  433  YFDANDQLVEMDEAKMSTFKKAIEDMAADSLRCVAIAYRSYEMKNVPTSEEELAHWSLPE  492

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LLAI+G+KDPCRPGV+
Sbjct  493  DDLVLLAIIGLKDPCRPGVK  512



>ref|XP_002325251.2| Calcium-transporting ATPase 8 family protein [Populus trichocarpa]
 gb|EEF03816.2| Calcium-transporting ATPase 8 family protein [Populus trichocarpa]
Length=1107

 Score =   286 bits (731),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A+ GGK+++ P+ KSQLP  +  LL+EGIAQNTTGSVFVPEGG   E+SGSPTEKAI+ 
Sbjct  515  EAFSGGKKMDLPESKSQLPPILSSLLIEGIAQNTTGSVFVPEGGGDLEISGSPTEKAIMG  574

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RSES++IH FPFNSEKK+GGVA++L +S+VHIHWKGAAEIVL+ CT Y
Sbjct  575  WAIKLGMNFDAVRSESNVIHVFPFNSEKKKGGVALQLPNSQVHIHWKGAAEIVLASCTKY  634

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+ N VPLD+++   FKKAIEDMA  SLRCV++AY +YDMDK+P  E++L++W +P+ 
Sbjct  635  VDASGNTVPLDQDKVSFFKKAIEDMACSSLRCVSIAYRTYDMDKVPADEQQLAQWVIPQD  694

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  695  DLVLLAIIGIKDPCRPGVR  713



>ref|XP_006600468.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Glycine max]
Length=1105

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGG-KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +A+IGG K+I  P D SQ  + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL
Sbjct  531  EAWIGGGKKIADPHDVSQFSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAIL  590

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            ++GVKLG+NFD  RS+SSIIH FPFNS+KKRGGVA  + DSEVHIHWKGAAEIVL+CCT 
Sbjct  591  EWGVKLGMNFDTARSKSSIIHVFPFNSDKKRGGVATWVSDSEVHIHWKGAAEIVLACCTR  650

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y DAND +V +DE +  +FKKAIEDMA +SLRCVA+AY SY+M  +P SEEEL+ W LPE
Sbjct  651  YFDANDQLVEMDEAKMSTFKKAIEDMAADSLRCVAIAYRSYEMKNVPTSEEELAHWSLPE  710

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LLAI+G+KDPCRPGV+
Sbjct  711  DDLVLLAIIGLKDPCRPGVK  730



>gb|KHN17641.1| Calcium-transporting ATPase 10, plasma membrane-type [Glycine 
soja]
Length=1070

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGG-KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +A+IGG K+I  P D SQ  + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL
Sbjct  523  EAWIGGGKKIADPHDVSQFSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAIL  582

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            ++GVKLG+NFD  RS+SSIIH FPFNS+KKRGGVA  + DSEVHIHWKGAAEIVL+CCT 
Sbjct  583  EWGVKLGMNFDTARSKSSIIHVFPFNSDKKRGGVATWVSDSEVHIHWKGAAEIVLACCTR  642

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y DAND +V +DE +  +FKKAIEDMA +SLRCVA+AY SY+M  +P SEEEL+ W LPE
Sbjct  643  YFDANDQLVEMDEAKMSTFKKAIEDMAADSLRCVAIAYRSYEMKNVPTSEEELAHWSLPE  702

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LLAI+G+KDPCRPGV+
Sbjct  703  DDLVLLAIIGLKDPCRPGVK  722



>ref|XP_007154697.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
 ref|XP_007154698.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
 gb|ESW26691.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
 gb|ESW26692.1| hypothetical protein PHAVU_003G140200g [Phaseolus vulgaris]
Length=1082

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A IGGK+I PPDD  Q    +  LL+EG+AQNT GSV+VPEGG   E+SGSPTEKAIL 
Sbjct  511  EACIGGKKIIPPDDSQQFSAMLRSLLIEGVAQNTNGSVYVPEGGNDVEISGSPTEKAILD  570

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ FDA RSESSIIH FPFNSEKKRGGVA+++ DSE+HIHWKGAAEIVL+CCT Y
Sbjct  571  WGIKLGMRFDAARSESSIIHVFPFNSEKKRGGVAIQMPDSEIHIHWKGAAEIVLACCTGY  630

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID ND +V +DE +   FKKAIEDMA +SLRCVA+AY SY+M+ +P S EEL+ W LP+ 
Sbjct  631  IDVNDQLVEMDEEKMSQFKKAIEDMAADSLRCVAIAYRSYEMENVPTS-EELAHWSLPDN  689

Query  535  DLILLAILGIKDPCRPGVR  591
            DL LLAI+G+KDPCRPGV+
Sbjct  690  DLFLLAIIGLKDPCRPGVK  708



>ref|XP_003549287.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006600469.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Glycine max]
 ref|XP_006600470.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Glycine max]
 ref|XP_006600471.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X5 [Glycine max]
Length=1074

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGG-KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +A+IGG K+I  P D SQ  + +  LL+EG+AQNT GSV++PEGG   E+SGSPTEKAIL
Sbjct  500  EAWIGGGKKIADPHDVSQFSRMLCSLLIEGVAQNTNGSVYIPEGGNDVEISGSPTEKAIL  559

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            ++GVKLG+NFD  RS+SSIIH FPFNS+KKRGGVA  + DSEVHIHWKGAAEIVL+CCT 
Sbjct  560  EWGVKLGMNFDTARSKSSIIHVFPFNSDKKRGGVATWVSDSEVHIHWKGAAEIVLACCTR  619

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y DAND +V +DE +  +FKKAIEDMA +SLRCVA+AY SY+M  +P SEEEL+ W LPE
Sbjct  620  YFDANDQLVEMDEAKMSTFKKAIEDMAADSLRCVAIAYRSYEMKNVPTSEEELAHWSLPE  679

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LLAI+G+KDPCRPGV+
Sbjct  680  DDLVLLAIIGLKDPCRPGVK  699



>ref|XP_010094240.1| Calcium-transporting ATPase 10, plasma membrane-type [Morus notabilis]
 gb|EXB55438.1| Calcium-transporting ATPase 10, plasma membrane-type [Morus notabilis]
Length=1124

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 168/199 (84%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY GGK+++ PD+KS LP  V  LL+EGIAQNT G V+VPE GG  EVSGSPTEKAI+ 
Sbjct  479  EAYAGGKKVDTPDNKSGLPPLVSSLLIEGIAQNTNGGVYVPENGGEIEVSGSPTEKAIIS  538

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+++G+NF+A RSESSI+H FPFNSEKKRGGVAVKL DS+VH+HWKGAAE+VL+ CT Y
Sbjct  539  WGIQIGMNFEAARSESSILHVFPFNSEKKRGGVAVKLPDSQVHVHWKGAAEMVLASCTQY  598

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID  ++VV +D+++   FK+AIEDMA  +LRCVA+AY +Y+++++P  EEELSRW LPE 
Sbjct  599  IDDTNHVVAMDDDQVTFFKRAIEDMAARTLRCVAIAYRTYELERVPTDEEELSRWALPED  658

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  659  NLILLAIVGIKDPCRPGVR  677



>gb|KHN22652.1| Calcium-transporting ATPase 8, plasma membrane-type [Glycine 
soja]
Length=1072

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 167/200 (84%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGG-KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +A+IGG K+I PP ++S+    +  LL+EG+AQNT GSV++PEGG   EVSGSPTEKAIL
Sbjct  500  EAWIGGGKKIVPPYEESKFSHMLCSLLIEGVAQNTNGSVYIPEGGNDVEVSGSPTEKAIL  559

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            ++G+KLG+NFD  RS+SSIIH FPFNS+KKRGGVA ++ DSE+HIHWKGAAEIVL+CCT 
Sbjct  560  EWGIKLGMNFDTARSDSSIIHVFPFNSDKKRGGVATRVSDSEIHIHWKGAAEIVLACCTR  619

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y DAND +V +DE +  +FKKAIEDMA +SLRCVA+AY SY+M  +P SEEELS W LPE
Sbjct  620  YFDANDQLVEMDEAKMSTFKKAIEDMAADSLRCVAIAYRSYEMKNVPISEEELSHWSLPE  679

Query  532  GDLILLAILGIKDPCRPGVR  591
             +L+LLAI+G+KDPCRPGV+
Sbjct  680  DNLVLLAIIGLKDPCRPGVK  699



>ref|XP_011094123.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094124.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094125.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094126.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
 ref|XP_011094127.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Sesamum indicum]
Length=1095

 Score =   283 bits (724),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +AY  GK+I+PPD+KS LP  VI LL+EG+AQNTTGSVFVPEGG   EVSGSPTEKAILQ
Sbjct  506  EAYACGKKIDPPDNKSLLPPSVISLLVEGVAQNTTGSVFVPEGGGALEVSGSPTEKAILQ  565

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+ LG++F   RSES IIHAFPFNSEKKRGGVAVK  DSE+ +HWKGAAEIVL+ CT Y
Sbjct  566  WGLNLGMDFSGARSESEIIHAFPFNSEKKRGGVAVKRSDSEIRVHWKGAAEIVLASCTSY  625

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID +D+VV +DE++   FKKAIEDMA  SLRCVA+AY   + D++P S+EEL  W+LPEG
Sbjct  626  IDPDDSVVQMDEDKLSLFKKAIEDMAARSLRCVAIAYRICEKDEVPTSDEELENWQLPEG  685

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRP VR
Sbjct  686  DLILLAIVGIKDPCRPFVR  704



>ref|XP_011094128.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X2 [Sesamum indicum]
Length=1093

 Score =   283 bits (724),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +AY  GK+I+PPD+KS LP  VI LL+EG+AQNTTGSVFVPEGG   EVSGSPTEKAILQ
Sbjct  504  EAYACGKKIDPPDNKSLLPPSVISLLVEGVAQNTTGSVFVPEGGGALEVSGSPTEKAILQ  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+ LG++F   RSES IIHAFPFNSEKKRGGVAVK  DSE+ +HWKGAAEIVL+ CT Y
Sbjct  564  WGLNLGMDFSGARSESEIIHAFPFNSEKKRGGVAVKRSDSEIRVHWKGAAEIVLASCTSY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID +D+VV +DE++   FKKAIEDMA  SLRCVA+AY   + D++P S+EEL  W+LPEG
Sbjct  624  IDPDDSVVQMDEDKLSLFKKAIEDMAARSLRCVAIAYRICEKDEVPTSDEELENWQLPEG  683

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRP VR
Sbjct  684  DLILLAIVGIKDPCRPFVR  702



>ref|XP_006593507.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X7 [Glycine max]
Length=987

 Score =   281 bits (719),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGG-KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +A+IGG K+I PP ++S+    +  LL+EG+AQNT GSV++ EGG   EVSGSPTEKAIL
Sbjct  500  EAWIGGGKKIVPPYEESKFSHMLCSLLIEGVAQNTNGSVYIAEGGNDVEVSGSPTEKAIL  559

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            ++G+KLG+NFD  RS+SSIIH FPFNS+KKRGGVA ++ DSE+HIHWKGAAEIVL+CCT 
Sbjct  560  EWGIKLGMNFDTARSDSSIIHVFPFNSDKKRGGVATRVSDSEIHIHWKGAAEIVLACCTR  619

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y DAND +V +DE +  +FKKAIEDMA +SLRCVA+AY SY+M  +P SEEELS W LPE
Sbjct  620  YFDANDQLVEMDEAKMSTFKKAIEDMAADSLRCVAIAYRSYEMKNVPTSEEELSHWSLPE  679

Query  532  GDLILLAILGIKDPCRPGVR  591
             +L+LLAI+G+KDPCRPGV+
Sbjct  680  DNLVLLAIIGLKDPCRPGVK  699



>ref|XP_003543731.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006593502.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Glycine max]
 ref|XP_006593503.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Glycine max]
 ref|XP_006593504.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Glycine max]
 ref|XP_006593505.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X5 [Glycine max]
 ref|XP_006593506.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X6 [Glycine max]
Length=1074

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGG-KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +A+IGG K+I PP ++S+    +  LL+EG+AQNT GSV++ EGG   EVSGSPTEKAIL
Sbjct  500  EAWIGGGKKIVPPYEESKFSHMLCSLLIEGVAQNTNGSVYIAEGGNDVEVSGSPTEKAIL  559

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            ++G+KLG+NFD  RS+SSIIH FPFNS+KKRGGVA ++ DSE+HIHWKGAAEIVL+CCT 
Sbjct  560  EWGIKLGMNFDTARSDSSIIHVFPFNSDKKRGGVATRVSDSEIHIHWKGAAEIVLACCTR  619

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y DAND +V +DE +  +FKKAIEDMA +SLRCVA+AY SY+M  +P SEEELS W LPE
Sbjct  620  YFDANDQLVEMDEAKMSTFKKAIEDMAADSLRCVAIAYRSYEMKNVPTSEEELSHWSLPE  679

Query  532  GDLILLAILGIKDPCRPGVR  591
             +L+LLAI+G+KDPCRPGV+
Sbjct  680  DNLVLLAIIGLKDPCRPGVK  699



>gb|KCW80852.1| hypothetical protein EUGRSUZ_C02215 [Eucalyptus grandis]
Length=1062

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY+GG +++ P   SQLP  ++ LL+EGIAQNT GSVF PEGG   EVSGSPTEKAIL+
Sbjct  504  EAYVGGVKVDSPYSSSQLPMTMVSLLIEGIAQNTNGSVFTPEGGKDVEVSGSPTEKAILR  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G++LG+NF+A R E+SIIH FPFNSEKKRGGVA+KL +SEVH+HWKGAAEIVLS CT Y
Sbjct  564  WGLELGMNFEATRLEASIIHVFPFNSEKKRGGVALKLTNSEVHVHWKGAAEIVLSSCTRY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N  V  LDE + + F+KAIEDMA  SLRCVA+AY +YD + IP  EE+L++W LPE 
Sbjct  624  LDLNGQVAALDETKVVVFEKAIEDMAASSLRCVAIAYRTYDFEDIPTDEEQLTKWALPED  683

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+G+KDPCRPGV+
Sbjct  684  ELILLAIVGLKDPCRPGVK  702



>ref|XP_006453219.1| hypothetical protein CICLE_v10007305mg [Citrus clementina]
 ref|XP_006474293.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474294.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Citrus sinensis]
 ref|XP_006474295.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Citrus sinensis]
 ref|XP_006474296.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Citrus sinensis]
 ref|XP_006474297.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X5 [Citrus sinensis]
 ref|XP_006474298.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X6 [Citrus sinensis]
 gb|ESR66459.1| hypothetical protein CICLE_v10007305mg [Citrus clementina]
Length=1072

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 169/199 (85%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+GG++I+P D  SQL   V  LL+EGIAQNTTGSV++P  GG  EVSGSPTEKAILQ
Sbjct  496  EAYVGGRKIDPTDSNSQLSPMVTSLLVEGIAQNTTGSVYLPPNGGEAEVSGSPTEKAILQ  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+A+RSE S++H FPFNS KKRGGVAV+L +SEVHIHWKGAAEIVL  CT Y
Sbjct  556  WGMKLGMNFEAVRSECSVLHVFPFNSLKKRGGVAVQLPNSEVHIHWKGAAEIVLDSCTRY  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID +D++V +DE++ ++FKKAIEDMA+ SLRCVA+AY +Y+ +++P  EEELSRW LPE 
Sbjct  616  IDTDDHLVEMDEDKLLTFKKAIEDMASCSLRCVAIAYRTYERERVP-DEEELSRWALPED  674

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRP V+
Sbjct  675  NLVLLAIVGIKDPCRPSVK  693



>ref|XP_010048572.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW80851.1| hypothetical protein EUGRSUZ_C02215 [Eucalyptus grandis]
Length=1079

 Score =   280 bits (717),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY+GG +++ P   SQLP  ++ LL+EGIAQNT GSVF PEGG   EVSGSPTEKAIL+
Sbjct  504  EAYVGGVKVDSPYSSSQLPMTMVSLLIEGIAQNTNGSVFTPEGGKDVEVSGSPTEKAILR  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G++LG+NF+A R E+SIIH FPFNSEKKRGGVA+KL +SEVH+HWKGAAEIVLS CT Y
Sbjct  564  WGLELGMNFEATRLEASIIHVFPFNSEKKRGGVALKLTNSEVHVHWKGAAEIVLSSCTRY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N  V  LDE + + F+KAIEDMA  SLRCVA+AY +YD + IP  EE+L++W LPE 
Sbjct  624  LDLNGQVAALDETKVVVFEKAIEDMAASSLRCVAIAYRTYDFEDIPTDEEQLTKWALPED  683

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+G+KDPCRPGV+
Sbjct  684  ELILLAIVGLKDPCRPGVK  702



>ref|XP_010048570.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010048571.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Eucalyptus grandis]
Length=1072

 Score =   280 bits (717),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY+GG +++ P   SQLP  ++ LL+EGIAQNT GSVF PEGG   EVSGSPTEKAIL+
Sbjct  497  EAYVGGVKVDSPYSSSQLPMTMVSLLIEGIAQNTNGSVFTPEGGKDVEVSGSPTEKAILR  556

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G++LG+NF+A R E+SIIH FPFNSEKKRGGVA+KL +SEVH+HWKGAAEIVLS CT Y
Sbjct  557  WGLELGMNFEATRLEASIIHVFPFNSEKKRGGVALKLTNSEVHVHWKGAAEIVLSSCTRY  616

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N  V  LDE + + F+KAIEDMA  SLRCVA+AY +YD + IP  EE+L++W LPE 
Sbjct  617  LDLNGQVAALDETKVVVFEKAIEDMAASSLRCVAIAYRTYDFEDIPTDEEQLTKWALPED  676

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+G+KDPCRPGV+
Sbjct  677  ELILLAIVGLKDPCRPGVK  695



>ref|XP_010046911.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
 ref|XP_010046912.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
 ref|XP_010046913.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
Length=1072

 Score =   280 bits (716),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY  G++++PPD  SQL   +I LL+EGIAQN+ GSV+VPE GG  EVSGSPTEKAILQ
Sbjct  499  EAYACGRKVDPPDSNSQLSTSLISLLIEGIAQNSNGSVYVPEAGGDVEVSGSPTEKAILQ  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++F+A+RS+SSIIH FPFNSEKKR GVAVKL DSE HIHWKGAAEIVL+ CT Y
Sbjct  559  WGIKLGMDFEAVRSKSSIIHVFPFNSEKKRAGVAVKLPDSEAHIHWKGAAEIVLASCTKY  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DAND VV +D ++ + F+K IEDMA  SLRC+A+AY  YD+  IP  EE L++W LPE 
Sbjct  619  MDANDQVVAMDGDKEMYFRKTIEDMAAGSLRCIAIAYRPYDIKDIPLDEERLAKWALPED  678

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGV+
Sbjct  679  ELILLAIVGIKDPCRPGVK  697



>ref|XP_010687432.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1085

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY  GK+++PP+D S L   +  +L+EG+AQNTTG VF+PEGG   E+SGSPTEKAIL 
Sbjct  510  EAYANGKKVDPPNDGSLLSPMLSSVLIEGVAQNTTGCVFLPEGGGDVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+A RSES+IIHAFPFNSEKKRGGVAVK   SEVHIHWKGAAEIVL+ C+ Y
Sbjct  570  WGVKLGMNFEAKRSESTIIHAFPFNSEKKRGGVAVKTHGSEVHIHWKGAAEIVLASCSSY  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D  D+V+ LDEN+   FKKAIE MA +SLRCVA+AY S +MDK+P  EE++S+W LPE 
Sbjct  630  MDEKDSVMALDENKLAFFKKAIEQMAVQSLRCVALAYRSCEMDKVPSDEEQMSQWVLPED  689

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  690  ELILLAIVGIKDPCRPGVR  708



>ref|XP_010687434.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1074

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY  GK+++PP+D S L   +  +L+EG+AQNTTG VF+PEGG   E+SGSPTEKAIL 
Sbjct  499  EAYANGKKVDPPNDGSLLSPMLSSVLIEGVAQNTTGCVFLPEGGGDVEISGSPTEKAILS  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+A RSES+IIHAFPFNSEKKRGGVAVK   SEVHIHWKGAAEIVL+ C+ Y
Sbjct  559  WGVKLGMNFEAKRSESTIIHAFPFNSEKKRGGVAVKTHGSEVHIHWKGAAEIVLASCSSY  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D  D+V+ LDEN+   FKKAIE MA +SLRCVA+AY S +MDK+P  EE++S+W LPE 
Sbjct  619  MDEKDSVMALDENKLAFFKKAIEQMAVQSLRCVALAYRSCEMDKVPSDEEQMSQWVLPED  678

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  679  ELILLAIVGIKDPCRPGVR  697



>ref|XP_008223854.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
 ref|XP_008223855.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
 ref|XP_008223856.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
 ref|XP_008223857.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Prunus mume]
Length=1080

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 168/199 (84%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+ GGK+I+  D+KS L   +  LL+EGIA NTTGSV+VPE GG  EVSGSPTEKAILQ
Sbjct  499  EAFTGGKKIDISDNKSDLSPMLSALLVEGIALNTTGSVYVPETGGDIEVSGSPTEKAILQ  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+AI+SESS++H FPFNSEKKRGG AVKL +SEVHIHWKGAAEIVL+ CT Y
Sbjct  559  WGIKLGMNFEAIKSESSVLHVFPFNSEKKRGGAAVKLPNSEVHIHWKGAAEIVLASCTKY  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DAND +  +D+++++ F+++IEDMA  SLRCVA+AY SY+++ +P  E++L+ W LP+ 
Sbjct  619  LDANDQLAAMDDDKSMMFRESIEDMAARSLRCVAIAYRSYELESVPTDEQQLALWALPDD  678

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  679  DLVLLAIVGIKDPCRPGVR  697



>gb|KCW77157.1| hypothetical protein EUGRSUZ_D01503 [Eucalyptus grandis]
Length=1052

 Score =   277 bits (708),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 163/198 (82%), Gaps = 2/198 (1%)
 Frame = +1

Query  4    AYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQF  180
            AY  G+++NPPD  SQL   +I LL+EGIAQN+ GSV+VPE GG  EVSGSPTEKAILQ+
Sbjct  487  AYACGRKVNPPDSNSQLSTSLISLLIEGIAQNSNGSVYVPETGGDVEVSGSPTEKAILQW  546

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
            G+KLG++F+ +RS SSII  FPFNS+KKRGGVAVKL +SEV IHWKGAAEIVL+ CT Y+
Sbjct  547  GIKLGMDFEVVRSRSSIIRVFPFNSDKKRGGVAVKLPNSEVRIHWKGAAEIVLAACTKYM  606

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            DAND VV +DE++ + F+KAI+DMA  SLRCVA+AY  YD+  IP  EE+L+ W LPE +
Sbjct  607  DANDQVVEMDEDKKMDFEKAIKDMAVGSLRCVAIAYRLYDIKDIPLDEEQLTEWALPEDE  666

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAILG+KDPCRPGV+
Sbjct  667  LILLAILGMKDPCRPGVK  684



>ref|XP_010536881.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010536882.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010536883.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010536884.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Tarenaya hassleriana]
Length=1080

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY GG +++ PDD SQLP ++  LL+EG+AQNTTG V+VPE GG  E+SGSPTEKAIL 
Sbjct  496  EAYAGGDKMDTPDDSSQLPPELNSLLVEGVAQNTTGGVYVPESGGNVELSGSPTEKAILG  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS+SSI+H FPFNSEKKRGGVAVKL D +VHIHWKGA+EIVL+ C  Y
Sbjct  556  WGIKLGMDFDAVRSQSSILHVFPFNSEKKRGGVAVKLPDGQVHIHWKGASEIVLASCKSY  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D   NV  + E++   FK AIEDMA  +LRCVA+AY +Y+++K+P SEEELS+W LPE 
Sbjct  616  MDEGGNVTEMTEDKVSYFKNAIEDMAARTLRCVALAYRTYEVEKVPTSEEELSKWVLPED  675

Query  535  DLILLAILGIKDPCRPGVR  591
            DL LLAI+GIKDPCRPGVR
Sbjct  676  DLCLLAIVGIKDPCRPGVR  694



>ref|XP_010046915.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
Length=1086

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 8/205 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-------GGVPEVSGSPT  159
            +A+   ++++PPD  SQ    +I LL+EGIAQN+ GSV+VPE        G PEVSGSPT
Sbjct  498  EAFACERKVDPPDSNSQPSTSLISLLIEGIAQNSNGSVYVPETGGDVEVSGSPEVSGSPT  557

Query  160  EKAILQFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVL  336
            EKAILQ+G+KLG++F+AIRS SSII  FPFNSEKKRGG AVKL DSEVHIHWKGAAEIVL
Sbjct  558  EKAILQWGIKLGMDFEAIRSRSSIIRVFPFNSEKKRGGAAVKLPDSEVHIHWKGAAEIVL  617

Query  337  SCCTHYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSR  516
            + CT Y+DAND V  +DEN  + F+KAI+DMA  SLRCVA+AY  YD+  IP  EE+L++
Sbjct  618  ASCTKYMDANDQVAAMDENMKMYFRKAIQDMAASSLRCVAIAYRPYDVKDIPLDEEQLTK  677

Query  517  WELPEGDLILLAILGIKDPCRPGVR  591
            W LPE +LILLAI+GIKDPCRPGV+
Sbjct  678  WALPEDELILLAIVGIKDPCRPGVK  702



>ref|XP_003533744.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006587001.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Glycine max]
 ref|XP_006587002.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X3 [Glycine max]
 ref|XP_006587003.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X4 [Glycine max]
Length=1085

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 161/200 (81%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP--EVSGSPTEKAIL  174
            +AY GGK+I+PP      P  +  LL+EG+AQNT GSV+ PEG     EVSGSPTEKAIL
Sbjct  506  EAYAGGKKIDPPHKLESYPM-LRSLLIEGVAQNTNGSVYAPEGAANDVEVSGSPTEKAIL  564

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
            Q+G+++G+NF A RSESSIIH FPFNSEKKRGGVA++  DS +HIHWKGAAEIVL+CCT 
Sbjct  565  QWGIQIGMNFTAARSESSIIHVFPFNSEKKRGGVAIQTADSNIHIHWKGAAEIVLACCTG  624

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D ND +V +DE +   FKKAIEDMA +SLRCVA+AY SY+ +K+P +EE LS+W LPE
Sbjct  625  YVDVNDQLVGMDEEKMTFFKKAIEDMAADSLRCVAIAYRSYEKEKVPTNEELLSQWSLPE  684

Query  532  GDLILLAILGIKDPCRPGVR  591
             DLILLAI+G+KDPCRPGV+
Sbjct  685  DDLILLAIVGLKDPCRPGVK  704



>ref|XP_007227032.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
 gb|EMJ28231.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
Length=1029

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+ GGK+I+  D+KS L   +  LL+EGIA NTTGSV+VPE GG  EVSGSPTEKAILQ
Sbjct  448  EAFTGGKKIDVSDNKSDLSPMLSALLIEGIALNTTGSVYVPETGGDIEVSGSPTEKAILQ  507

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+AI+SES ++H FPFNSEKKRGG AVKL +SEVHIHWKGAAEIVL+ CT Y
Sbjct  508  WGIKLGMNFEAIKSESLVLHVFPFNSEKKRGGAAVKLPNSEVHIHWKGAAEIVLASCTKY  567

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DAND +  +D+++++ F+++IEDMA  SLRCVA+AY SY+++ +P  E++L+ W LP+ 
Sbjct  568  LDANDQLAAMDDDKSMMFRESIEDMAARSLRCVAIAYRSYELESVPTDEQQLALWALPDD  627

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  628  DLVLLAIVGIKDPCRPGVR  646



>emb|CBI17890.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = +1

Query  4    AYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQF  180
            AY GGK+I+ PD  S     +  LL+EGIAQNT GSVF+PEGG   EVSGSPTEKAIL +
Sbjct  502  AYAGGKKIDTPDRGSLSSSLLSSLLIEGIAQNTNGSVFIPEGGGDVEVSGSPTEKAILNW  561

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
            G+K+G+NF+A+RS SSII  FPFNSEKKRGGVA+KL DS+VH+HWKGAAEIVL+ CT YI
Sbjct  562  GIKIGMNFEAVRSGSSIIQVFPFNSEKKRGGVAIKLPDSQVHLHWKGAAEIVLASCTRYI  621

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D NDNVVP+ E++ + FKKAIEDMA  SLRCVA+AY  Y+M+ +P  EE+L +W LPE D
Sbjct  622  DENDNVVPMTEDKVLFFKKAIEDMAAGSLRCVAIAYRPYEMENVPTDEEQLDQWVLPEDD  681

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGVR
Sbjct  682  LVLLAIVGIKDPCRPGVR  699



>ref|XP_002262829.2| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Vitis vinifera]
 ref|XP_010656879.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Vitis vinifera]
Length=1078

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = +1

Query  4    AYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQF  180
            AY GGK+I+ PD  S     +  LL+EGIAQNT GSVF+PEGG   EVSGSPTEKAIL +
Sbjct  502  AYAGGKKIDTPDRGSLSSSLLSSLLIEGIAQNTNGSVFIPEGGGDVEVSGSPTEKAILNW  561

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
            G+K+G+NF+A+RS SSII  FPFNSEKKRGGVA+KL DS+VH+HWKGAAEIVL+ CT YI
Sbjct  562  GIKIGMNFEAVRSGSSIIQVFPFNSEKKRGGVAIKLPDSQVHLHWKGAAEIVLASCTRYI  621

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D NDNVVP+ E++ + FKKAIEDMA  SLRCVA+AY  Y+M+ +P  EE+L +W LPE D
Sbjct  622  DENDNVVPMTEDKVLFFKKAIEDMAAGSLRCVAIAYRPYEMENVPTDEEQLDQWVLPEDD  681

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGVR
Sbjct  682  LVLLAIVGIKDPCRPGVR  699



>ref|XP_007227033.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
 gb|EMJ28232.1| hypothetical protein PRUPE_ppa000670mg [Prunus persica]
Length=1041

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+ GGK+I+  D+KS L   +  LL+EGIA NTTGSV+VPE GG  EVSGSPTEKAILQ
Sbjct  448  EAFTGGKKIDVSDNKSDLSPMLSALLIEGIALNTTGSVYVPETGGDIEVSGSPTEKAILQ  507

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+AI+SES ++H FPFNSEKKRGG AVKL +SEVHIHWKGAAEIVL+ CT Y
Sbjct  508  WGIKLGMNFEAIKSESLVLHVFPFNSEKKRGGAAVKLPNSEVHIHWKGAAEIVLASCTKY  567

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DAND +  +D+++++ F+++IEDMA  SLRCVA+AY SY+++ +P  E++L+ W LP+ 
Sbjct  568  LDANDQLAAMDDDKSMMFRESIEDMAARSLRCVAIAYRSYELESVPTDEQQLALWALPDD  627

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  628  DLVLLAIVGIKDPCRPGVR  646



>ref|XP_007014494.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 ref|XP_007014495.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 ref|XP_007014496.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 gb|EOY32113.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 gb|EOY32114.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
 gb|EOY32115.1| Autoinhibited Ca(2+)-ATPase 10 isoform 1 [Theobroma cacao]
Length=1082

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY+GG++I+PPD  S+LP  +  LL+E +A N  GSVF P+GG   EVSGSPTEKAIL 
Sbjct  501  EAYVGGRKIDPPDSSSELPDMLTLLLVEAVAVNANGSVFTPDGGGDVEVSGSPTEKAILN  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ C+ Y
Sbjct  561  WAIKLGMNFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACSWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D +D VV +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL+RW LPE 
Sbjct  621  LDTDDGVVAMDEEKVAFFEKAIESMAAGSLRCVAIAYRSYESEKVPTNEEELARWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+G+KDPCRPGV+
Sbjct  681  DLVLLAIVGLKDPCRPGVQ  699



>ref|XP_006585663.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Glycine max]
 ref|XP_006585664.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Glycine max]
Length=1092

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++NPPDD S+L  K + L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL 
Sbjct  512  EAYVGSTKVNPPDDSSKLHPKALSLINEGIAQNTTGNVFVPKDGGETEVSGSPTEKAILS  571

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+++H FPFNSEKKRGGVA+KL DS +HIHWKGAAEIVL  CT Y
Sbjct  572  WAVKLGMNFDVIRSNSTVLHVFPFNSEKKRGGVALKLGDSGIHIHWKGAAEIVLGTCTQY  631

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++  +  ++E++   FK AI+DMA  SLRCVA+AY SY++DK+P SE++L +W LPE 
Sbjct  632  LDSDGQLQSIEEDKKAFFKDAIDDMAARSLRCVAIAYRSYELDKVPSSEQDLDQWSLPEY  691

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  692  ELVLLAIVGIKDPCRPGVK  710



>gb|KHN38078.1| Calcium-transporting ATPase 9, plasma membrane-type [Glycine 
soja]
Length=1069

 Score =   273 bits (699),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++NPPDD S+L  K + L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL 
Sbjct  489  EAYVGSTKVNPPDDSSKLHPKALSLINEGIAQNTTGNVFVPKDGGETEVSGSPTEKAILS  548

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+++H FPFNSEKKRGGVA+KL DS +HIHWKGAAEIVL  CT Y
Sbjct  549  WAVKLGMNFDVIRSNSTVLHVFPFNSEKKRGGVALKLGDSGIHIHWKGAAEIVLGTCTQY  608

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++  +  ++E++   FK AI+DMA  SLRCVA+AY SY++DK+P SE++L +W LPE 
Sbjct  609  LDSDGQLQSIEEDKKAFFKDAIDDMAARSLRCVAIAYRSYELDKVPSSEQDLDQWSLPEY  668

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  669  ELVLLAIVGIKDPCRPGVK  687



>ref|XP_006597086.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Glycine max]
Length=1091

 Score =   273 bits (699),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A +G K++NPPDD ++L  +V+ L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL 
Sbjct  518  EACVGRKKLNPPDDLTKLHPEVLSLINEGIAQNTTGNVFVPKDGGEVEVSGSPTEKAILS  577

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+I+H FPFNSEKKRGG+A+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  578  WAVKLGMNFDLIRSNSTILHVFPFNSEKKRGGLALKLPDSAVHIHWKGAAEIVLGTCTQY  637

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++ ++  ++E E + FK +IEDMA +SLRCVA+AY SYD+DKIP +EEEL +W LPE 
Sbjct  638  LDSDGHLKSIEE-EKVFFKNSIEDMAAQSLRCVAIAYRSYDLDKIPSNEEELDQWSLPEH  696

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  697  ELVLLAIVGIKDPCRPGVK  715



>ref|XP_004486584.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Cicer arietinum]
Length=1091

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K++NPPDD S+L  +V+ L+ EGIAQNTTG++FVP +GG  EVSGSPTEKAIL 
Sbjct  516  EAYVGKKKLNPPDDSSKLHPEVLSLINEGIAQNTTGNIFVPKDGGEAEVSGSPTEKAILS  575

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NF+ IRS S I+H FPFNSEKKRGGVAVKL DS VHIHWKGAAEIVL  CT Y
Sbjct  576  WAMKLGMNFELIRSNSKILHVFPFNSEKKRGGVAVKLVDSGVHIHWKGAAEIVLGTCTQY  635

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N     ++E +A   KKAI+DMA +SLRCVA+AY SY++DKIP  EE+L +W LPE 
Sbjct  636  LDSNGQRQSIEEEKAF-LKKAIDDMAAQSLRCVAIAYRSYELDKIPSKEEDLDQWILPEH  694

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  695  ELVLLAIVGIKDPCRPGVK  713



>ref|XP_006595201.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Glycine max]
Length=1103

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K++NPPDD ++L  +V  L+ EGIAQNTTG++FVP +GG  EVSGSPTEKAIL 
Sbjct  523  EAFVGRKKLNPPDDLTKLHPEVSSLINEGIAQNTTGNIFVPKDGGEAEVSGSPTEKAILS  582

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+I+H FPFNSEKKRGG+A+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  583  WAVKLGMNFDLIRSNSTILHVFPFNSEKKRGGLALKLPDSAVHIHWKGAAEIVLGKCTQY  642

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++ ++  ++E E + FK AIEDMA +SLRCVA+AY SYD+DKIP +EEEL +W LPE 
Sbjct  643  LDSDGHLKSIEE-EKVFFKNAIEDMAAQSLRCVAIAYRSYDLDKIPSNEEELDQWCLPEH  701

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  702  ELVLLAIVGIKDPCRPGVK  720



>gb|KEH39694.1| calcium-transporting ATPase 9, plasma membrane-type protein [Medicago 
truncatula]
Length=878

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 165/200 (83%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGK-RINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAIL  174
            +AY GG+ ++NPPDD S+L  +V+ L+ EGIAQNTTG++F+P +GG  E+SGSPTEKAIL
Sbjct  516  EAYAGGREKLNPPDDSSKLHPEVLSLINEGIAQNTTGNIFIPKDGGETEISGSPTEKAIL  575

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
             + VKLG+NF+ +RS S I+H FPFNSEKKRGGVAVKL DSEVHIHWKGAAEIVL  CT 
Sbjct  576  SWAVKLGMNFELVRSRSKILHVFPFNSEKKRGGVAVKLADSEVHIHWKGAAEIVLGTCTQ  635

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N     ++E +A  F+KAI+DMA +SLRC+A+AY SY+++KIP  EE+L +W LP+
Sbjct  636  YLDSNGQRQSIEEEKAF-FRKAIDDMAAQSLRCIAIAYRSYELEKIPSKEEDLDQWSLPD  694

Query  532  GDLILLAILGIKDPCRPGVR  591
             +L+LLAI+GIKDPCRPGV+
Sbjct  695  HELVLLAIVGIKDPCRPGVK  714



>ref|XP_006598389.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Glycine max]
Length=1057

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY GGK+I+PP      P  +  LL+EG+AQNT GSV+ PEG    EVSGSPTEKAILQ
Sbjct  503  EAYAGGKKIDPPHKLESYPM-LRSLLIEGVAQNTNGSVYAPEGANDVEVSGSPTEKAILQ  561

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+++G+NF A RSESSIIH FPFNSEKKRGGVA++  D  +HIHWKGAAEIVL+CCT Y
Sbjct  562  WGIQIGMNFMAARSESSIIHVFPFNSEKKRGGVAIQTADCNIHIHWKGAAEIVLACCTGY  621

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND +V +DE +   FKKAIEDMA +SLRCVA+AY SY+ +K+P +EE LS W LPE 
Sbjct  622  VDVNDQLVGMDEEKMTFFKKAIEDMAADSLRCVAIAYRSYEKEKVPTNEELLSHWSLPED  681

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+G+KDPCRPGV+
Sbjct  682  DLILLAIVGLKDPCRPGVK  700



>gb|KHN31858.1| Calcium-transporting ATPase 9, plasma membrane-type [Glycine 
soja]
Length=1021

 Score =   271 bits (693),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 165/199 (83%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A +G K++NPPDD ++L  +V  L+ EGIAQNTTG++FVP +GG  EVSGSPTEKAIL 
Sbjct  489  EACVGRKKLNPPDDLTKLHPEVSSLINEGIAQNTTGNIFVPKDGGEAEVSGSPTEKAILS  548

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+I+H FPFNSEKKRGG+A+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  549  WAVKLGMNFDLIRSNSTILHVFPFNSEKKRGGLALKLPDSAVHIHWKGAAEIVLGKCTQY  608

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++ ++  ++E E + FK AIEDMA +SLRCVA+AY SYD+DKIP +EEEL +W LPE 
Sbjct  609  LDSDGHLKSIEE-EKVFFKNAIEDMAAQSLRCVAIAYRSYDLDKIPSNEEELDQWSLPEH  667

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  668  ELVLLAIVGIKDPCRPGVK  686



>ref|XP_010048692.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Eucalyptus grandis]
 gb|KCW81053.1| hypothetical protein EUGRSUZ_C02428 [Eucalyptus grandis]
Length=1033

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 159/199 (80%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A+IGG++++ P+  SQ P  ++ LL E IAQNT GSVF PEGG   E+SGSPTEKAIL 
Sbjct  458  EAHIGGEKMDSPNGSSQQPTTMVTLLTESIAQNTNGSVFTPEGGEDVEISGSPTEKAILS  517

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+  RS+SSIIH FPFNS+KKRGGVA+KL ++EVH+HWKGAAEIVLS CT Y
Sbjct  518  WGLKLGMNFEVTRSQSSIIHVFPFNSQKKRGGVALKLTETEVHVHWKGAAEIVLSSCTQY  577

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND V  LDE +   F KAIEDMA  SLRCVA+AY + D+  IP  EE+L++W LPE 
Sbjct  578  MDLNDQVAALDEEKFTYFTKAIEDMAASSLRCVAIAYRTIDLKDIPTDEEQLTKWALPED  637

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+G+KDPCRPGV+
Sbjct  638  ELILLAIVGLKDPCRPGVK  656



>gb|KJB21987.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21994.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=997

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL 
Sbjct  501  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILI  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  561  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  621  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  681  DLVLLAIVGIKDPCRPSVK  699



>gb|KHN22385.1| Calcium-transporting ATPase 9, plasma membrane-type [Glycine 
soja]
Length=1452

 Score =   273 bits (697),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A +G K++NPPDD ++L  +V+ L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL 
Sbjct  451  EACVGRKKLNPPDDLTKLHPEVLSLINEGIAQNTTGNVFVPKDGGEVEVSGSPTEKAILS  510

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+I+H FPFNSEKKRGG+A+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  511  WAVKLGMNFDLIRSNSTILHVFPFNSEKKRGGLALKLPDSAVHIHWKGAAEIVLGTCTQY  570

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++ ++  ++E E + FK +IEDMA +SLRCVA+AY SYD+DKIP +EEEL +W LPE 
Sbjct  571  LDSDGHLKSIEE-EKVFFKNSIEDMAAQSLRCVAIAYRSYDLDKIPSNEEELDQWSLPEH  629

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  630  ELVLLAIVGIKDPCRPGVK  648


 Score =   273 bits (697),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = +1

Query  1     DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
             +A +G K++NPPDD ++L  +V+ L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL 
Sbjct  918   EACVGRKKLNPPDDLTKLHPEVLSLINEGIAQNTTGNVFVPKDGGEVEVSGSPTEKAILS  977

Query  178   FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
             + VKLG+NFD IRS S+I+H FPFNSEKKRGG+A+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  978   WAVKLGMNFDLIRSNSTILHVFPFNSEKKRGGLALKLPDSAVHIHWKGAAEIVLGTCTQY  1037

Query  355   IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
             +D++ ++  ++E E + FK +IEDMA +SLRCVA+AY SYD+DKIP +EEEL +W LPE 
Sbjct  1038  LDSDGHLKSIEE-EKVFFKNSIEDMAAQSLRCVAIAYRSYDLDKIPSNEEELDQWSLPEH  1096

Query  535   DLILLAILGIKDPCRPGVR  591
             +L+LLAI+GIKDPCRPGV+
Sbjct  1097  ELVLLAIVGIKDPCRPGVK  1115



>ref|XP_010276717.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nelumbo nucifera]
 ref|XP_010276718.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Nelumbo nucifera]
Length=1074

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY+GG++++ PD+   L   +  LL+EGIAQNTTGSVF+PEGG   E+SGSPTEKAIL 
Sbjct  504  EAYVGGEKMDAPDNALLLSPTLSSLLIEGIAQNTTGSVFMPEGGGDVEISGSPTEKAILY  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ FD +RSESSI+H FPFNSEKKRGGVAV+L +SEVHIHWKGAAEIVL+ CT Y
Sbjct  564  WGVKLGMKFDRVRSESSILHVFPFNSEKKRGGVAVQLPNSEVHIHWKGAAEIVLASCTAY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N +  P+ E++  +F+KAIEDMA  SLRCVA+AY  YD+D +PK EEE + W+LPE 
Sbjct  624  LDKNGSREPMGEDKDKAFRKAIEDMAAGSLRCVAIAYRPYDLDNVPKEEEERAGWQLPED  683

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGVR
Sbjct  684  DLILLAIVGIKDPCRPGVR  702



>ref|XP_008227946.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Prunus mume]
Length=1098

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G K+IN PDD SQL  +V  LL EGIAQNTTG+VF P+GG  E+SGSPTEKAIL +
Sbjct  522  EAYVGKKKINLPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKGGEVEISGSPTEKAILSW  581

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
             VKLG+ FD IRSES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y+
Sbjct  582  AVKLGMKFDFIRSESTVLHVFPFNSEKKRGGVALKQTDSKVHIHWKGAAEIVLASCTEYL  641

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D+N     ++E++   FK AI+DMA  SLRCVA+AY SY++DK+P  EE LS+W LPE +
Sbjct  642  DSNGCSQNINEDKEF-FKAAIDDMAASSLRCVAIAYRSYELDKVPTEEEHLSQWALPEDN  700

Query  538  LILLAILGIKDPCRPGVR  591
            L+LL I+GIKDPCRPGV+
Sbjct  701  LVLLGIIGIKDPCRPGVK  718



>gb|KJB21991.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1017

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL 
Sbjct  501  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILI  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  561  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  621  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  681  DLVLLAIVGIKDPCRPSVK  699



>gb|EPS66913.1| hypothetical protein M569_07863, partial [Genlisea aurea]
Length=1071

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +1

Query  19   KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQFGVKLG  195
            +++  PD+KS  P ++   L+EGIA+NTTGSVFVPEGG   E+SGSPTEKAILQ+GV LG
Sbjct  512  QKVPQPDNKSMFPPRLHSFLVEGIAKNTTGSVFVPEGGGAHEISGSPTEKAILQWGVNLG  571

Query  196  LNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYIDANDN  372
            ++F+A +SES IIHAFPFNSEKKRGGVA+KL +SEV +HWKGAAEIVL+CC+ YID+ DN
Sbjct  572  MDFNAAQSESMIIHAFPFNSEKKRGGVALKLLNSEVRLHWKGAAEIVLACCSSYIDSGDN  631

Query  373  VVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGDLILLA  552
            VVPLD ++   FKKAIEDMA  SLRCVA+AY     +++P S EEL  W+LP+ DLILLA
Sbjct  632  VVPLDHHKISYFKKAIEDMAAASLRCVAIAYRECRKEEVPTSNEELESWQLPDDDLILLA  691

Query  553  ILGIKDPCRPGVR  591
            I+GIKDPCRPGVR
Sbjct  692  IVGIKDPCRPGVR  704



>ref|XP_004167733.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like, 
partial [Cucumis sativus]
Length=888

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY GGK+I+PP+ KS+    +  LL+EGIA N+ GSV+VPE GG  EV+GSPTEKAIL 
Sbjct  313  EAYAGGKKIDPPEKKSEFSPTLHSLLVEGIALNSNGSVYVPESGGEVEVTGSPTEKAILN  372

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+KLG+NF+A+R+ES+I+H FPF+S+KKRGGVA + D++VH+HWKGAAEIVL+ CT Y+
Sbjct  373  WGIKLGMNFEALRTESTILHVFPFSSDKKRGGVACQQDNQVHVHWKGAAEIVLASCTQYM  432

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +D  V LDE++   FK+AIEDMA+ SLRCVA+AY   D + +P SEE+LS+W LPE D
Sbjct  433  DEHDQFVQLDEDKMKYFKRAIEDMASRSLRCVAIAYRPVDPENVPDSEEQLSKWALPEED  492

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+G+KDPCRPGV+
Sbjct  493  LVLLAIVGLKDPCRPGVK  510



>gb|KJB21985.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21989.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1092

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL 
Sbjct  501  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILI  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  561  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  621  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  681  DLVLLAIVGIKDPCRPSVK  699



>gb|KJB21986.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21992.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1089

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL 
Sbjct  501  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILI  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  561  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  621  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  681  DLVLLAIVGIKDPCRPSVK  699



>gb|KJB21990.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1087

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL 
Sbjct  499  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILI  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  559  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  619  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  678

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  679  DLVLLAIVGIKDPCRPSVK  697



>gb|KJB21993.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1083

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  EGG   EVSGSPTEKAIL 
Sbjct  501  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEGGGDVEVSGSPTEKAILI  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  561  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  621  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  681  DLVLLAIVGIKDPCRPSVK  699



>ref|XP_008227947.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Prunus mume]
Length=860

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+IN PDD SQL  +V  LL EGIAQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  522  EAYVGKKKINLPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKQGGEVEISGSPTEKAILS  581

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRSES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y
Sbjct  582  WAVKLGMKFDFIRSESTVLHVFPFNSEKKRGGVALKQTDSKVHIHWKGAAEIVLASCTEY  641

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N     ++E++   FK AI+DMA  SLRCVA+AY SY++DK+P  EE LS+W LPE 
Sbjct  642  LDSNGCSQNINEDKEF-FKAAIDDMAASSLRCVAIAYRSYELDKVPTEEEHLSQWALPED  700

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LL I+GIKDPCRPGV+
Sbjct  701  NLVLLGIIGIKDPCRPGVK  719



>gb|AES65356.2| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1009

 Score =   268 bits (684),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            + Y GG +++PP +  + P K+  LL+EG+AQNT GSV+VPEG    EVSGSPTEKAIL 
Sbjct  514  EVYAGGSKVDPPHELERSP-KLRTLLIEGVAQNTNGSVYVPEGANDIEVSGSPTEKAILN  572

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+++G+NF   RSESSI+H FPFNSEKKRGGVA++  DS+VHIHWKGAAEIVL+CCT Y
Sbjct  573  WGLQVGMNFVTARSESSILHVFPFNSEKKRGGVAIQTADSDVHIHWKGAAEIVLACCTGY  632

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            IDAND +V +DE +   FKKAIEDMA++SLRCVA+AY  Y+ +K+P +EE+L+ W LPE 
Sbjct  633  IDANDQLVEIDEEKMTFFKKAIEDMASDSLRCVAIAYRPYEKEKVPDNEEQLADWSLPEE  692

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  693  ELVLLAIVGIKDPCRPGVK  711



>ref|XP_004150387.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Cucumis sativus]
 gb|KGN61187.1| hypothetical protein Csa_2G062620 [Cucumis sativus]
Length=1076

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY GGK+I+PP+ KS+    +  LL+EGIA N+ GSV+VPE GG  EV+GSPTEKAIL 
Sbjct  501  EAYAGGKKIDPPEKKSEFSPTLHSLLVEGIALNSNGSVYVPESGGEVEVTGSPTEKAILN  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+KLG+NF+A+R+ES+I+H FPF+S+KKRGGVA + D++VH+HWKGAAEIVL+ CT Y+
Sbjct  561  WGIKLGMNFEALRTESTILHVFPFSSDKKRGGVACQQDNQVHVHWKGAAEIVLASCTQYM  620

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +D  V LDE++   FK+AIEDMA+ SLRCVA+AY   D + +P SEE+LS+W LPE D
Sbjct  621  DEHDQFVQLDEDKMKYFKRAIEDMASRSLRCVAIAYRPVDPENVPDSEEQLSKWALPEED  680

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+G+KDPCRPGV+
Sbjct  681  LVLLAIVGLKDPCRPGVK  698



>gb|AES65357.2| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1093

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            + Y GG +++PP +  + P K+  LL+EG+AQNT GSV+VPEG    EVSGSPTEKAIL 
Sbjct  514  EVYAGGSKVDPPHELERSP-KLRTLLIEGVAQNTNGSVYVPEGANDIEVSGSPTEKAILN  572

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+++G+NF   RSESSI+H FPFNSEKKRGGVA++  DS+VHIHWKGAAEIVL+CCT Y
Sbjct  573  WGLQVGMNFVTARSESSILHVFPFNSEKKRGGVAIQTADSDVHIHWKGAAEIVLACCTGY  632

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            IDAND +V +DE +   FKKAIEDMA++SLRCVA+AY  Y+ +K+P +EE+L+ W LPE 
Sbjct  633  IDANDQLVEIDEEKMTFFKKAIEDMASDSLRCVAIAYRPYEKEKVPDNEEQLADWSLPEE  692

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  693  ELVLLAIVGIKDPCRPGVK  711



>ref|XP_008450934.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Cucumis melo]
 ref|XP_008450942.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Cucumis melo]
Length=1076

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY GGK+I+PP+ KS+L   +  LL+EGIA N+ GSV+VPE GG  EV+GSPTEKAIL 
Sbjct  501  EAYAGGKKIDPPEKKSELSPMIHSLLVEGIALNSNGSVYVPESGGEVEVTGSPTEKAILN  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+KLG+NF+A+R+E +I+H FPF+S+KKRGGVAV+ D++VH+HWKGAAEIVL+ CT Y+
Sbjct  561  WGIKLGMNFEALRAERTILHVFPFSSDKKRGGVAVQQDNQVHVHWKGAAEIVLASCTRYM  620

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +D  V LDE++   FK+AIEDMA+ SLRCVA+AY   D + +P  EE+LS+W LPE D
Sbjct  621  DEHDQSVQLDEDKMKYFKRAIEDMASRSLRCVAIAYRPVDPENVPDGEEQLSKWALPEDD  680

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+G+KDPCRPGV+
Sbjct  681  LVLLAIVGLKDPCRPGVK  698



>ref|XP_007142130.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
 ref|XP_007142131.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
 gb|ESW14124.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
 gb|ESW14125.1| hypothetical protein PHAVU_008G255200g [Phaseolus vulgaris]
Length=1101

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++NPPD+ S+L  KV+ L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL 
Sbjct  522  EAYVGSTKVNPPDNSSKLHPKVLSLINEGIAQNTTGNVFVPKDGGEKEVSGSPTEKAILS  581

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +KLG+NFD IRS S ++H FPFNSEKKRGGVA+KL DSEVHIHWKGAAEIVL  CT Y
Sbjct  582  WALKLGMNFDVIRSNSKVLHVFPFNSEKKRGGVALKLGDSEVHIHWKGAAEIVLGACTQY  641

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++  +  + E +A  FK++I DMA  SLRCVA+AY  Y++DK+P SE++L +W LPE 
Sbjct  642  LDSDGQLQSIKEEQAF-FKESINDMAARSLRCVAIAYRPYELDKVPSSEQDLDQWSLPEH  700

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCR GV+
Sbjct  701  ELVLLAIVGIKDPCRYGVK  719



>gb|KJB21984.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1092

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  E  G  EVSGSPTEKAIL 
Sbjct  501  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEACGDVEVSGSPTEKAILI  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  561  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  621  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  681  DLVLLAIVGIKDPCRPSVK  699



>gb|KJB21983.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
 gb|KJB21988.1| hypothetical protein B456_004G024800 [Gossypium raimondii]
Length=1089

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 2/199 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQ  177
            +AY GG++ +PP+ +S+LP  ++ LL+EGIA N  GSVF  E  G  EVSGSPTEKAIL 
Sbjct  501  EAYAGGRKNDPPESRSELPDTLVSLLIEGIAVNANGSVFTSEACGDVEVSGSPTEKAILI  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG++FDA+RS SSI+H FPFNSEKKRGGVA++L DS+VHIHWKGAAEIVL+ CT Y
Sbjct  561  WGIKLGMDFDAVRSGSSIVHVFPFNSEKKRGGVAIRLPDSKVHIHWKGAAEIVLAACTWY  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N   V +DE +   F+KAIE MA  SLRCVA+AY SY+ +K+P +EEEL++W LPE 
Sbjct  621  LDTNGEAVAMDEEKVAFFEKAIETMAAGSLRCVAIAYRSYESEKVPTNEEELAKWALPED  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRP V+
Sbjct  681  DLVLLAIVGIKDPCRPSVK  699



>ref|XP_003595106.1| Plasma membrane calcium-transporting ATPase [Medicago truncatula]
Length=1184

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            + Y GG +++PP +  + P K+  LL+EG+AQNT GSV+VPEG    EVSGSPTEKAIL 
Sbjct  577  EVYAGGSKVDPPHELERSP-KLRTLLIEGVAQNTNGSVYVPEGANDIEVSGSPTEKAILN  635

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+++G+NF   RSESSI+H FPFNSEKKRGGVA++  DS+VHIHWKGAAEIVL+CCT Y
Sbjct  636  WGLQVGMNFVTARSESSILHVFPFNSEKKRGGVAIQTADSDVHIHWKGAAEIVLACCTGY  695

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            IDAND +V +DE +   FKKAIEDMA++SLRCVA+AY  Y+ +K+P +EE+L+ W LPE 
Sbjct  696  IDANDQLVEIDEEKMTFFKKAIEDMASDSLRCVAIAYRPYEKEKVPDNEEQLADWSLPEE  755

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  756  ELVLLAIVGIKDPCRPGVK  774



>ref|XP_003595105.1| Plasma membrane calcium-transporting ATPase [Medicago truncatula]
Length=1156

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            + Y GG +++PP +  + P K+  LL+EG+AQNT GSV+VPEG    EVSGSPTEKAIL 
Sbjct  577  EVYAGGSKVDPPHELERSP-KLRTLLIEGVAQNTNGSVYVPEGANDIEVSGSPTEKAILN  635

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+++G+NF   RSESSI+H FPFNSEKKRGGVA++  DS+VHIHWKGAAEIVL+CCT Y
Sbjct  636  WGLQVGMNFVTARSESSILHVFPFNSEKKRGGVAIQTADSDVHIHWKGAAEIVLACCTGY  695

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            IDAND +V +DE +   FKKAIEDMA++SLRCVA+AY  Y+ +K+P +EE+L+ W LPE 
Sbjct  696  IDANDQLVEIDEEKMTFFKKAIEDMASDSLRCVAIAYRPYEKEKVPDNEEQLADWSLPEE  755

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  756  ELVLLAIVGIKDPCRPGVK  774



>ref|XP_007217082.1| hypothetical protein PRUPE_ppa000581mg [Prunus persica]
 gb|EMJ18281.1| hypothetical protein PRUPE_ppa000581mg [Prunus persica]
Length=1088

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+IN PDD SQL  +V  LL EGIAQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  511  EAYVGKKKINLPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKQGGEVEISGSPTEKAILS  570

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRSES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y
Sbjct  571  WAVKLGMKFDFIRSESTVLHVFPFNSEKKRGGVALKQTDSKVHIHWKGAAEIVLASCTEY  630

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N     ++E++   FK AI+DMA  SLRCVA+AY SY++DK+P  EE LS+W LPE 
Sbjct  631  LDSNGCSQNINEDKEF-FKAAIDDMAASSLRCVAIAYRSYELDKVPTEEEHLSQWALPED  689

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LL I+GIKDPCRPGV+
Sbjct  690  NLVLLGIIGIKDPCRPGVK  708



>ref|XP_008227944.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Prunus mume]
 ref|XP_008227945.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Prunus mume]
Length=1099

 Score =   266 bits (679),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+IN PDD SQL  +V  LL EGIAQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  522  EAYVGKKKINLPDDSSQLHPQVSTLLSEGIAQNTTGNVFEPKQGGEVEISGSPTEKAILS  581

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRSES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y
Sbjct  582  WAVKLGMKFDFIRSESTVLHVFPFNSEKKRGGVALKQTDSKVHIHWKGAAEIVLASCTEY  641

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N     ++E++   FK AI+DMA  SLRCVA+AY SY++DK+P  EE LS+W LPE 
Sbjct  642  LDSNGCSQNINEDKEF-FKAAIDDMAASSLRCVAIAYRSYELDKVPTEEEHLSQWALPED  700

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LL I+GIKDPCRPGV+
Sbjct  701  NLVLLGIIGIKDPCRPGVK  719



>dbj|BAF00961.1| Ca2+-transporting ATPase like protein [Arabidopsis thaliana]
Length=616

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++ PD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  43   ECYAGLQKMDSPDSSSKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  102

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA++SESS +  FPFNSEKKRGGVAVK  DS VHIHWKGAAEIVL  CTHY+
Sbjct  103  AIKLGMDFDALKSESSAVQFFPFNSEKKRGGVAVKSPDSSVHIHWKGAAEIVLGSCTHYM  162

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +++ V + E++    K AI+DMA  SLRCVA+A+ +++ DKIP  EE+LSRWELPE D
Sbjct  163  DESESFVDMSEDKMGGLKDAIDDMAARSLRCVAIAFRTFEADKIPTDEEQLSRWELPEDD  222

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+GIKDPCRPGV+
Sbjct  223  LILLAIVGIKDPCRPGVK  240



>ref|XP_004488018.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Cicer arietinum]
Length=1090

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            + Y GG +I+PP      P K+  LL+EG+AQNT GSV+VPEGG   EVSGSPTEKAIL 
Sbjct  510  EVYAGGTKIDPPHQLESSP-KLRSLLIEGVAQNTNGSVYVPEGGNDVEVSGSPTEKAILH  568

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + +++G+NF   RSESSIIH FPFNSEKKRGGVA++  DS+VHIHWKGAAEIVL+CCT Y
Sbjct  569  WAIQVGMNFATARSESSIIHVFPFNSEKKRGGVAIQTADSDVHIHWKGAAEIVLACCTGY  628

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID ND ++ +DE +  SF++AIE+MA +SLRCVA+AY SY+ +K+P +E+ L++W LP+ 
Sbjct  629  IDTNDQLMEMDEEKMTSFREAIENMAADSLRCVAIAYRSYEKEKVPNNEDLLAQWSLPDD  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  689  ELVLLAIVGIKDPCRPGVK  707



>ref|XP_009333971.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1100

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G K+INPPDD SQL   V  LL EG+AQNTTG+VF P GG  E+SGSPTEKAIL +
Sbjct  522  EAYVGRKKINPPDDTSQLHPLVSTLLSEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSW  581

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
              KLG+ F+AIR ES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y+
Sbjct  582  AFKLGMKFEAIRLESTVLHVFPFNSEKKRGGVALKQADSKVHIHWKGAAEIVLASCTEYL  641

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D++     +++++   FK AI+DMA  SLRCVA+AY  Y++DK+P  EE+LS+W LPE D
Sbjct  642  DSDGCSQNIEDDKEF-FKTAIDDMAERSLRCVAIAYRPYELDKVPTDEEQLSQWALPEDD  700

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  701  LVLLAIVGIKDPCRPGVK  718



>ref|XP_009340519.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1100

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G K+INPPDD SQL   V  L+ EG+AQNTTG+VF P GG  E+SGSPTEKAIL +
Sbjct  522  EAYVGIKKINPPDDTSQLHPLVSTLISEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSW  581

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
              KLG+ FDAIR ES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y+
Sbjct  582  AFKLGMKFDAIRLESTVLHVFPFNSEKKRGGVALKQADSKVHIHWKGAAEIVLASCTEYL  641

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D++     +++++   FK AI+DMA  SLRCVA+AY  Y++DK+P  EE+LS+W LPE D
Sbjct  642  DSDGCSQNIEDDKEF-FKTAIDDMAERSLRCVAIAYRPYELDKVPTDEEQLSQWALPEDD  700

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  701  LVLLAIVGIKDPCRPGVK  718



>ref|XP_006582993.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Glycine max]
Length=1090

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++  PDD S+L  K + L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL+
Sbjct  511  EAYVGSTKVYSPDDSSKLHPKALSLINEGIAQNTTGNVFVPKDGGETEVSGSPTEKAILK  570

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG++FD IRS S+++H FPFNSEKKRGGVA+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  571  WAVKLGMDFDVIRSNSTVLHVFPFNSEKKRGGVALKLGDSGVHIHWKGAAEIVLGTCTQY  630

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++  +  ++E +   FK AI+DMA  SLRCVA+AY SY++DK+P SE++L +W LPE 
Sbjct  631  LDSDGQLQSIEEEKGF-FKDAIDDMAARSLRCVAIAYRSYELDKVPSSEQDLDQWSLPEH  689

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  690  ELVLLAIVGIKDPCRPGVK  708



>gb|KHN39354.1| Calcium-transporting ATPase 9, plasma membrane-type [Glycine 
soja]
Length=1065

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++  PDD S+L  K + L+ EGIAQNTTG+VFVP +GG  EVSGSPTEKAIL+
Sbjct  486  EAYVGSTKVYSPDDSSKLHPKALSLINEGIAQNTTGNVFVPKDGGETEVSGSPTEKAILK  545

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG++FD IRS S+++H FPFNSEKKRGGVA+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  546  WAVKLGMDFDVIRSNSTVLHVFPFNSEKKRGGVALKLGDSGVHIHWKGAAEIVLGTCTQY  605

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++  +  ++E +   FK AI+DMA  SLRCVA+AY SY++DK+P SE++L +W LPE 
Sbjct  606  LDSDGQLQSIEEEKGF-FKDAIDDMAARSLRCVAIAYRSYELDKVPSSEQDLDQWSLPEH  664

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  665  ELVLLAIVGIKDPCRPGVK  683



>ref|XP_011467548.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Fragaria vesca subsp. vesca]
Length=1104

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 159/198 (80%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G  +I+PPDD SQL   V  LL EGIAQNT+G+VF PEGG  E+SGSPTEKAIL +
Sbjct  522  EAYVGRNKIHPPDDSSQLHSLVSTLLSEGIAQNTSGNVFEPEGGEVEISGSPTEKAILSW  581

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+ F+AIRSES+I+H FPFNSEKKRGGVAVK  DS+VHIHWKGAAEIVL+ CT Y+
Sbjct  582  ALKLGMKFNAIRSESTILHVFPFNSEKKRGGVAVKGTDSKVHIHWKGAAEIVLASCTGYL  641

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D+N  +  + +++    ++AI+ MA  SLRCVA+AY  Y+MDK+P  EE LS+W LPE +
Sbjct  642  DSNGCLQDITQDKEF-LREAIDSMAASSLRCVAIAYRPYEMDKVPTEEENLSQWALPEDN  700

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  701  LVLLAIVGIKDPCRPGVK  718



>gb|KEH28612.1| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1104

 Score =   262 bits (670),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++NPPDD S+   + + L+ E IAQNTTG+VFV  +GG  EVSGSPTEKAIL 
Sbjct  527  EAYVGKSKLNPPDDSSKFHPEALSLINESIAQNTTGNVFVSKDGGELEVSGSPTEKAILS  586

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+++H FPFNSEKKRGGVA+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  587  WAVKLGMNFDVIRSNSTVLHVFPFNSEKKRGGVALKLVDSGVHIHWKGAAEIVLGACTQY  646

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N ++  + E E    K+AI+DMA  SLRCVA+AY SY++DKIP +EE+L++W LPE 
Sbjct  647  LDSNSHLQSI-EQEKDFLKEAIDDMAARSLRCVAIAYRSYELDKIPSNEEDLAQWSLPED  705

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  706  ELVLLAIVGIKDPCRPGVK  724



>gb|KEH28611.1| calcium-transporting ATPase 8, plasma membrane-type protein [Medicago 
truncatula]
Length=1111

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++NPPDD S+   + + L+ E IAQNTTG+VFV  +GG  EVSGSPTEKAIL 
Sbjct  534  EAYVGKSKLNPPDDSSKFHPEALSLINESIAQNTTGNVFVSKDGGELEVSGSPTEKAILS  593

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD IRS S+++H FPFNSEKKRGGVA+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  594  WAVKLGMNFDVIRSNSTVLHVFPFNSEKKRGGVALKLVDSGVHIHWKGAAEIVLGACTQY  653

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N ++  + E E    K+AI+DMA  SLRCVA+AY SY++DKIP +EE+L++W LPE 
Sbjct  654  LDSNSHLQSI-EQEKDFLKEAIDDMAARSLRCVAIAYRSYELDKIPSNEEDLAQWSLPED  712

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  713  ELVLLAIVGIKDPCRPGVK  731



>ref|XP_009343847.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Pyrus x bretschneideri]
 ref|XP_009343848.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Pyrus x bretschneideri]
Length=1070

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 160/198 (81%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +A+ GG++I   DDK  L   +  LL+EGIA NT GSV++PE G   EVSGSPTEKAILQ
Sbjct  494  EAFTGGRKIVLSDDKPDLSPMLSSLLIEGIALNTNGSVYMPETGSDIEVSGSPTEKAILQ  553

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
             G+KLG+ FDAIRSESS++H FPFNSEKKRGG AVKL +SEVHIHWKGAAEIVL+CCT Y
Sbjct  554  LGIKLGMKFDAIRSESSLLHVFPFNSEKKRGGAAVKLPNSEVHIHWKGAAEIVLACCTKY  613

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D NDN+V +D+ ++  F+K+IEDMA  SLRCVA+AY  ++++ +P ++ +LS W LP+ 
Sbjct  614  LDPNDNLVAMDDEKSKIFRKSIEDMAARSLRCVAIAYRPHELEDVP-TDGQLSEWALPDD  672

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCRPGV
Sbjct  673  DLVLLAIVGIKDPCRPGV  690



>ref|XP_010913722.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Elaeis guineensis]
Length=1085

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GGK+I+PPD+   +    I LL+EGIAQNTTG+VF PE GG  EV+GSPTEKAIL 
Sbjct  498  EAYVGGKKIDPPDNIESMSSTAISLLIEGIAQNTTGNVFEPESGGTIEVTGSPTEKAILS  557

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RS+SSI+H FPFNSEKKRG VAV +  SEVH+HWKGAAEIVL  C+H+
Sbjct  558  WAVKLGMKFDDARSKSSILHVFPFNSEKKRGAVAVHVGGSEVHVHWKGAAEIVLGTCSHW  617

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+  V P+  ++A +FKK+IEDMA  SLRCVA AY +YD++K+P +EE+   W+LPE 
Sbjct  618  LDADGLVQPMTSDKADAFKKSIEDMAAVSLRCVAFAYKTYDLEKVP-NEEQRVNWQLPED  676

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILL I+GIKDPCRPGV+
Sbjct  677  DLILLGIVGIKDPCRPGVK  695



>ref|XP_010913719.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010913720.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010913721.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Elaeis guineensis]
Length=1088

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GGK+I+PPD+   +    I LL+EGIAQNTTG+VF PE GG  EV+GSPTEKAIL 
Sbjct  501  EAYVGGKKIDPPDNIESMSSTAISLLIEGIAQNTTGNVFEPESGGTIEVTGSPTEKAILS  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RS+SSI+H FPFNSEKKRG VAV +  SEVH+HWKGAAEIVL  C+H+
Sbjct  561  WAVKLGMKFDDARSKSSILHVFPFNSEKKRGAVAVHVGGSEVHVHWKGAAEIVLGTCSHW  620

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+  V P+  ++A +FKK+IEDMA  SLRCVA AY +YD++K+P +EE+   W+LPE 
Sbjct  621  LDADGLVQPMTSDKADAFKKSIEDMAAVSLRCVAFAYKTYDLEKVP-NEEQRVNWQLPED  679

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILL I+GIKDPCRPGV+
Sbjct  680  DLILLGIVGIKDPCRPGVK  698



>ref|XP_010545613.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Tarenaya hassleriana]
Length=1087

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY GGKR+  PD+ S +P +++ L+ EG+AQNTTG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  510  EAYAGGKRMELPDNSSGMPSELLSLICEGVAQNTTGNVFVPKDGGDVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  +LG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  570  WAYQLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVVIHWKGAAEIVLACCTKY  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D  E   FK AI+ MA  SLRCVA+A   Y+++K+PK +E+L RW LPE 
Sbjct  630  MDSNGTLQPIDGQEEF-FKVAIDSMAANSLRCVAIACRKYELNKVPKDQEDLDRWVLPED  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LL I+GIKDPCRPGV+
Sbjct  689  ELVLLGIVGIKDPCRPGVK  707



>ref|XP_006281735.1| hypothetical protein CARUB_v10027891mg [Capsella rubella]
 gb|EOA14633.1| hypothetical protein CARUB_v10027891mg [Capsella rubella]
Length=1080

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTAQLPATITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVHIHWKGA+EIVL+ C  Y
Sbjct  552  WGIKLGMNFETTRSQSSILHAFPFNSEKKRGGVAVKTADGEVHIHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID N NV P+ E++A+ FK  IE+MA  +LRCVA+A+ +++ +K+P + EELS+W LPE 
Sbjct  612  IDENGNVAPMTEDKALFFKNGIEEMAGRTLRCVALAFRTFEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>ref|XP_006427751.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
 gb|ESR40991.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
Length=1019

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +A+IG K+INPPDD SQ+   VI LL EGIAQNTTG+VFVP+ G   EVSGSPTEKAIL 
Sbjct  499  EAFIGRKKINPPDDSSQMHSIVISLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILS  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD +RSE++++H FPFNSEKKRGGVAVK ++SEVH+HWKGAAE++L+ CT Y
Sbjct  559  WAVKLGMKFDRVRSETTVLHVFPFNSEKKRGGVAVKRINSEVHVHWKGAAEMILASCTKY  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D +  +  +D +E   FK A+++MA  SLRCVA+AY S + D++P  EE L +W LPE 
Sbjct  619  LDTDGQLQSIDGDEDF-FKAAVDEMAARSLRCVAIAYRSCEADEVPTEEESLDKWTLPEE  677

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGV+
Sbjct  678  ELILLAIVGIKDPCRPGVK  696



>ref|XP_009340518.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1101

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+INPPDD SQL   V  L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  522  EAYVGIKKINPPDDTSQLHPLVSTLISEGVAQNTTGNVFEPTQGGEVEISGSPTEKAILS  581

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FDAIR ES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y
Sbjct  582  WAFKLGMKFDAIRLESTVLHVFPFNSEKKRGGVALKQADSKVHIHWKGAAEIVLASCTEY  641

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++     +++++   FK AI+DMA  SLRCVA+AY  Y++DK+P  EE+LS+W LPE 
Sbjct  642  LDSDGCSQNIEDDKEF-FKTAIDDMAERSLRCVAIAYRPYELDKVPTDEEQLSQWALPED  700

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGV+
Sbjct  701  DLVLLAIVGIKDPCRPGVK  719



>ref|XP_009359960.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1070

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+ GG +I+    KS +   +  LL+EGIA NT GSV+ PE GG  EVSGSPTEKAILQ
Sbjct  494  EAFTGGGKIDLSGSKSDVSPMLSSLLIEGIALNTNGSVYTPETGGDIEVSGSPTEKAILQ  553

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
             G+KLG+NFDAIRS+SSI+H FPFNSEKKRGG AVKL ++EVHIHWKGAAEIVL+CCT Y
Sbjct  554  LGIKLGMNFDAIRSKSSILHVFPFNSEKKRGGAAVKLPNTEVHIHWKGAAEIVLACCTKY  613

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND +V +DE ++  F+K+IEDMAT SLRCVA+AY  ++++ +P  +E+LS W LP+ 
Sbjct  614  LDPNDQLVAMDEGKSTMFRKSIEDMATRSLRCVAIAYRPHELENVP-GDEQLSEWVLPDD  672

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCR GV
Sbjct  673  DLVLLAIVGIKDPCRSGV  690



>ref|XP_009333970.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1101

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+INPPDD SQL   V  LL EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  522  EAYVGRKKINPPDDTSQLHPLVSTLLSEGVAQNTTGNVFEPTQGGEVEISGSPTEKAILS  581

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ F+AIR ES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y
Sbjct  582  WAFKLGMKFEAIRLESTVLHVFPFNSEKKRGGVALKQADSKVHIHWKGAAEIVLASCTEY  641

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++     +++++   FK AI+DMA  SLRCVA+AY  Y++DK+P  EE+LS+W LPE 
Sbjct  642  LDSDGCSQNIEDDKEF-FKTAIDDMAERSLRCVAIAYRPYELDKVPTDEEQLSQWALPED  700

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGV+
Sbjct  701  DLVLLAIVGIKDPCRPGVK  719



>ref|XP_007138755.1| hypothetical protein PHAVU_009G234600g [Phaseolus vulgaris]
 gb|ESW10749.1| hypothetical protein PHAVU_009G234600g [Phaseolus vulgaris]
Length=1082

 Score =   260 bits (665),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 157/200 (79%), Gaps = 6/200 (3%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVI-PLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAIL  174
            +AY G  +I+PP    +L   ++  LL+EGIA NT GSV+ PEG    EVSGSPTEKAIL
Sbjct  505  EAYAGSNKIDPP---HKLENSMLRSLLIEGIALNTNGSVYAPEGANDVEVSGSPTEKAIL  561

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
             +G++LG+NF A RSESSIIH FPFNSEKKRGGVA++  DS +HIHWKGAAEIVL+CCT 
Sbjct  562  HWGIQLGMNFTAARSESSIIHVFPFNSEKKRGGVALQTADSNIHIHWKGAAEIVLACCTG  621

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            YIDAND +V +DE +   FKKAIEDMA +SLRCVA+AY SY+  K+P +EE L+ W LPE
Sbjct  622  YIDANDQLVGMDEEKMSFFKKAIEDMAADSLRCVAIAYRSYEKKKVPTNEELLAHWSLPE  681

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL LLAI+GIKDPCRPGV+
Sbjct  682  DDLNLLAIVGIKDPCRPGVK  701



>ref|XP_009359959.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1113

 Score =   260 bits (665),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+ GG +I+    KS +   +  LL+EGIA NT GSV+ PE GG  EVSGSPTEKAILQ
Sbjct  537  EAFTGGGKIDLSGSKSDVSPMLSSLLIEGIALNTNGSVYTPETGGDIEVSGSPTEKAILQ  596

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
             G+KLG+NFDAIRS+SSI+H FPFNSEKKRGG AVKL ++EVHIHWKGAAEIVL+CCT Y
Sbjct  597  LGIKLGMNFDAIRSKSSILHVFPFNSEKKRGGAAVKLPNTEVHIHWKGAAEIVLACCTKY  656

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND +V +DE ++  F+K+IEDMAT SLRCVA+AY  ++++ +P  +E+LS W LP+ 
Sbjct  657  LDPNDQLVAMDEGKSTMFRKSIEDMATRSLRCVAIAYRPHELENVP-GDEQLSEWVLPDD  715

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCR GV
Sbjct  716  DLVLLAIVGIKDPCRSGV  733



>ref|XP_006427752.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
 gb|ESR40992.1| hypothetical protein CICLE_v10024770mg [Citrus clementina]
Length=1076

 Score =   260 bits (664),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +A+IG K+INPPDD SQ+   VI LL EGIAQNTTG+VFVP+ G   EVSGSPTEKAIL 
Sbjct  499  EAFIGRKKINPPDDSSQMHSIVISLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILS  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD +RSE++++H FPFNSEKKRGGVAVK ++SEVH+HWKGAAE++L+ CT Y
Sbjct  559  WAVKLGMKFDRVRSETTVLHVFPFNSEKKRGGVAVKRINSEVHVHWKGAAEMILASCTKY  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D +  +  +D +E   FK A+++MA  SLRCVA+AY S + D++P  EE L +W LPE 
Sbjct  619  LDTDGQLQSIDGDEDF-FKAAVDEMAARSLRCVAIAYRSCEADEVPTEEESLDKWTLPEE  677

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGV+
Sbjct  678  ELILLAIVGIKDPCRPGVK  696



>gb|KCW44504.1| hypothetical protein EUGRSUZ_L019901, partial [Eucalyptus grandis]
Length=432

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY G K+++PP+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL 
Sbjct  158  EAYAGQKKLDPPNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILS  217

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RSES+++H  PFNS KKRGGVA+K + SEV IHWKGAAE+VL  CT Y
Sbjct  218  WAVKLGMKFDVSRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFIHWKGAAELVLDSCTRY  277

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N    P+DE +   FK+AI+DMA  SLRCVA+A   +D+D +P  EE L +W LPE 
Sbjct  278  VDSNGQFQPIDEEKDF-FKQAIDDMAARSLRCVAIACRQHDLDSVPADEESLDKWVLPED  336

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGV+
Sbjct  337  DLVLLAIVGIKDPCRPGVK  355



>ref|NP_194719.1| calcium-transporting ATPase 10 [Arabidopsis thaliana]
 sp|Q9SZR1.2|ACA10_ARATH RecName: Full=Calcium-transporting ATPase 10, plasma membrane-type; 
AltName: Full=Ca(2+)-ATPase isoform 10 [Arabidopsis thaliana]
 emb|CAB79748.1| Ca2+-transporting ATPase-like protein [Arabidopsis thaliana]
 gb|AEE85690.1| calcium-transporting ATPase 10 [Arabidopsis thaliana]
Length=1069

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++ PD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  496  ECYAGLQKMDSPDSSSKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  555

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA++SESS +  FPFNSEKKRGGVAVK  DS VHIHWKGAAEIVL  CTHY+
Sbjct  556  AIKLGMDFDALKSESSAVQFFPFNSEKKRGGVAVKSPDSSVHIHWKGAAEIVLGSCTHYM  615

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +++ V + E++    K AI+DMA  SLRCVA+A+ +++ DKIP  EE+LSRWELPE D
Sbjct  616  DESESFVDMSEDKMGGLKDAIDDMAARSLRCVAIAFRTFEADKIPTDEEQLSRWELPEDD  675

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+GIKDPCRPGV+
Sbjct  676  LILLAIVGIKDPCRPGVK  693



>ref|XP_011033032.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Populus euphratica]
Length=1098

 Score =   259 bits (663),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G ++INPPDD SQL  +   LL EGIAQNTTG+VFVP +GG  E++GSPTEKAIL 
Sbjct  511  EAYVGSQKINPPDDPSQLQSEAGSLLCEGIAQNTTGNVFVPKDGGDVEITGSPTEKAILS  570

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD +R+ES I+H FPFNSEKKRGGVA+++ DS+VHIHWKGAAE+VL+ CT Y
Sbjct  571  WAVKLGMKFDVLRAESKILHVFPFNSEKKRGGVAIQMADSKVHIHWKGAAEMVLASCTGY  630

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N ++  +D+ E   FK AI+DMA  SLRCVA+AY  Y++DK+P  EE L +W LPE 
Sbjct  631  LDSNGSLQSIDK-EMDFFKVAIDDMAARSLRCVAIAYRPYELDKVPTDEESLGKWVLPED  689

Query  535  DLILLAILGIKDPCRPGV  588
            +L+LLAI+GIKDPCR GV
Sbjct  690  ELVLLAIVGIKDPCRKGV  707



>ref|XP_011033031.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Populus euphratica]
Length=1110

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G ++INPPDD SQL  +   LL EGIAQNTTG+VFVP +GG  E++GSPTEKAIL 
Sbjct  523  EAYVGSQKINPPDDPSQLQSEAGSLLCEGIAQNTTGNVFVPKDGGDVEITGSPTEKAILS  582

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD +R+ES I+H FPFNSEKKRGGVA+++ DS+VHIHWKGAAE+VL+ CT Y
Sbjct  583  WAVKLGMKFDVLRAESKILHVFPFNSEKKRGGVAIQMADSKVHIHWKGAAEMVLASCTGY  642

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N ++  +D+ E   FK AI+DMA  SLRCVA+AY  Y++DK+P  EE L +W LPE 
Sbjct  643  LDSNGSLQSIDK-EMDFFKVAIDDMAARSLRCVAIAYRPYELDKVPTDEESLGKWVLPED  701

Query  535  DLILLAILGIKDPCRPGV  588
            +L+LLAI+GIKDPCR GV
Sbjct  702  ELVLLAIVGIKDPCRKGV  719



>ref|XP_008360507.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Malus domestica]
Length=923

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+ GG++I    DK  L   +  LL+EGIA NT GSV++PE GG  EVSGSPTEKAILQ
Sbjct  347  EAFTGGRKIVLSGDKPDLSPMLSSLLIEGIAFNTNGSVYMPETGGDIEVSGSPTEKAILQ  406

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
             G+KLG+NFD IRSESS++H FPFNSEKKRGG AVKL +SEVHIHWKGAAEIVL+CCT Y
Sbjct  407  LGIKLGMNFDVIRSESSLLHVFPFNSEKKRGGAAVKLPNSEVHIHWKGAAEIVLACCTKY  466

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND +V +D+ ++  F+K+IEDMA  SLRCVA+AY  ++++ +P ++ +LS W LP+ 
Sbjct  467  LDPNDKLVAMDDEKSKIFRKSIEDMAARSLRCVAIAYRPHELEDVP-TDGQLSEWALPDD  525

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCRPGV
Sbjct  526  DLVLLAIVGIKDPCRPGV  543



>ref|XP_009349647.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X1 [Pyrus x bretschneideri]
Length=1099

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G K+INPPDD SQL   V  LL EG+AQNTTG+VF P GG  E+SGSPTEKAIL +
Sbjct  521  EAYVGRKKINPPDDSSQLHPLVSTLLSEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSW  580

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
              KLG+ F  IRSES+++H FPFNSEKKRGGVAVK  DS+VHIHWKGAAEI+L+ CT Y+
Sbjct  581  AFKLGMKFGVIRSESTVLHVFPFNSEKKRGGVAVKQADSKVHIHWKGAAEILLASCTEYL  640

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D++     + +++   F  AI DMA  SLRCVA+AY  Y +DKIP  EE+LS+W LPE +
Sbjct  641  DSDGCSHNIKDDKEF-FMTAINDMAESSLRCVAIAYRPYGLDKIPTDEEQLSQWALPEDN  699

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGVR
Sbjct  700  LVLLAIVGIKDPCRPGVR  717



>ref|XP_002867382.1| autoinhibited Ca2+-ATPase 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43641.1| autoinhibited Ca2+-ATPase 10 [Arabidopsis lyrata subsp. lyrata]
Length=1078

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP      L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  501  ECYAGFQKMDPPDSSSKLPSAFTSRLVEGIAHNTTGSVFRSETGEIQVSGSPTERAILSW  560

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA++SESS +  FPFNSEKKRGGVAVK  DS VH+HWKGAAEIVL  CTHY+
Sbjct  561  AIKLGMDFDALKSESSAVQFFPFNSEKKRGGVAVKSPDSSVHVHWKGAAEIVLGSCTHYM  620

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +++ V + E++    K+AI+DMA  SLRCVA+A+ +++ DKIP  EE+LSRW LPE D
Sbjct  621  DESESFVDMSEDKMAGLKEAIDDMAARSLRCVAIAFRTFEADKIPTDEEQLSRWVLPEDD  680

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  681  LVLLAIVGIKDPCRPGVK  698



>ref|XP_008391559.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Malus domestica]
 ref|XP_008391560.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Malus domestica]
 ref|XP_008391561.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Malus domestica]
Length=1070

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+ GG++I    DK  L   +  LL+EGIA NT GSV++PE GG  EVSGSPTEKAILQ
Sbjct  494  EAFTGGRKIVLSGDKPDLSPMLSSLLIEGIAFNTNGSVYMPETGGDIEVSGSPTEKAILQ  553

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
             G+KLG+NFD IRSESS++H FPFNSEKKRGG AVKL +SEVHIHWKGAAEIVL+CCT Y
Sbjct  554  LGIKLGMNFDVIRSESSLLHVFPFNSEKKRGGAAVKLPNSEVHIHWKGAAEIVLACCTKY  613

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D ND +V +D+ ++  F+K+IEDMA  SLRCVA+AY  ++++ +P ++ +LS W LP+ 
Sbjct  614  LDPNDKLVAMDDEKSKIFRKSIEDMAARSLRCVAIAYRPHELEDVP-TDGQLSEWALPDD  672

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCRPGV
Sbjct  673  DLVLLAIVGIKDPCRPGV  690



>ref|XP_008380287.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Malus domestica]
Length=1100

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G K+INPPDD SQL   V  LL EG+A NTTG+VF P GG  E+SGSPTEKAIL +
Sbjct  522  EAYVGRKKINPPDDTSQLHPLVSTLLSEGVAHNTTGNVFEPTGGKVEISGSPTEKAILSW  581

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
              KLG+ FD I+ ES+++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y+
Sbjct  582  AFKLGMKFDVIKLESTVLHVFPFNSEKKRGGVALKQADSKVHIHWKGAAEIVLASCTEYL  641

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D++     +++++   FK AI+DMA  SLRCVA+AY  Y+ DK+P  EE+LS+W LPE +
Sbjct  642  DSDGCSQNIEDDKEF-FKTAIDDMAERSLRCVAIAYRPYEQDKVPTDEEQLSQWALPEDN  700

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  701  LVLLAIVGIKDPCRPGVK  718



>gb|KCW44503.1| hypothetical protein EUGRSUZ_L019901, partial [Eucalyptus grandis]
Length=481

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY G K+++PP+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL 
Sbjct  158  EAYAGQKKLDPPNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILS  217

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RSES+++H  PFNS KKRGGVA+K + SEV IHWKGAAE+VL  CT Y
Sbjct  218  WAVKLGMKFDVSRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFIHWKGAAELVLDSCTRY  277

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N    P+DE +   FK+AI+DMA  SLRCVA+A   +D+D +P  EE L +W LPE 
Sbjct  278  VDSNGQFQPIDEEKDF-FKQAIDDMAARSLRCVAIACRQHDLDSVPADEESLDKWVLPED  336

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGV+
Sbjct  337  DLVLLAIVGIKDPCRPGVK  355



>ref|XP_008342501.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Malus domestica]
Length=978

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G K+INPPDD SQL   V  LL EG+AQNTTG+VF P GG  E+SGSPTEKAIL +
Sbjct  525  EAYVGRKKINPPDDSSQLHPLVSTLLSEGVAQNTTGNVFEPTGGEVEISGSPTEKAILSW  584

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
              KLG+ F  IR ES+++H FPFNSEKKRGGVAVK  DS VHIHWKGAAEI+L+ CT Y+
Sbjct  585  AFKLGMKFGVIRLESTVLHVFPFNSEKKRGGVAVKQADSNVHIHWKGAAEILLASCTEYL  644

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D++  +  + +++   F  AI DMA  SLRCVA+AY  Y +DK+P  EE+LS+W LPE +
Sbjct  645  DSDGCLHNIKDDKEF-FATAINDMAESSLRCVAIAYRPYGLDKVPTDEEQLSQWALPEDN  703

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGVR
Sbjct  704  LVLLAIVGIKDPCRPGVR  721



>ref|XP_002315383.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
 gb|EEF01554.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
Length=1085

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AYIG ++INPPD+  +L  +V  LL EGIAQNTTG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  508  EAYIGKQKINPPDNPLKLHSEVSSLLCEGIAQNTTGNVFVPKDGGDVEISGSPTEKAILS  567

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FDA+RSES I+H FPFNSEKK+GGVAV+  DS+VHIHWKGAAE+VL+ CT Y
Sbjct  568  WAVKLGMKFDALRSESKILHVFPFNSEKKQGGVAVQTTDSKVHIHWKGAAEMVLASCTRY  627

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N ++  +D++    FK +I+DMA  SLRCVA+AY  YD+DK+P   E L +W LPE 
Sbjct  628  LDSNGSLQSIDKDMDF-FKASIDDMAACSLRCVAIAYRPYDLDKVPTDVESLDKWVLPED  686

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  687  ELVLLAIVGIKDPCRPGVK  705



>ref|XP_008781797.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
 ref|XP_008781798.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
 ref|XP_008781799.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
Length=1086

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +1

Query  4    AYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQF  180
            AY+GGK+I+PPD+   +P   + LL+EGIAQNTTG+VF PE GG  EV+GSPTEKAIL +
Sbjct  502  AYVGGKKIDPPDNIESMPSNAVSLLIEGIAQNTTGNVFEPESGGTIEVTGSPTEKAILSW  561

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHYI  357
             VKLG+ FD  RS+SSI+H FPFNSEKKRG VAV +  SEV +HWKGAAEIVL+ C+H++
Sbjct  562  AVKLGMKFDDARSKSSILHVFPFNSEKKRGAVAVHVGGSEVRVHWKGAAEIVLATCSHWL  621

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            DA+  V P+  ++A +FKK+IEDMA  SLRCVA AY  YD++K+P +EE+   W+LPE D
Sbjct  622  DADGLVQPMTSDKADTFKKSIEDMAAVSLRCVAFAYKPYDLEKVP-NEEQRDSWQLPEDD  680

Query  538  LILLAILGIKDPCRPGVR  591
            L LL I+GIKDPCRPGV+
Sbjct  681  LFLLGIVGIKDPCRPGVK  698



>emb|CDY46716.1| BnaC07g42210D [Brassica napus]
Length=1073

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  499  ECYTGFQKMDPPDSSSKLPPPFTSILVEGIAHNTTGSVFRSESGEVQVSGSPTERAILNW  558

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+NFDA+RSESS +H FPFNSE+KRGGVAVK  DS VH+HWKGAAEIVL  CTHY+
Sbjct  559  AIKLGMNFDALRSESSAVHFFPFNSEQKRGGVAVKSPDSTVHVHWKGAAEIVLGSCTHYM  618

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N++ V +  ++    K AI DMA  SLRCVA+A+ +++ DKIP  E++LSRW LPE +
Sbjct  619  DENESPVDMSGDKMAELKNAINDMAARSLRCVAIAFRNFEADKIPTDEDQLSRWVLPEDE  678

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  679  LVLLAIVGIKDPCRPGVK  696



>ref|XP_010451807.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Camelina sativa]
Length=1074

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 160/199 (80%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTAQLPATITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGIKLGMNFETTRSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E +A+ F+  IE+MA  +LRCVA+A+ +++ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTEEKALYFRNGIEEMAGRTLRCVALAFRTFEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>ref|XP_004507012.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Cicer arietinum]
Length=1096

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 160/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  +INPP D S+L  + + L+ E +AQNTTG+VFV  +GG  EVSGSPTEKAIL 
Sbjct  519  EAYVGRGKINPPVDSSKLQPETLSLIHESVAQNTTGNVFVSKDGGEVEVSGSPTEKAILS  578

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+NFD  RS S+++H FPFNSEKKRGGVA+KL DS VHIHWKGAAEIVL  CT Y
Sbjct  579  WAVKLGMNFDLTRSNSTVLHVFPFNSEKKRGGVALKLADSGVHIHWKGAAEIVLGTCTQY  638

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N ++  ++E +   FK+AI+DMA  SLRCVA+AY SY++D+IP +EE+L +W LP+ 
Sbjct  639  LDSNGHLQSIEEEKDF-FKEAIDDMAARSLRCVAIAYRSYELDEIPSNEEDLDKWSLPDH  697

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  698  ELVLLAIVGIKDPCRPGVK  716



>ref|XP_002866184.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42443.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1079

 Score =   257 bits (656),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 158/199 (79%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGVKLGMNFETARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ +++A+ FK  I DMA  +LRCVA+A+ +Y+ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTDDKALFFKNGINDMAGRTLRCVALAFRTYEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>ref|XP_010483208.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Camelina sativa]
Length=1074

 Score =   256 bits (655),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 160/199 (80%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL 
Sbjct  496  ESYAGGKK----TDTAQLPPTITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGIKLGMNFETTRSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E +A+ F+  IE+MA  +LRCVA+A+ +++ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTEEKALYFRNGIEEMAGRTLRCVALAFRTFEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>ref|XP_010443383.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Camelina sativa]
Length=1074

 Score =   256 bits (655),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 160/199 (80%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D +QLP  +  L++EGI+QNTTGS+FVPEGG   E+SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTAQLPPTITSLVVEGISQNTTGSIFVPEGGGELELSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGIKLGMNFETTRSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E +A+ F+  IE+MA  +LRCVA+A+ +++ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTEEKALYFRNGIEEMAGRTLRCVALAFRTFEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>ref|XP_002310944.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
 gb|EEE88311.2| an N-terminal calmodulin binding autoinhibitory domain-containing 
family protein [Populus trichocarpa]
Length=1106

 Score =   256 bits (655),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G ++INPPDD SQL  +   LL EGIAQNTTG+VFVP +GG  E++GSPTEKAIL 
Sbjct  525  EAYVGNQKINPPDDPSQLQSEAGLLLCEGIAQNTTGNVFVPKDGGDVEITGSPTEKAILS  584

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD +R+ES I+  FPFNSEKKRGGVA++  DS+VHIHWKGAAE+VL+ CT Y
Sbjct  585  WAVKLGMKFDVLRAESKILRVFPFNSEKKRGGVAIQTADSKVHIHWKGAAEMVLASCTGY  644

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N ++  +D+ E   FK AI+DMA  SLRCVA+AY  Y++DK+P  EE L +W LPE 
Sbjct  645  LDSNGSLQSIDK-EMDFFKVAIDDMAACSLRCVAIAYRPYELDKVPTDEESLGKWVLPED  703

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  704  ELVLLAIVGIKDPCRPGVK  722



>emb|CDY43534.1| BnaA01g07100D [Brassica napus]
Length=1060

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL +
Sbjct  486  ECYAGFQKMDPPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNW  545

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+NFDA+RSESS IH FPFNSE+KRGGVAVK  DS VH+HWKGAAEIVL  CTHY+
Sbjct  546  AIKLGMNFDALRSESSAIHFFPFNSEQKRGGVAVKSPDSSVHVHWKGAAEIVLGSCTHYM  605

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N+++V +   +    K  I DMA  SLRCVA+A+ + + DKIP  EE+LSRW LP+ D
Sbjct  606  DENESLVDMSGEKMAELKNDINDMAARSLRCVAIAFRTLEADKIPTDEEQLSRWVLPDDD  665

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  666  LVLLAIVGIKDPCRPGVK  683



>gb|KCW44502.1| hypothetical protein EUGRSUZ_L019901, partial [Eucalyptus grandis]
Length=549

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY G K+++PP+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL 
Sbjct  158  EAYAGQKKLDPPNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILS  217

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RSES+++H  PFNS KKRGGVA+K + SEV IHWKGAAE+VL  CT Y
Sbjct  218  WAVKLGMKFDVSRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFIHWKGAAELVLDSCTRY  277

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N    P+DE +   FK+AI+DMA  SLRCVA+A   +D+D +P  EE L +W LPE 
Sbjct  278  VDSNGQFQPIDEEKDF-FKQAIDDMAARSLRCVAIACRQHDLDSVPADEESLDKWVLPED  336

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGV+
Sbjct  337  DLVLLAIVGIKDPCRPGVK  355



>emb|CDY20693.1| BnaA02g08330D [Brassica napus]
Length=1070

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTEQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NFD  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGIKLGMNFDTARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E++A  FK  IE+MA  +LRCVA+A+  Y+ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTEDKAQYFKNGIEEMAGRTLRCVALAFRHYEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>ref|XP_006492040.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Citrus sinensis]
Length=1076

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +A+IG K+INPPDD SQ+   VI LL EGIAQNTTG+VFVP+ G   EVSGSPTEKAIL 
Sbjct  499  EAFIGRKKINPPDDSSQMHSIVIYLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILS  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD +RSE++++H FPFNSEKKRGGVAVK ++SEVH+HWKGAAE++L+ CT Y
Sbjct  559  WAVKLGMKFDRVRSETTVLHVFPFNSEKKRGGVAVKRINSEVHVHWKGAAEMILASCTKY  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D + ++  +D +E   FK A+++MA  SLRCVA+AY   + D +P  EE L +W LPE 
Sbjct  619  LDTDGHLQSIDGDEDF-FKAAVDEMAARSLRCVAIAYRLCEADDVPTDEESLDKWTLPEE  677

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGV+
Sbjct  678  ELILLAIVGIKDPCRPGVK  696



>ref|XP_006401244.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
 dbj|BAJ34212.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42697.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
Length=1073

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS+FVPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTEQLPATITSLCVEGIAQNTTGSIFVPEGGGDLEFSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NFD  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGIKLGMNFDTARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E++ + FKK IE+MA  +LRCVA+A+ +++ +K+P + EE+ +W LPE 
Sbjct  612  IDEDGNVAPMTEDKELYFKKGIEEMAKRTLRCVALAFRTFEAEKVP-TGEEVEKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>ref|XP_006401243.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
 gb|ESQ42696.1| hypothetical protein EUTSA_v10012523mg [Eutrema salsugineum]
Length=999

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS+FVPEGG   E SGSPTEKAIL 
Sbjct  422  ESYAGGKKT----DTEQLPATITSLCVEGIAQNTTGSIFVPEGGGDLEFSGSPTEKAILG  477

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NFD  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  478  WGIKLGMNFDTARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  537

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E++ + FKK IE+MA  +LRCVA+A+ +++ +K+P + EE+ +W LPE 
Sbjct  538  IDEDGNVAPMTEDKELYFKKGIEEMAKRTLRCVALAFRTFEAEKVP-TGEEVEKWVLPED  596

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  597  DLILLAIVGIKDPCRPGVK  615



>ref|XP_009126900.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Brassica rapa]
 ref|XP_009126902.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Brassica rapa]
Length=1070

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS++VPEG G  E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTEQLPATITSLCVEGIAQNTTGSIYVPEGRGDLEFSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NFD  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGIKLGMNFDTARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E++A  FK  IE+MA  +LRCVA+A+  Y+ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTEDKAQYFKNGIEEMAGRTLRCVALAFRHYEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>emb|CDY30184.1| BnaA03g49860D [Brassica napus]
Length=1062

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  488  ECYTGFQKMDPPDSSSKLPPPFTSILVEGIAHNTTGSVFRSESGEVQVSGSPTERAILNW  547

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA+RSESS +H FPFNSE+KRGGVAVK  DS VH+HWKGAAEIVL  CTHY+
Sbjct  548  AIKLGMDFDALRSESSAVHFFPFNSEQKRGGVAVKSPDSTVHVHWKGAAEIVLGSCTHYM  607

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N++ V +  ++    K AI DMA  SLRCVA+A+ +++ DKIP  E++LSRW LPE +
Sbjct  608  DENESPVDMSGDKMAELKNAINDMAARSLRCVAIAFRNFEADKIPTDEDQLSRWVLPEDE  667

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  668  LVLLAIVGIKDPCRPGVK  685



>dbj|BAH20100.1| AT5G57110 [Arabidopsis thaliana]
Length=1074

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGVKLGMNFETARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ +++A  FK  I DMA  +LRCVA+A+ +Y+ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTDDKASFFKNGINDMAGRTLRCVALAFRTYEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>emb|CAB43665.1| Ca2+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=1093

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 155/208 (75%), Gaps = 11/208 (5%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++ PD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  510  ECYAGLQKMDSPDSSSKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  569

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-----------DSEVHIHWKGAAE  327
             +KLG++FDA++SESS +  FPFNSEKKRGGVAVK            DS VHIHWKGAAE
Sbjct  570  AIKLGMDFDALKSESSAVQFFPFNSEKKRGGVAVKSHPNDFLIHFQPDSSVHIHWKGAAE  629

Query  328  IVLSCCTHYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEE  507
            IVL  CTHY+D +++ V + E++    K AI+DMA  SLRCVA+A+ +++ DKIP  EE+
Sbjct  630  IVLGSCTHYMDESESFVDMSEDKMGGLKDAIDDMAARSLRCVAIAFRTFEADKIPTDEEQ  689

Query  508  LSRWELPEGDLILLAILGIKDPCRPGVR  591
            LSRWELPE DLILLAI+GIKDPCRPGV+
Sbjct  690  LSRWELPEDDLILLAIVGIKDPCRPGVK  717



>emb|CDX68595.1| BnaC01g08580D [Brassica napus]
Length=1058

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            ++Y G ++++PPD  S+LP      L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  484  ESYAGFQKMDPPDSSSKLPPAFTSKLVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  543

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+NFDA+RSESS +H FPFNSE+KRGGVAVK  DS VH+HWKGAAEIVL  CTHY+
Sbjct  544  AIKLGMNFDALRSESSAVHFFPFNSEQKRGGVAVKSADSSVHVHWKGAAEIVLGSCTHYM  603

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N+++V +   +    K  I DMA  SLRCVA+A+ + + DKIP  EE+LS+W LP+ D
Sbjct  604  DENESLVDMSGEKMAKLKNDINDMAARSLRCVAIAFRTLEADKIPTDEEQLSKWVLPDDD  663

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  664  LVLLAIVGIKDPCRPGVK  681



>ref|XP_009137874.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Brassica rapa]
 ref|XP_009137875.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Brassica rapa]
Length=1073

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  500  ECYTGFQKMDPPDSSSKLPPPFTSILVEGIAHNTTGSVFRSESGEVQVSGSPTERAILNW  559

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA+RSESS +H FPFNSE+KRGGVAVK  DS VH+HWKGAAEIVL  CTHY+
Sbjct  560  AIKLGMDFDALRSESSAVHFFPFNSEQKRGGVAVKSPDSTVHVHWKGAAEIVLGSCTHYM  619

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N++ V +  ++    K AI DMA  SLRCVA+A+ +++ DKIP  E++LSRW LPE +
Sbjct  620  DENESPVDMSGDKMAELKNAINDMAARSLRCVAIAFRNFEADKIPTDEDQLSRWVLPEDE  679

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  680  LVLLAIVGIKDPCRPGVK  697



>ref|XP_009349648.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
isoform X2 [Pyrus x bretschneideri]
Length=1100

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+INPPDD SQL   V  LL EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  521  EAYVGRKKINPPDDSSQLHPLVSTLLSEGVAQNTTGNVFEPTQGGEVEISGSPTEKAILS  580

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ F  IRSES+++H FPFNSEKKRGGVAVK  DS+VHIHWKGAAEI+L+ CT Y
Sbjct  581  WAFKLGMKFGVIRSESTVLHVFPFNSEKKRGGVAVKQADSKVHIHWKGAAEILLASCTEY  640

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++     + +++   F  AI DMA  SLRCVA+AY  Y +DKIP  EE+LS+W LPE 
Sbjct  641  LDSDGCSHNIKDDKEF-FMTAINDMAESSLRCVAIAYRPYGLDKIPTDEEQLSQWALPED  699

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGVR
Sbjct  700  NLVLLAIVGIKDPCRPGVR  718



>ref|NP_851200.1| calcium-transporting ATPase 8 [Arabidopsis thaliana]
 ref|NP_200521.3| calcium-transporting ATPase 8 [Arabidopsis thaliana]
 sp|Q9LF79.1|ACA8_ARATH RecName: Full=Calcium-transporting ATPase 8, plasma membrane-type; 
AltName: Full=Ca(2+)-ATPase isoform 8 [Arabidopsis thaliana]
 emb|CAB96189.1| plasma membrane Ca2+-ATPase [Arabidopsis thaliana]
 gb|AAL47426.1| AT5g57110/MUL3_5 [Arabidopsis thaliana]
 dbj|BAE99029.1| Ca2+-transporting ATPase like protein [Arabidopsis thaliana]
 gb|AED96847.1| calcium-transporting ATPase 8 [Arabidopsis thaliana]
 gb|AED96848.1| calcium-transporting ATPase 8 [Arabidopsis thaliana]
Length=1074

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  552  WGVKLGMNFETARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ +++A  FK  I DMA  +LRCVA+A+ +Y+ +K+P + EELS+W LPE 
Sbjct  612  IDEDGNVAPMTDDKASFFKNGINDMAGRTLRCVALAFRTYEAEKVP-TGEELSKWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  671  DLILLAIVGIKDPCRPGVK  689



>gb|EPS66449.1| hypothetical protein M569_08327, partial [Genlisea aurea]
Length=645

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            + Y  G+++  PDDK QLP  V  LL+EGIAQNTTGSVFVPE GG  E+SGSPTEKAILQ
Sbjct  455  ETYACGQKLLQPDDKFQLPSGVHSLLVEGIAQNTTGSVFVPECGGALEISGSPTEKAILQ  514

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GV LG++F+A +SES IIHAFPFNSEKKRGGVA+KL +SEV +HWKGAAEI+LSCC+ Y
Sbjct  515  WGVNLGMDFNAAQSESVIIHAFPFNSEKKRGGVALKLSNSEVRVHWKGAAEIILSCCSSY  574

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID++  V+P+D+++   FKK IE MA  SLRCVA+AY     +++P S+EEL  W LPEG
Sbjct  575  IDSHGIVIPMDDHKLSIFKKEIEGMAAASLRCVALAYKLCRTEEVPTSDEELESWHLPEG  634

Query  535  DLILLAILGIK  567
            DL++LA +GIK
Sbjct  635  DLVMLAFVGIK  645



>dbj|BAA97361.1| Ca2+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=1099

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L++EGI+QNTTGS+FVPEGG   E SGSPTEKAIL 
Sbjct  513  ESYAGGKKT----DTEQLPATITSLVVEGISQNTTGSIFVPEGGGDLEYSGSPTEKAILG  568

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  Y
Sbjct  569  WGVKLGMNFETARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSY  628

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ +++A  FK  I DMA  +LRCVA+A+ +Y+ +K+P + EELS+W LPE 
Sbjct  629  IDEDGNVAPMTDDKASFFKNGINDMAGRTLRCVALAFRTYEAEKVP-TGEELSKWVLPED  687

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  688  DLILLAIVGIKDPCRPGVK  706



>ref|XP_004299792.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011464741.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011464742.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
 ref|XP_011464743.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Fragaria vesca subsp. vesca]
Length=1087

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 157/192 (82%), Gaps = 2/192 (1%)
 Frame = +1

Query  19   KRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQFGVKLG  195
            +++N  D K  L   +  L++EGIAQNTTG+V+VPE GG  EV+GSPTEKAILQ+ +KLG
Sbjct  501  RKVNSNDGKPDLSPTISSLIIEGIAQNTTGNVYVPETGGDVEVTGSPTEKAILQWALKLG  560

Query  196  LNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYIDANDN  372
            +NF A RS+SSI+H FPFNSEKKRGGVAVKL +SEVHIHWKGAAEI+L+ CT YID++D 
Sbjct  561  MNFVAARSQSSILHVFPFNSEKKRGGVAVKLPNSEVHIHWKGAAEIILASCTRYIDSDDQ  620

Query  373  VVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGDLILLA  552
            V  +D+++ + F+K+IE+MA+ SLRCVA+AY+ Y++  +P  EE+L+ W LP  DL+LLA
Sbjct  621  VAAMDDDKRMFFRKSIEEMASGSLRCVAMAYLPYELGNVPTGEEQLADWALPADDLVLLA  680

Query  553  ILGIKDPCRPGV  588
            I+GIKDPCRPGV
Sbjct  681  IVGIKDPCRPGV  692



>ref|XP_010929325.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
Length=923

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY GG +++PPDD  QL + + PLL+EG+AQNTTG VF PE GG  EVSGSPTEKAIL 
Sbjct  372  EAYAGGMKLDPPDDVKQL-RNISPLLIEGLAQNTTGDVFEPEDGGAIEVSGSPTEKAILS  430

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ F+ +RS+SSI+H FPFNSEKK GGVAV+L DS VHIHWKGAAE+VL+CC+++
Sbjct  431  WGVKLGMKFNDVRSKSSILHVFPFNSEKKHGGVAVQLPDSRVHIHWKGAAELVLACCSNW  490

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +  + +V P+  N+   FKK+IE MA  SLRCVA+AY  YD+ K+P +EE+   WELP+ 
Sbjct  491  LALDGSVQPMTSNKMNEFKKSIEAMAAVSLRCVALAYRLYDLGKVP-NEEQRDTWELPDD  549

Query  535  DLILLAILGIKDPCRPGV  588
            +LILL I+GIKDPCRPGV
Sbjct  550  ELILLGIVGIKDPCRPGV  567



>gb|KDP34443.1| hypothetical protein JCGZ_11914 [Jatropha curcas]
Length=1069

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G  ++N PDD SQL  +V+ LL EG AQN+TG+VF P +GG  EVSGSPTEKAIL 
Sbjct  492  EAYVGRMKMNGPDDSSQLHSEVVSLLCEGAAQNSTGNVFAPKDGGDVEVSGSPTEKAILS  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRS+S ++  FPFNSEKKRGGVAV + DS++HIHWKGAAEIVL+ CT Y
Sbjct  552  WAVKLGMKFDVIRSQSKVLQVFPFNSEKKRGGVAVQRSDSKIHIHWKGAAEIVLASCTGY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID+N  +  +DE++   FK AI++MA  SLRCVA+AY SYD DK+   EE L +W LPE 
Sbjct  612  IDSNCCLQSMDEDKEF-FKDAIDEMAASSLRCVAIAYRSYDADKVLADEEALDKWILPED  670

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCRPGV
Sbjct  671  DLVLLAIVGIKDPCRPGV  688



>ref|XP_002275074.2| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Vitis vinifera]
Length=1075

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG---VPEVSGSPTEKAI  171
            +AY+G K+I+PPDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAI
Sbjct  497  EAYVGRKKIDPPDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAI  556

Query  172  LQFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTH  351
            L + VKLG+ FD IR ESSI+H FPFNSEKKRGGVAV+ D++VHIHWKGAAE+VL  CT 
Sbjct  557  LAWAVKLGMKFDVIREESSILHVFPFNSEKKRGGVAVQGDNKVHIHWKGAAEMVLGSCTE  616

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  + P+ E++   F +AI  MA  SLRCVA+AY ++D+DK+P  EE+  +W LPE
Sbjct  617  YLDSNGCLQPMGEDKEF-FSEAINQMAASSLRCVAIAYRTFDLDKMPIDEEQRDQWVLPE  675

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LL+I+GIKDPCR GV+
Sbjct  676  NDLVLLSIVGIKDPCRSGVQ  695



>ref|XP_010655160.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Vitis vinifera]
 ref|XP_010655161.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Vitis vinifera]
Length=1030

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG---VPEVSGSPTEKAI  171
            +AY+G K+I+PPDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAI
Sbjct  452  EAYVGRKKIDPPDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAI  511

Query  172  LQFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTH  351
            L + VKLG+ FD IR ESSI+H FPFNSEKKRGGVAV+ D++VHIHWKGAAE+VL  CT 
Sbjct  512  LAWAVKLGMKFDVIREESSILHVFPFNSEKKRGGVAVQGDNKVHIHWKGAAEMVLGSCTE  571

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  + P+ E++   F +AI  MA  SLRCVA+AY ++D+DK+P  EE+  +W LPE
Sbjct  572  YLDSNGCLQPMGEDKEF-FSEAINQMAASSLRCVAIAYRTFDLDKMPIDEEQRDQWVLPE  630

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LL+I+GIKDPCR GV+
Sbjct  631  NDLVLLSIVGIKDPCRSGVQ  650



>ref|XP_010109302.1| Calcium-transporting ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXC21596.1| Calcium-transporting ATPase 9, plasma membrane-type [Morus notabilis]
Length=1104

 Score =   254 bits (649),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQ  177
            +AY+G K++NPPDD SQL      LL EGIAQNTTG+VFVP+G G  E++GSPTEKAIL 
Sbjct  527  EAYVGKKKMNPPDDPSQLHSDASALLSEGIAQNTTGNVFVPKGDGDVEITGSPTEKAILS  586

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + ++LG+ FD IRSE+ ++H FPFNSEKKRGGVA+K  DS+VHIHWKGAAEIVL+ CT Y
Sbjct  587  WAMELGMKFDIIRSETIVLHVFPFNSEKKRGGVALKQKDSKVHIHWKGAAEIVLTSCTRY  646

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  V  +  ++   F ++I+DMA  SLRCVA+AY +YD+ K+P  EE+L++W LPE 
Sbjct  647  LDSNGCVQSIHADKDF-FMESIDDMAARSLRCVAIAYRAYDLAKVPVEEEQLAQWALPED  705

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCR GV+
Sbjct  706  DLVLLAIVGIKDPCRRGVK  724



>ref|XP_010655162.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Vitis vinifera]
Length=1029

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG---VPEVSGSPTEKAI  171
            +AY+G K+I+PPDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAI
Sbjct  451  EAYVGRKKIDPPDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAI  510

Query  172  LQFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTH  351
            L + VKLG+ FD IR ESSI+H FPFNSEKKRGGVAV+ D++VHIHWKGAAE+VL  CT 
Sbjct  511  LAWAVKLGMKFDVIREESSILHVFPFNSEKKRGGVAVQGDNKVHIHWKGAAEMVLGSCTE  570

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  + P+ E++   F +AI  MA  SLRCVA+AY ++D+DK+P  EE+  +W LPE
Sbjct  571  YLDSNGCLQPMGEDKEF-FSEAINQMAASSLRCVAIAYRTFDLDKMPIDEEQRDQWVLPE  629

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LL+I+GIKDPCR GV+
Sbjct  630  NDLVLLSIVGIKDPCRSGVQ  649



>ref|NP_001169407.1| uncharacterized protein LOC100383276 [Zea mays]
 gb|ACN33659.1| unknown [Zea mays]
 tpg|DAA48122.1| TPA: hypothetical protein ZEAMMB73_416489 [Zea mays]
Length=657

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY  G +++P DD SQ+      L++EGIAQNTTG+VF+PE GG  E++GSPTEKAIL 
Sbjct  76   EAYFAGTKLDPCDDVSQMSDSAASLIIEGIAQNTTGTVFLPEDGGAAELTGSPTEKAILS  135

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+K+G++FD +R++SS+IH FPFNSEKKRG VAV+LD  VHIHWKGAAEIVLS C  ++
Sbjct  136  WGLKIGMDFDDVRTKSSVIHVFPFNSEKKRGAVAVQLDDGVHIHWKGAAEIVLSSCKSWL  195

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
              + +V  +   +   FK++IEDM   SLRCVA AY S+D++KIP   E+++ WELPE D
Sbjct  196  SVDGSVQSMSAEKHDEFKRSIEDMGANSLRCVAFAYCSFDIEKIPM--EDITSWELPEDD  253

Query  538  LILLAILGIKDPCRPGVR  591
            L LL I+GIKDPCRPGVR
Sbjct  254  LTLLGIIGIKDPCRPGVR  271



>ref|XP_008801513.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X2 [Phoenix dactylifera]
Length=865

 Score =   252 bits (644),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 160/199 (80%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GG +++ PDD  +L   + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL 
Sbjct  497  EAYVGGMKLDTPDDVKEL-YNISPLLIEGIAQNTTGDVFEPEDGGAIEVNGSPTEKAILS  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ F+ +RS+SSI+H FPFNSEKKRGGVA++L DS VH+HWKGAAE+VL+CC+++
Sbjct  556  WGVKLGMKFNDVRSKSSILHVFPFNSEKKRGGVAIQLPDSRVHVHWKGAAELVLACCSNW  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +  + ++ P+  N+   FKK+IEDMA  SLRCVA+AY  YD +K+P +EE+   WELPE 
Sbjct  616  LAPDGSLQPMTSNKMNEFKKSIEDMAAVSLRCVALAYRLYDPEKVP-NEEQRDTWELPED  674

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILL I+GIKDPCRPGV+
Sbjct  675  ELILLGIVGIKDPCRPGVK  693



>ref|XP_009128358.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Brassica rapa]
Length=1071

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL +
Sbjct  498  ECYAGFQKMDPPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNW  557

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+NFDA+RSESS IH FPFNSE+KRGGVAVK  DS VH+HWKGAAEIVL  CTHY+
Sbjct  558  AIKLGMNFDALRSESSAIHFFPFNSEQKRGGVAVKSPDSSVHVHWKGAAEIVLGSCTHYM  617

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N+++V +   +    K  I DMA  SLRCVA+A+ + + DKIP  +E+LSRW LP+ D
Sbjct  618  DENESLVGMSGEKMGELKNDINDMAARSLRCVAIAFRTLEADKIPTDKEQLSRWVLPDDD  677

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  678  LVLLAIVGIKDPCRPGVK  695



>ref|XP_010928700.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
 ref|XP_010928701.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
 ref|XP_010928702.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
 ref|XP_010928703.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Elaeis guineensis]
Length=1067

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GG++I+PP+D S +      LL+EGIAQNTTGSVF PE GG  E++GSPTEKAIL 
Sbjct  493  EAYVGGEKIDPPEDVSLMSSTASSLLIEGIAQNTTGSVFEPERGGTIEITGSPTEKAILS  552

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RSESSI+H FPFNSEKKRGGVAV + DSEVH+HWKGAAEIVL+ CT +
Sbjct  553  WAVKLGMKFDDARSESSILHVFPFNSEKKRGGVAVHVGDSEVHVHWKGAAEIVLAQCTSW  612

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            + A+  V P+  ++  +FKK IEDMA  SLRC++ AY  YD+  +P SEE+   W+LPE 
Sbjct  613  LGADGFVQPMTPDKLDAFKKLIEDMAAVSLRCISFAYRPYDLKNVP-SEEQRDNWQLPED  671

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+G+KDPCRPGV+
Sbjct  672  DLILLAIVGMKDPCRPGVK  690



>ref|XP_002514375.1| cation-transporting atpase plant, putative [Ricinus communis]
 gb|EEF47971.1| cation-transporting atpase plant, putative [Ricinus communis]
Length=1017

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 157/198 (79%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K++ P DD +QL  +V  LL EG+AQN+TGSVFVP +GG  E+SGSPTEKAIL 
Sbjct  465  EAYVGKKKMIPADDSAQLHSEVSSLLCEGVAQNSTGSVFVPKDGGDVEISGSPTEKAILS  524

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD+IRS+S ++  FPFNSEKKRGGVA+ + DS+VHIHWKGAAE+VL+ CT Y
Sbjct  525  WAVKLGMKFDSIRSQSKVLQVFPFNSEKKRGGVAIQRTDSKVHIHWKGAAELVLASCTRY  584

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N +V  +DE++    K AI+DMA  SLRCVA+AY S  ++K+P  EE L +W LPE 
Sbjct  585  MDSNGSVQSIDEDKDF-LKAAIDDMAASSLRCVAIAYRSIVLEKVPADEEGLDKWVLPED  643

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCRPGV
Sbjct  644  DLVLLAIVGIKDPCRPGV  661



>emb|CBI25301.3| unnamed protein product [Vitis vinifera]
Length=1152

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG---VPEVSGSPTEKAI  171
            +AY+G K+I+PPDD SQL   V  LL EGIA NT G+VFVP+GG     E+SGSPTEKAI
Sbjct  574  EAYVGRKKIDPPDDSSQLHPDVSSLLHEGIACNTQGNVFVPKGGGEEKMEISGSPTEKAI  633

Query  172  LQFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTH  351
            L + VKLG+ FD IR ESSI+H FPFNSEKKRGGVAV+ D++VHIHWKGAAE+VL  CT 
Sbjct  634  LAWAVKLGMKFDVIREESSILHVFPFNSEKKRGGVAVQGDNKVHIHWKGAAEMVLGSCTE  693

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  + P+ E++   F +AI  MA  SLRCVA+AY ++D+DK+P  EE+  +W LPE
Sbjct  694  YLDSNGCLQPMGEDKEF-FSEAINQMAASSLRCVAIAYRTFDLDKMPIDEEQRDQWVLPE  752

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LL+I+GIKDPCR GV+
Sbjct  753  NDLVLLSIVGIKDPCRSGVQ  772



>emb|CDY32902.1| BnaC02g11860D [Brassica napus]
Length=1122

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 156/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL 
Sbjct  497  ESYAGGKKT----DTQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILG  552

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+NF+  RS+SSI+HAFPFNSEKKRGGVAVK  D EVH+HWKGA+EIVL+ C  +
Sbjct  553  WGIKLGMNFETARSQSSILHAFPFNSEKKRGGVAVKTADGEVHVHWKGASEIVLASCRSF  612

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E++A  FK  IE+MA  +LRCVA+A+  Y+ +K+P + EELS+W LPE 
Sbjct  613  IDEDGNVAPMTEDKAQYFKNGIEEMAGRTLRCVALAFRHYEAEKVP-TGEELSKWVLPED  671

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGV+
Sbjct  672  DLILLAIVGIKDPCRPGVK  690



>ref|XP_002325252.2| hypothetical protein POPTR_0018s13660g, partial [Populus trichocarpa]
 gb|EEF03817.2| hypothetical protein POPTR_0018s13660g, partial [Populus trichocarpa]
Length=1082

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEG-GVPEVSGSPTEKAILQ  177
            + Y+ G++I+PPD KS L   +  L++EGIA+NTT SVF+PEG G P +SGSPTEKAI++
Sbjct  436  EVYVAGQKIDPPDSKSLLSPMLSSLVIEGIARNTTASVFIPEGEGDPVISGSPTEKAIVE  495

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G KLG++FDA+RSESS+I  F FNSEKK+GGVA++L DS+VHIHWKGAAEI+L+ C  Y
Sbjct  496  WGFKLGMDFDAVRSESSVISVFLFNSEKKKGGVALQLPDSQVHIHWKGAAEIILASCVGY  555

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
             DAN N+V +D+++ + FK  IEDMA  SLRC+A+AY +YDMDK+P  E+EL++W LPE 
Sbjct  556  CDANGNLVQMDKDKELLFKNVIEDMAANSLRCIALAYKTYDMDKLPVDEQELAQWPLPED  615

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLA++G+K+PC PGV
Sbjct  616  DLVLLALIGLKNPCHPGV  633



>ref|XP_007023813.1| Autoinhibited Ca(2+)-ATPase 9 isoform 4 [Theobroma cacao]
 gb|EOY26435.1| Autoinhibited Ca(2+)-ATPase 9 isoform 4 [Theobroma cacao]
Length=1042

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQL   V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  506  EAFVGKKKINPPADSSQLHPSVVSLLSEGVAQNSTGNVFVPKDGGDVEISGSPTEKAILS  565

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ +D IRSES+++H FPFNSEKKRGGVA++L DS+VHIHWKGAAE+VL+ C+ Y
Sbjct  566  WAVKLGMKYDVIRSESTVLHVFPFNSEKKRGGVALQLSDSQVHIHWKGAAELVLASCSRY  625

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +DE E    K AI++MAT SLRC+A+AY   + ++IP  EE  +RW LPE 
Sbjct  626  LDSNGCLQSIDE-EKDYLKAAIDEMATSSLRCIALAYRLCEKEEIPTDEESFNRWVLPED  684

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  685  NLVLLAIVGIKDPCRPGVK  703



>ref|XP_009128366.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
 ref|XP_009128368.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
 ref|XP_009128376.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
 ref|XP_009128385.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Brassica rapa]
Length=997

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL +
Sbjct  422  ECYAGFQKMDPPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNW  481

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL---DSEVHIHWKGAAEIVLSCCTH  351
             +KLG+NFDA+RSESS IH FPFNSE+KRGGVAVK    DS VH+HWKGAAEIVL  CTH
Sbjct  482  AIKLGMNFDALRSESSAIHFFPFNSEQKRGGVAVKSFQPDSSVHVHWKGAAEIVLGSCTH  541

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D N+++V +   +    K  I DMA  SLRCVA+A+ + + DKIP  +E+LSRW LP+
Sbjct  542  YMDENESLVGMSGEKMGELKNDINDMAARSLRCVAIAFRTLEADKIPTDKEQLSRWVLPD  601

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LLAI+GIKDPCRPGV+
Sbjct  602  DDLVLLAIVGIKDPCRPGVK  621



>ref|XP_009128346.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Brassica rapa]
 ref|XP_009128354.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Brassica rapa]
Length=1073

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  S+LP      L+EGIA NTTGSVF+ E G  +VSGSPTE+AIL +
Sbjct  498  ECYAGFQKMDPPDSSSKLPPAFTCKLVEGIAHNTTGSVFLSESGEIQVSGSPTERAILNW  557

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL---DSEVHIHWKGAAEIVLSCCTH  351
             +KLG+NFDA+RSESS IH FPFNSE+KRGGVAVK    DS VH+HWKGAAEIVL  CTH
Sbjct  558  AIKLGMNFDALRSESSAIHFFPFNSEQKRGGVAVKSFQPDSSVHVHWKGAAEIVLGSCTH  617

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D N+++V +   +    K  I DMA  SLRCVA+A+ + + DKIP  +E+LSRW LP+
Sbjct  618  YMDENESLVGMSGEKMGELKNDINDMAARSLRCVAIAFRTLEADKIPTDKEQLSRWVLPD  677

Query  532  GDLILLAILGIKDPCRPGVR  591
             DL+LLAI+GIKDPCRPGV+
Sbjct  678  DDLVLLAIVGIKDPCRPGVK  697



>ref|XP_008801512.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X1 [Phoenix dactylifera]
Length=1074

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 160/199 (80%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GG +++ PDD  +L   + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL 
Sbjct  497  EAYVGGMKLDTPDDVKEL-YNISPLLIEGIAQNTTGDVFEPEDGGAIEVNGSPTEKAILS  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ F+ +RS+SSI+H FPFNSEKKRGGVA++L DS VH+HWKGAAE+VL+CC+++
Sbjct  556  WGVKLGMKFNDVRSKSSILHVFPFNSEKKRGGVAIQLPDSRVHVHWKGAAELVLACCSNW  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +  + ++ P+  N+   FKK+IEDMA  SLRCVA+AY  YD +K+P +EE+   WELPE 
Sbjct  616  LAPDGSLQPMTSNKMNEFKKSIEDMAAVSLRCVALAYRLYDPEKVP-NEEQRDTWELPED  674

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILL I+GIKDPCRPGV+
Sbjct  675  ELILLGIVGIKDPCRPGVK  693



>ref|XP_007023810.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
 ref|XP_007023811.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
 gb|EOY26432.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
 gb|EOY26433.1| Autoinhibited Ca(2+)-ATPase 9 isoform 1 [Theobroma cacao]
Length=1084

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQL   V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  506  EAFVGKKKINPPADSSQLHPSVVSLLSEGVAQNSTGNVFVPKDGGDVEISGSPTEKAILS  565

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ +D IRSES+++H FPFNSEKKRGGVA++L DS+VHIHWKGAAE+VL+ C+ Y
Sbjct  566  WAVKLGMKYDVIRSESTVLHVFPFNSEKKRGGVALQLSDSQVHIHWKGAAELVLASCSRY  625

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +DE E    K AI++MAT SLRC+A+AY   + ++IP  EE  +RW LPE 
Sbjct  626  LDSNGCLQSIDE-EKDYLKAAIDEMATSSLRCIALAYRLCEKEEIPTDEESFNRWVLPED  684

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  685  NLVLLAIVGIKDPCRPGVK  703



>ref|XP_007023812.1| Autoinhibited Ca(2+)-ATPase 9 isoform 3 [Theobroma cacao]
 gb|EOY26434.1| Autoinhibited Ca(2+)-ATPase 9 isoform 3 [Theobroma cacao]
Length=1085

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQL   V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  506  EAFVGKKKINPPADSSQLHPSVVSLLSEGVAQNSTGNVFVPKDGGDVEISGSPTEKAILS  565

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ +D IRSES+++H FPFNSEKKRGGVA++L DS+VHIHWKGAAE+VL+ C+ Y
Sbjct  566  WAVKLGMKYDVIRSESTVLHVFPFNSEKKRGGVALQLSDSQVHIHWKGAAELVLASCSRY  625

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +DE E    K AI++MAT SLRC+A+AY   + ++IP  EE  +RW LPE 
Sbjct  626  LDSNGCLQSIDE-EKDYLKAAIDEMATSSLRCIALAYRLCEKEEIPTDEESFNRWVLPED  684

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  685  NLVLLAIVGIKDPCRPGVK  703



>ref|XP_010927267.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X2 [Elaeis guineensis]
Length=1047

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 161/199 (81%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GG +++ P+D  +L   + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL 
Sbjct  469  EAYVGGMKLDAPNDVKELCN-ISPLLIEGIAQNTTGDVFEPEDGGAMEVTGSPTEKAILS  527

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ F+ +RS+SSI+H FPFNSEKKRGGVA++L DS VHIHWKGAAE+VL+CC+++
Sbjct  528  WGVKLGMKFNDVRSKSSILHVFPFNSEKKRGGVAIQLPDSRVHIHWKGAAELVLACCSNW  587

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +  + +V P+  N+   FKK+I+DMA  SLRC+A+AY  YD++K+P +EE+   WELPE 
Sbjct  588  LAPDGSVQPITSNKMNEFKKSIKDMAAVSLRCIALAYRLYDLEKVP-NEEKRDTWELPED  646

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILL I+GIKDPCRPGV+
Sbjct  647  ELILLGIVGIKDPCRPGVK  665



>ref|XP_009385903.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Musa acuminata subsp. malaccensis]
Length=1090

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+GG++INPPD+   L      LL+EGIAQNTTGSVF  E G  EV+GSPTEKAIL +
Sbjct  504  EAYVGGRKINPPDNAELLSSTASSLLIEGIAQNTTGSVFKAETGAFEVTGSPTEKAILSW  563

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHYI  357
            GVKLG+ F+  RSESSIIH FPFNS+KKRGGVAV +   ++H+HWKGAAEIVL+ CT ++
Sbjct  564  GVKLGMTFNDARSESSIIHVFPFNSDKKRGGVAVHQAGDDIHVHWKGAAEIVLASCTSWL  623

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            DAN +  PL  N+   FKK IEDMA  SLRCVA AY  YD++++ ++EE+   W+LPE D
Sbjct  624  DANGSKQPLTANKVTGFKKLIEDMAAASLRCVAFAYRFYDLERV-RNEEQRESWQLPEDD  682

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  683  LVLLAIVGIKDPCRPGVK  700



>ref|XP_010927266.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
isoform X1 [Elaeis guineensis]
Length=1075

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 161/199 (81%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GG +++ P+D  +L   + PLL+EGIAQNTTG VF PE GG  EV+GSPTEKAIL 
Sbjct  497  EAYVGGMKLDAPNDVKELCN-ISPLLIEGIAQNTTGDVFEPEDGGAMEVTGSPTEKAILS  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ F+ +RS+SSI+H FPFNSEKKRGGVA++L DS VHIHWKGAAE+VL+CC+++
Sbjct  556  WGVKLGMKFNDVRSKSSILHVFPFNSEKKRGGVAIQLPDSRVHIHWKGAAELVLACCSNW  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +  + +V P+  N+   FKK+I+DMA  SLRC+A+AY  YD++K+P +EE+   WELPE 
Sbjct  616  LAPDGSVQPITSNKMNEFKKSIKDMAAVSLRCIALAYRLYDLEKVP-NEEKRDTWELPED  674

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILL I+GIKDPCRPGV+
Sbjct  675  ELILLGIVGIKDPCRPGVK  693



>emb|CDY19574.1| BnaA05g19820D [Brassica napus]
Length=602

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  24   ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  83

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  84   WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  143

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D+ +   F+ AI+ MA  SLRCVA+A  + ++ ++PK +E+L +W LPE 
Sbjct  144  MDSNGTLQPIDDQKEF-FRLAIDAMAKNSLRCVAIACRTQELSQVPKEQEDLDKWSLPED  202

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  203  ELTLLAIVGIKDPCRPGVR  221



>gb|KDO47130.1| hypothetical protein CISIN_1g04209132mg, partial [Citrus sinensis]
Length=434

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 153/199 (77%), Gaps = 14/199 (7%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +A+IG K+INPPDD SQ+   VI LL EGIAQNTTG+VFVP+ G   EVSGSPTEKAIL 
Sbjct  109  EAFIGRKKINPPDDSSQMHSIVIYLLSEGIAQNTTGNVFVPKDGEAVEVSGSPTEKAILS  168

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD +RSE++++H FPFNSEKKRGGVAVK ++SEVH+HWKGAAE++L+ CT Y
Sbjct  169  WAVKLGMKFDRVRSETTVLHVFPFNSEKKRGGVAVKRINSEVHVHWKGAAEMILASCTKY  228

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D +  +  +D +E   FK A+++MA  SLRCVA+AY  + +DK          W LPE 
Sbjct  229  LDTDGQLQSIDGDEDF-FKAAVDEMAARSLRCVAIAY-RFILDK----------WTLPEE  276

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGV+
Sbjct  277  ELILLAIVGIKDPCRPGVK  295



>ref|XP_010433051.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Camelina sativa]
Length=1067

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  494  ECYAGFQKMDPPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  553

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA++SESS +  +PFNSEKKRGGVAVK  DS VH+HWKGAAEIVL  CT Y+
Sbjct  554  AIKLGMDFDALKSESSAVQFYPFNSEKKRGGVAVKSSDSSVHVHWKGAAEIVLGSCTQYM  613

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N++ V + E++      AI DMA  SLRCVA+A+  +++DKIP  +E+LSRW LPE D
Sbjct  614  DENESFVDMSEDKMAGLIDAINDMAARSLRCVAIAFRKFEVDKIPTDDEQLSRWVLPEDD  673

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  674  LVLLAIVGIKDPCRPGVK  691



>emb|CDY38264.1| BnaA10g11120D [Brassica napus]
Length=1073

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 154/199 (77%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DSQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+  RS+SSI+HAFPF+SEKKRGGVAVK  D EV IHWKGA+EIVL+CC  Y
Sbjct  552  WGVKLGMNFETARSQSSILHAFPFSSEKKRGGVAVKTADGEVRIHWKGASEIVLACCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E +   FK  IE+MA  +LRCVA+A+ +Y+ +K+P + EELS W LPE 
Sbjct  612  IDEDGNVAPMTEEKEQYFKNGIEEMAGRTLRCVALAFRTYEPEKVP-TGEELSNWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGVR
Sbjct  671  DLILLAIVGIKDPCRPGVR  689



>ref|XP_009120228.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Brassica rapa]
 ref|XP_009120229.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Brassica rapa]
Length=1073

 Score =   251 bits (641),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 154/199 (77%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DSQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+  RS+SSI+HAFPF+SEKKRGGVAVK  D EV IHWKGA+EIVL+CC  Y
Sbjct  552  WGVKLGMNFETARSQSSILHAFPFSSEKKRGGVAVKTADGEVRIHWKGASEIVLACCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E +   FK  IE+MA  +LRCVA+A+ +Y+ +K+P + EELS W LPE 
Sbjct  612  IDEDGNVAPMTEEKEQYFKNGIEEMAGRTLRCVALAFKTYEPEKVP-TGEELSNWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILLAI+GIKDPCRPGVR
Sbjct  671  DLILLAIVGIKDPCRPGVR  689



>gb|KJB56395.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=900

 Score =   250 bits (638),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQLP  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  504  EAFVGKKKINPPSDSSQLPASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILS  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRS+S I+H FPFNSEKKRGGVA++  DSEV IHWKGAAEIVL+ C+ Y
Sbjct  564  WAVKLGMKFDIIRSDSKILHVFPFNSEKKRGGVALQGADSEVRIHWKGAAEIVLTSCSGY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID+N  +  ++E++   FK AI++MA  SLRCVA+AY   + +K+P  EE  + W LPE 
Sbjct  624  IDSNGCLQSINEDKEF-FKAAIDEMAVNSLRCVALAYRLCEKEKVPTDEEGFNGWILPED  682

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  683  NLVLLAIVGIKDPCRPGVK  701



>gb|KJB56394.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=873

 Score =   249 bits (637),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQLP  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  504  EAFVGKKKINPPSDSSQLPASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILS  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRS+S I+H FPFNSEKKRGGVA++  DSEV IHWKGAAEIVL+ C+ Y
Sbjct  564  WAVKLGMKFDIIRSDSKILHVFPFNSEKKRGGVALQGADSEVRIHWKGAAEIVLTSCSGY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID+N  +  ++E++   FK AI++MA  SLRCVA+AY   + +K+P  EE  + W LPE 
Sbjct  624  IDSNGCLQSINEDKEF-FKAAIDEMAVNSLRCVALAYRLCEKEKVPTDEEGFNGWILPED  682

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  683  NLVLLAIVGIKDPCRPGVK  701



>ref|XP_010041252.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like, 
partial [Eucalyptus grandis]
Length=798

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY G K+++PP+D S+L + V  LL EGIAQNT G+VFVP+GG   E+SGSPTEKAIL 
Sbjct  407  EAYAGQKKLDPPNDSSKLHEVVTSLLHEGIAQNTQGNVFVPKGGEDVEISGSPTEKAILS  466

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RSES+++H  PFNS KKRGGVA+K + SEV IHWKGAAE+VL  CT Y
Sbjct  467  WAVKLGMKFDVSRSESTVLHVVPFNSCKKRGGVAIKRNNSEVFIHWKGAAELVLDSCTRY  526

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N    P+DE +   FK+AI+DMA  SLRCVA+A   +D+D +P  EE L +W LPE 
Sbjct  527  VDSNGQFQPIDEEKDF-FKQAIDDMAARSLRCVAIACRQHDLDSVPADEESLDKWVLPED  585

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGV+
Sbjct  586  DLVLLAIVGIKDPCRPGVK  604



>gb|KJB56396.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=941

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQLP  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  504  EAFVGKKKINPPSDSSQLPASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILS  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRS+S I+H FPFNSEKKRGGVA++  DSEV IHWKGAAEIVL+ C+ Y
Sbjct  564  WAVKLGMKFDIIRSDSKILHVFPFNSEKKRGGVALQGADSEVRIHWKGAAEIVLTSCSGY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID+N  +  ++E++   FK AI++MA  SLRCVA+AY   + +K+P  EE  + W LPE 
Sbjct  624  IDSNGCLQSINEDKEF-FKAAIDEMAVNSLRCVALAYRLCEKEKVPTDEEGFNGWILPED  682

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  683  NLVLLAIVGIKDPCRPGVK  701



>ref|XP_006285159.1| hypothetical protein CARUB_v10006503mg [Capsella rubella]
 gb|EOA18057.1| hypothetical protein CARUB_v10006503mg [Capsella rubella]
Length=1070

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++ PD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  496  ECYTGFQKMDTPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  555

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA++SESS +  FPFNSEKKRGGVAVK  D  VH+HWKGAAEIVL  CTHY+
Sbjct  556  AIKLGMDFDALKSESSAVQFFPFNSEKKRGGVAVKSSDLSVHVHWKGAAEIVLGSCTHYM  615

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N++ V + E++      AI DMA  SLRCVA+A+  +++DK+P  +E+LSRW LPE D
Sbjct  616  DENESFVDMSEDKMAGLIDAINDMAARSLRCVAIAFRKFEVDKLPTDDEQLSRWVLPEDD  675

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  676  LVLLAIVGIKDPCRPGVK  693



>gb|KJB56391.1| hypothetical protein B456_009G118300 [Gossypium raimondii]
Length=1082

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQLP  V+ LL EG+AQN+TG+VFVP +GG  E+SGSPTEKAIL 
Sbjct  504  EAFVGKKKINPPSDSSQLPASVVSLLNEGVAQNSTGNVFVPKDGGNIEISGSPTEKAILS  563

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD IRS+S I+H FPFNSEKKRGGVA++  DSEV IHWKGAAEIVL+ C+ Y
Sbjct  564  WAVKLGMKFDIIRSDSKILHVFPFNSEKKRGGVALQGADSEVRIHWKGAAEIVLTSCSGY  623

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID+N  +  ++E++   FK AI++MA  SLRCVA+AY   + +K+P  EE  + W LPE 
Sbjct  624  IDSNGCLQSINEDKEF-FKAAIDEMAVNSLRCVALAYRLCEKEKVPTDEEGFNGWILPED  682

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  683  NLVLLAIVGIKDPCRPGVK  701



>ref|XP_010541090.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010541091.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010541092.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
 ref|XP_010541094.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type 
[Tarenaya hassleriana]
Length=1071

 Score =   249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY G ++++PPD  ++LP     LL+EGIA NT+GSVF  + G  EVSGSPTE+AIL +
Sbjct  496  EAYTGFQKMDPPDSHAKLPPTFTSLLVEGIAHNTSGSVFQSDHGETEVSGSPTERAILNW  555

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+NFDAIRS+SS I  FPFNSEKKRGGVAVK  D++V I+WKGAAEIVL  C+ Y+
Sbjct  556  AIKLGMNFDAIRSDSSAIQFFPFNSEKKRGGVAVKSSDAKVQIYWKGAAEIVLGSCSRYM  615

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D  +++V + E++    + AI+DMA  SLRCVA+AY  Y+ DK+P  EE+LS+W LPE D
Sbjct  616  DEGESLVDMCEDKMEELRNAIDDMAKRSLRCVAIAYRPYETDKVPTDEEQLSKWVLPEDD  675

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  676  LVLLAIVGIKDPCRPGVK  693



>ref|XP_006412795.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 gb|ESQ54248.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
Length=1070

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G  +++PPD  S+LP     +LLEGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  496  ECYAGFLKMDPPDSSSKLPPAFTSILLEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  555

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+NFD++RS SS +   PFNSE+KRGGVAVK  DS VH++WKGAAEIVL  CTHY+
Sbjct  556  AIKLGMNFDSLRSASSAVQFVPFNSEQKRGGVAVKSPDSTVHVYWKGAAEIVLGSCTHYM  615

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N+++V +  ++    K AI DMA  SLRCVA+A+ S++ +KIP  +E+LSRW LP+ D
Sbjct  616  DENESLVDMSGDKMAELKNAINDMAARSLRCVAIAFRSFEAEKIPTDDEQLSRWALPDDD  675

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  676  LVLLAIVGIKDPCRPGVK  693



>ref|XP_009414910.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Musa acuminata subsp. malaccensis]
 ref|XP_009414919.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Musa acuminata subsp. malaccensis]
Length=1095

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+GG++I+PPD+   L      LL+EGIAQNTTGSVFV E GV +V+GSPTEKAIL +
Sbjct  501  EAYVGGRKIDPPDNPELLSPTASTLLIEGIAQNTTGSVFVLETGVVDVTGSPTEKAILSW  560

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHYI  357
            GVKLG+ FD  RS+SSI+H FPFNS+KKRGGVAV +   ++H+HWKGAAEIVL+ CT ++
Sbjct  561  GVKLGMIFDDARSKSSIVHVFPFNSDKKRGGVAVYQGGDDIHVHWKGAAEIVLASCTSWL  620

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            DA+    PL  ++   FKK IEDMA  SLRC+A AY  Y+++++P +EE+   W+LPE D
Sbjct  621  DADGFKQPLTSDKLSEFKKTIEDMAAASLRCIAFAYRLYELERVP-NEEQRDSWQLPEDD  679

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+GIKDPCRPGV+
Sbjct  680  LILLAIVGIKDPCRPGVK  697



>ref|XP_006412793.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 ref|XP_006412794.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 gb|ESQ54246.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
 gb|ESQ54247.1| hypothetical protein EUTSA_v10024281mg [Eutrema salsugineum]
Length=1069

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G  +++PPD  S+LP     +LLEGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  496  ECYAGFLKMDPPDSSSKLPPAFTSILLEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  555

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG+NFD++RS SS +   PFNSE+KRGGVAVK  DS VH++WKGAAEIVL  CTHY+
Sbjct  556  AIKLGMNFDSLRSASSAVQFVPFNSEQKRGGVAVKSPDSTVHVYWKGAAEIVLGSCTHYM  615

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N+++V +  ++    K AI DMA  SLRCVA+A+ S++ +KIP  +E+LSRW LP+ D
Sbjct  616  DENESLVDMSGDKMAELKNAINDMAARSLRCVAIAFRSFEAEKIPTDDEQLSRWALPDDD  675

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  676  LVLLAIVGIKDPCRPGVK  693



>tpg|DAA48121.1| TPA: hypothetical protein ZEAMMB73_416489 [Zea mays]
Length=1143

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY  G +++P DD SQ+      L++EGIAQNTTG+VF+PE GG  E++GSPTEKAIL 
Sbjct  562  EAYFAGTKLDPCDDVSQMSDSAASLIIEGIAQNTTGTVFLPEDGGAAELTGSPTEKAILS  621

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+K+G++FD +R++SS+IH FPFNSEKKRG VAV+LD  VHIHWKGAAEIVLS C  ++
Sbjct  622  WGLKIGMDFDDVRTKSSVIHVFPFNSEKKRGAVAVQLDDGVHIHWKGAAEIVLSSCKSWL  681

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
              + +V  +   +   FK++IEDM   SLRCVA AY S+D++KIP   E+++ WELPE D
Sbjct  682  SVDGSVQSMSAEKHDEFKRSIEDMGANSLRCVAFAYCSFDIEKIPM--EDITSWELPEDD  739

Query  538  LILLAILGIKDPCRPGVR  591
            L LL I+GIKDPCRPGVR
Sbjct  740  LTLLGIIGIKDPCRPGVR  757



>ref|XP_010447798.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Camelina sativa]
Length=1067

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  494  ECYAGFQKMDPPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  553

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA++S SS +  +PFNSEKKRGGVAVK  DS VH+HWKGAAEIVL  CT Y+
Sbjct  554  AIKLGMDFDALKSGSSAVQFYPFNSEKKRGGVAVKSSDSSVHVHWKGAAEIVLGSCTQYM  613

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D N++ V + E++      AI DMA  SLRCVA+A   +++DKIP  EE+LSRW LPE D
Sbjct  614  DENESFVDMSEDKMAGLIDAINDMAARSLRCVAIAVRKFEVDKIPTDEEQLSRWVLPEDD  673

Query  538  LILLAILGIKDPCRPGVR  591
            L+LLAI+GIKDPCRPGV+
Sbjct  674  LVLLAIVGIKDPCRPGVK  691



>ref|XP_011072737.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Sesamum indicum]
Length=1082

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G K+I+PP+D SQL   V  LL EGI QNT GSVF+ + G  E+SGSPTEKAILQ+
Sbjct  502  EAYVGPKKIDPPEDGSQLHATVSSLLDEGIVQNTAGSVFLSKDGELEISGSPTEKAILQW  561

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV--KLDSEVHIHWKGAAEIVLSCCTHY  354
            GVKLG+ FD ++SES ++H  PFNS KKRGGVA+  + +S+V IHWKGAAEI+LS C+HY
Sbjct  562  GVKLGMKFDIVKSESIVLHVSPFNSTKKRGGVALRGRTESKVLIHWKGAAEIILSSCSHY  621

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID N ++  +D+++   FK AI+DMA  +LRCVA+AY + + D++P  EE+L++W LP+ 
Sbjct  622  IDVNGSLQSMDKDKDF-FKDAIDDMAARTLRCVAIAYRTCETDEVPTDEEQLAQWTLPDD  680

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGVR
Sbjct  681  DLVLLAIVGIKDPCRPGVR  699



>ref|XP_006406305.1| hypothetical protein EUTSA_v10019954mg [Eutrema salsugineum]
 gb|ESQ47758.1| hypothetical protein EUTSA_v10019954mg [Eutrema salsugineum]
Length=1087

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  510  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ F+ IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  570  WAYKLGMKFETIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D N+   F+ AI+ MA  SLRCVA+A  +++++K+PK +E+L +W LPE 
Sbjct  630  MDSNGTLQPID-NQKEFFRLAIDAMAKNSLRCVAIACRTHELNKVPKEQEDLDKWALPED  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  689  ELTLLAIVGIKDPCRPGVR  707



>ref|XP_008799456.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Phoenix dactylifera]
Length=953

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +AY GG +++PPDD  QL   + PLL+EG+AQNTTG VF PE G   EVSGSPTEKAIL 
Sbjct  372  EAYAGGMKLDPPDDVEQLCD-ISPLLIEGLAQNTTGDVFEPEDGKAIEVSGSPTEKAILS  430

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ F+ +RS+SSI+  FPFNS+KKRGGVAV+L DS VH+HWKGAAE+VL+CC+ +
Sbjct  431  WGVKLGMKFNEVRSKSSILRVFPFNSDKKRGGVAVQLPDSRVHVHWKGAAELVLACCSSW  490

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +  + +V P+  N+   FKK+IEDMA  SLRCVA+AY  YD+ K+P +EE    WELP+ 
Sbjct  491  LALDGSVQPMTSNKMNEFKKSIEDMAAVSLRCVALAYRLYDLGKVP-NEEHRDTWELPDD  549

Query  535  DLILLAILGIKDPCRPGV  588
            +LILL I+GIKDPCRPGV
Sbjct  550  ELILLGIVGIKDPCRPGV  567



>emb|CDY53981.1| BnaC09g53480D [Brassica napus]
Length=1158

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 153/199 (77%), Gaps = 7/199 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            ++Y GGK+     D  QLP  +  L +EGIAQNTTGS++VPEGG   E SGSPTEKAIL 
Sbjct  496  ESYAGGKKT----DSQQLPATITSLCVEGIAQNTTGSIYVPEGGGDLEFSGSPTEKAILG  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+NF+  RS+SSI+HAFPF+SEKKRGGVAVK  D EV IHWKGA+EIVL+CC  Y
Sbjct  552  WGVKLGMNFETARSQSSILHAFPFSSEKKRGGVAVKTADGEVRIHWKGASEIVLACCRSY  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            ID + NV P+ E +   FK  IE+MA  +LRCVA+A+ +Y+ +K+P + EELS W LPE 
Sbjct  612  IDEDGNVAPMTEEKEQYFKNGIEEMAGRTLRCVALAFRTYEPEKVP-TGEELSNWVLPED  670

Query  535  DLILLAILGIKDPCRPGVR  591
             LILLAI+GIKDPCRPGVR
Sbjct  671  GLILLAIVGIKDPCRPGVR  689



>emb|CDY37311.1| BnaA01g25310D [Brassica napus]
Length=1091

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 154/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  513  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  572

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL CCT Y
Sbjct  573  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLGCCTQY  632

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W LPE 
Sbjct  633  MDSNGTLQPIDSQKEF-FRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWSLPED  691

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  692  ELTLLAIVGIKDPCRPGVR  710



>ref|XP_009109767.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Brassica rapa]
Length=1096

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 154/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  518  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  577

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL CCT Y
Sbjct  578  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLGCCTQY  637

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W LPE 
Sbjct  638  MDSNGTLQPIDSQKEF-FRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWSLPED  696

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  697  ELTLLAIVGIKDPCRPGVR  715



>emb|CDY50072.1| BnaC05g30810D [Brassica napus]
Length=1095

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  517  ETYAGGSKMDVADNPSGLHTKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  576

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  577  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  636

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D+ +   F+ AI+ MA  SLRCVA+A  + ++ ++PK +E+L +W LPE 
Sbjct  637  MDSNGTLQPIDDQKEF-FRLAIDAMAKNSLRCVAIACRTQELSQVPKEQEDLDKWALPED  695

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  696  ELTLLAIVGIKDPCRPGVR  714



>emb|CDY19575.1| BnaA05g19830D [Brassica napus]
Length=1095

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  517  ETYAGGSKMDVADNPSGLHTKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  576

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  577  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  636

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D+ +   F+ AI+ MA  SLRCVA+A  + ++ ++PK +E+L +W LPE 
Sbjct  637  MDSNGTLQPIDDQKEF-FRLAIDAMAKNSLRCVAIACRTQELSQVPKEQEDLDKWALPED  695

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  696  ELTLLAIVGIKDPCRPGVR  714



>emb|CDX82212.1| BnaA03g36090D [Brassica napus]
Length=1090

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  512  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  571

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT +
Sbjct  572  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQF  631

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D+ +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  632  MDSNGTLQPIDDQKEF-FRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  690

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  691  ELTLLAIVGIKDPCRPGVR  709



>gb|EYU21222.1| hypothetical protein MIMGU_mgv1a000501mg [Erythranthe guttata]
Length=1112

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G ++++PP+D +QL   +  LL EG+AQNT+GSVF+ + G  EVSGSPTEKA+LQ+
Sbjct  531  EAYVGKQKMDPPEDGAQLHATISSLLDEGLAQNTSGSVFLSKEGAMEVSGSPTEKAVLQW  590

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV--KLDSEVHIHWKGAAEIVLSCCTHY  354
            GVKLG+ FD ++SES ++H  PFNS KKRGGVAV  K  S+VHIHWKGAAEI+L+ C+ Y
Sbjct  591  GVKLGMKFDVVKSESIVLHVSPFNSTKKRGGVAVRGKTGSQVHIHWKGAAEIILASCSQY  650

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N ++  ++E + +  K AI DMA++SLRCVA+AY + ++D +P  EE+LS+W LP+ 
Sbjct  651  VDVNGSLQSIEEEKEL-LKDAINDMASKSLRCVAIAYRTCEIDTVPTDEEQLSQWTLPDE  709

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDPCRPGV+
Sbjct  710  DLVLLAIVGIKDPCRPGVQ  728



>ref|XP_008799453.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008799454.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008799455.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Phoenix dactylifera]
Length=1074

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +AY GG +++PPDD  QL   + PLL+EG+AQNTTG VF PE G   EVSGSPTEKAIL 
Sbjct  493  EAYAGGMKLDPPDDVEQLCD-ISPLLIEGLAQNTTGDVFEPEDGKAIEVSGSPTEKAILS  551

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GVKLG+ F+ +RS+SSI+  FPFNS+KKRGGVAV+L DS VH+HWKGAAE+VL+CC+ +
Sbjct  552  WGVKLGMKFNEVRSKSSILRVFPFNSDKKRGGVAVQLPDSRVHVHWKGAAELVLACCSSW  611

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +  + +V P+  N+   FKK+IEDMA  SLRCVA+AY  YD+ K+P +EE    WELP+ 
Sbjct  612  LALDGSVQPMTSNKMNEFKKSIEDMAAVSLRCVALAYRLYDLGKVP-NEEHRDTWELPDD  670

Query  535  DLILLAILGIKDPCRPGV  588
            +LILL I+GIKDPCRPGV
Sbjct  671  ELILLGIVGIKDPCRPGV  688



>ref|XP_010696088.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Beta vulgaris subsp. vulgaris]
Length=1089

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 160/199 (80%), Gaps = 4/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY G KR+NPP+D +Q+ ++   L++EG+A NTTGSVFVP +GG  EVSGSPTEKAIL 
Sbjct  511  EAYAGRKRLNPPNDAAQMHKEQSTLVIEGVAVNTTGSVFVPKDGGDAEVSGSPTEKAILS  570

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +GV+LG+ F+A+RSE+ I+H  PFNSEKKRGGVA++L +S+VHIHWKGAAE+VL+ CT +
Sbjct  571  WGVELGMKFEAVRSEAIILHVCPFNSEKKRGGVALQLSNSDVHIHWKGAAEMVLASCTQF  630

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKS-EEELSRWELPE  531
            +D + +V P++ +E   FK  I+DMA +SLRCVA AY  YD + +P + EEEL++W LPE
Sbjct  631  LDTDGSVKPIN-SEKSYFKGVIDDMAAKSLRCVAFAYRPYDRNAVPNTNEEELAQWTLPE  689

Query  532  GDLILLAILGIKDPCRPGV  588
             DLIL+ I+GIKDPCRPGV
Sbjct  690  DDLILVTIVGIKDPCRPGV  708



>tpg|DAA36132.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
Length=1036

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK+++ PD+   L   V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL 
Sbjct  494  EAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILS  553

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS-EVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ F+  R +SSI+H FPFNSEKKRGGVAV LD  EVHIHWKGAAEI+L  CT +
Sbjct  554  WGLKLGMKFNETRLKSSILHVFPFNSEKKRGGVAVHLDGPEVHIHWKGAAEIILDSCTSW  613

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D + +   +   +   FKK IEDMA  SLRCVA AY++++MD +P +E++ + W+LPE 
Sbjct  614  LDTDGSKHSMTPEKIAEFKKFIEDMAVASLRCVAFAYITHEMDDVP-NEDQRAEWKLPED  672

Query  535  DLILLAILGIKDPCRPGVR  591
            +LI+L I+GIKDPCRPGVR
Sbjct  673  NLIMLGIVGIKDPCRPGVR  691



>tpg|DAA36133.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
Length=997

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK+++ PD+   L   V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL 
Sbjct  494  EAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILS  553

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS-EVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ F+  R +SSI+H FPFNSEKKRGGVAV LD  EVHIHWKGAAEI+L  CT +
Sbjct  554  WGLKLGMKFNETRLKSSILHVFPFNSEKKRGGVAVHLDGPEVHIHWKGAAEIILDSCTSW  613

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D + +   +   +   FKK IEDMA  SLRCVA AY++++MD +P +E++ + W+LPE 
Sbjct  614  LDTDGSKHSMTPEKIAEFKKFIEDMAVASLRCVAFAYITHEMDDVP-NEDQRAEWKLPED  672

Query  535  DLILLAILGIKDPCRPGVR  591
            +LI+L I+GIKDPCRPGVR
Sbjct  673  NLIMLGIVGIKDPCRPGVR  691



>ref|XP_009145511.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Brassica rapa]
Length=1095

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  517  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  576

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  577  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  636

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D+ +   F+ AI+ MA  SLRCVA+A  + ++ ++PK +E+L +W LPE 
Sbjct  637  MDSNGTLQPIDDQKEF-FRLAIDAMAKNSLRCVAIACRTQELSQVPKEQEDLDKWSLPED  695

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  696  ELTLLAIVGIKDPCRPGVR  714



>ref|XP_009135736.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Brassica rapa]
Length=1090

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTE+AIL 
Sbjct  512  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTERAILS  571

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT +
Sbjct  572  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQF  631

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D+ +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  632  MDSNGTLQPIDDQKEF-FRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  690

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  691  ELTLLAIVGIKDPCRPGVR  709



>ref|XP_010445063.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
[Camelina sativa]
Length=508

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 154/227 (68%), Gaps = 30/227 (13%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  134  ECYAGFQKMDPPDSSTKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  193

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYI  357
             +KLG++FDA++SESS +  +PFNSEKKRGGVAVK  DS VH+HWKGAAEIVL  CT Y+
Sbjct  194  AIKLGMDFDALKSESSAVQFYPFNSEKKRGGVAVKSSDSSVHVHWKGAAEIVLGSCTQYM  253

Query  358  DANDNVVPLDENEA-------ISFKK----------------------AIEDMATESLRC  450
            D N++ V + E +        +SF                        AI DMA  SLRC
Sbjct  254  DDNESFVDMSEEKTVFLLQVQVSFYSYIYAIKPLYPKSVPDLMAGLIDAINDMAARSLRC  313

Query  451  VAVAYVSYDMDKIPKSEEELSRWELPEGDLILLAILGIKDPCRPGVR  591
            VA+A+  +++DKIP  +E+LSRW LPE DL+LLAI+GIKDPCRPGV+
Sbjct  314  VAIAFRKFEVDKIPTDDEQLSRWVLPEDDLVLLAIVGIKDPCRPGVK  360



>ref|XP_009135735.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Brassica rapa]
Length=1092

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTE+AIL 
Sbjct  514  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTERAILS  573

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT +
Sbjct  574  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQF  633

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D+ +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  634  MDSNGTLQPIDDQKEF-FRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  692

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  693  ELTLLAIVGIKDPCRPGVR  711



>ref|XP_002883291.1| Ca2+-transporting ATPase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59550.1| Ca2+-transporting ATPase [Arabidopsis lyrata subsp. lyrata]
Length=1087

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  510  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  570  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +D  +   F+ AI+ MA  SLRCVA+A  + +++++PK +E+L +W LPE 
Sbjct  630  MDSNGTLQSIDSQKEF-FRVAIDSMAKNSLRCVAIACRTQELNQVPKEQEDLDKWALPED  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  689  ELILLAIVGIKDPCRPGVR  707



>ref|XP_002445842.1| hypothetical protein SORBIDRAFT_07g026810 [Sorghum bicolor]
 gb|EES15337.1| hypothetical protein SORBIDRAFT_07g026810 [Sorghum bicolor]
Length=1087

 Score =   246 bits (628),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY  G +++P DD SQ+    + L++EGIAQNTTG+VF+PE GG  E+SGSPTEKAIL 
Sbjct  506  EAYFAGTKLDPCDDVSQMTDSAVSLIIEGIAQNTTGTVFLPEDGGTAELSGSPTEKAILS  565

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+K+G++F  +R++SS+IH FPFNSEKKRG VAV+ D  VHIHWKGAAEIVLS C  ++
Sbjct  566  WGLKIGMDFHDVRTKSSVIHVFPFNSEKKRGAVAVQSDDGVHIHWKGAAEIVLSSCKSWL  625

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
              N +V  +   +   FKK+IEDMA  SLRCVA AY S+D + IP  EE+++ WELPE  
Sbjct  626  SVNGSVQSMSAEKHDEFKKSIEDMAANSLRCVAFAYCSFDTEMIP--EEDIASWELPEDG  683

Query  538  LILLAILGIKDPCRPGVR  591
            L LL I+GIKDPCRPGV+
Sbjct  684  LTLLGIIGIKDPCRPGVK  701



>ref|XP_006296870.1| hypothetical protein CARUB_v10012867mg [Capsella rubella]
 gb|EOA29768.1| hypothetical protein CARUB_v10012867mg [Capsella rubella]
Length=1088

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  511  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  570

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ F+ IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  571  WAYKLGMKFETIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  630

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  631  MDSNGTLQSIDSQKEF-FRVAIDSMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  689

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  690  ELILLAIVGIKDPCRPGVR  708



>ref|XP_010488101.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Camelina sativa]
 ref|XP_010488102.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Camelina sativa]
Length=1087

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  510  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ F+ IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  570  WAYKLGMKFETIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  630  MDSNGTLQSIDSQKEF-FRVAIDSMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  689  ELILLAIVGIKDPCRPGVR  707



>ref|XP_008789606.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Phoenix dactylifera]
Length=1063

 Score =   245 bits (626),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 154/199 (77%), Gaps = 6/199 (3%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY+GGK+I+P +D   +      LL+EGIAQNTTGSVF PE GG+ E++GSPTEKAIL 
Sbjct  500  EAYVGGKKIDPLED---VESTACALLIEGIAQNTTGSVFEPENGGMIEITGSPTEKAILS  556

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ F   RS+SSI+H FPFNSEKKRGGVAV + DSEVH+HWKGAAEIVL+ CT +
Sbjct  557  WAVKLGMKFRDARSKSSILHVFPFNSEKKRGGVAVHVGDSEVHVHWKGAAEIVLAACTSW  616

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+  V P+  ++  +FKK IEDMA  SLRCV+ AY  YD+  +P SEE+   W+LPE 
Sbjct  617  LDADGLVQPMTSDKVDAFKKLIEDMAAVSLRCVSFAYRLYDLKNVP-SEEQRDNWQLPED  675

Query  535  DLILLAILGIKDPCRPGVR  591
            DLILL I+GIKDPCRPGV+
Sbjct  676  DLILLGIVGIKDPCRPGVK  694



>ref|XP_008668924.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Zea mays]
 ref|XP_008668925.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Zea mays]
 tpg|DAA36130.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
 tpg|DAA36131.1| TPA: hypothetical protein ZEAMMB73_748084 [Zea mays]
Length=1085

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK+++ PD+   L   V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL 
Sbjct  494  EAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILS  553

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS-EVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ F+  R +SSI+H FPFNSEKKRGGVAV LD  EVHIHWKGAAEI+L  CT +
Sbjct  554  WGLKLGMKFNETRLKSSILHVFPFNSEKKRGGVAVHLDGPEVHIHWKGAAEIILDSCTSW  613

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D + +   +   +   FKK IEDMA  SLRCVA AY++++MD +P +E++ + W+LPE 
Sbjct  614  LDTDGSKHSMTPEKIAEFKKFIEDMAVASLRCVAFAYITHEMDDVP-NEDQRAEWKLPED  672

Query  535  DLILLAILGIKDPCRPGVR  591
            +LI+L I+GIKDPCRPGVR
Sbjct  673  NLIMLGIVGIKDPCRPGVR  691



>ref|XP_010466338.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
 ref|XP_010466339.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
 ref|XP_010466340.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
Length=1087

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  510  ETYAGGSKMDVADNPSGLHPKLVDLISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ F+ IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  570  WAYKLGMKFETIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  630  MDSNGTLQSIDSQKEF-FRVAIDSMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  689  ELILLAIVGIKDPCRPGVR  707



>ref|XP_010509827.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
 ref|XP_010509835.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Camelina sativa]
Length=1087

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  510  ETYAGGSKMDVADNPSGLHPKLVDLISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ F+ IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  570  WAYKLGMKFETIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  +D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  630  MDSNGTLQSIDSQKEF-FRVAIDSMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  689  ELILLAIVGIKDPCRPGVR  707



>emb|CDY27537.1| BnaC01g32200D [Brassica napus]
Length=1092

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 154/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG+VF P +GG  E+SGSPTEKAIL 
Sbjct  514  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNVFHPKDGGEVEISGSPTEKAILS  573

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAF FNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  574  WAYKLGMKFDTIRSESAIIHAFTFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  633

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W LPE 
Sbjct  634  MDSNGTLQPIDSQKEF-FRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWSLPED  692

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  693  ELTLLAIVGIKDPCRPGVR  711



>gb|KGN45423.1| Autoinhibited calcium ATPase [Cucumis sativus]
Length=1089

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 151/196 (77%), Gaps = 3/196 (2%)
 Frame = +1

Query  10   IGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGV  186
            +G K INPPDD  QL   V+ LL EG+AQN+TG+VFV  +GG  EVSGSPTEKAIL + V
Sbjct  515  VGRKMINPPDDPLQLNSSVLSLLHEGVAQNSTGNVFVAKDGGGIEVSGSPTEKAILSWAV  574

Query  187  KLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYIDA  363
            KLG+ FD I+SES ++H  PFNSEKKRGGVA+K  +SEV IHWKGAAE+VLS CT ++D+
Sbjct  575  KLGMKFDDIKSESKVLHVVPFNSEKKRGGVAIKRANSEVCIHWKGAAEMVLSSCTKFMDS  634

Query  364  NDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGDLI  543
            N  +  L++NE   FK AI DMA  SLRCVA+AY SY ++KIP  E+ L +W+LP  DL+
Sbjct  635  NGEMHSLEDNEDY-FKTAISDMAARSLRCVAIAYKSYQLEKIPIDEQRLDQWDLPTDDLV  693

Query  544  LLAILGIKDPCRPGVR  591
            LLAI+GIKDPCR GV+
Sbjct  694  LLAIVGIKDPCRDGVK  709



>emb|CDY32412.1| BnaC03g41960D [Brassica napus]
Length=1090

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  512  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  571

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT +
Sbjct  572  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQF  631

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D++  + P+D N+   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  632  MDSSGTLQPID-NQKEFFRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  690

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  691  ELTLLAIVGIKDPCRPGVR  709



>ref|XP_004141743.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=1089

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 151/196 (77%), Gaps = 3/196 (2%)
 Frame = +1

Query  10   IGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGV  186
            +G K INPPDD  QL   V+ LL EG+AQN+TG+VFV  +GG  EVSGSPTEKAIL + V
Sbjct  515  VGRKMINPPDDPLQLNSSVLSLLHEGVAQNSTGNVFVAKDGGGIEVSGSPTEKAILSWAV  574

Query  187  KLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYIDA  363
            KLG+ FD I+SES ++H  PFNSEKKRGGVA+K  +SEV IHWKGAAE+VLS CT ++D+
Sbjct  575  KLGMKFDDIKSESKVLHVVPFNSEKKRGGVAIKRANSEVCIHWKGAAEMVLSSCTKFMDS  634

Query  364  NDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGDLI  543
            N  +  L++NE   FK AI DMA  SLRCVA+AY SY ++KIP  E+ L +W+LP  DL+
Sbjct  635  NGEMHSLEDNEDY-FKTAISDMAARSLRCVAIAYKSYQLEKIPIDEQRLDQWDLPTDDLV  693

Query  544  LLAILGIKDPCRPGVR  591
            LLAI+GIKDPCR GV+
Sbjct  694  LLAIVGIKDPCRDGVK  709



>ref|XP_004159010.1| PREDICTED: LOW QUALITY PROTEIN: calcium-transporting ATPase 9, 
plasma membrane-type-like [Cucumis sativus]
Length=1089

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 151/196 (77%), Gaps = 3/196 (2%)
 Frame = +1

Query  10   IGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQFGV  186
            +G K INPPDD  QL   V+ LL EG+AQN+TG+VFV  +GG  EVSGSPTEKAIL + V
Sbjct  515  VGRKMINPPDDPLQLNSSVLSLLHEGVAQNSTGNVFVAKDGGGIEVSGSPTEKAILSWAV  574

Query  187  KLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHYIDA  363
            KLG+ FD I+SES ++H  PFNSEKKRGGVA+K  +SEV IHWKGAAE+VLS CT ++D+
Sbjct  575  KLGMKFDDIKSESKVLHVVPFNSEKKRGGVAIKRANSEVCIHWKGAAEMVLSSCTKFMDS  634

Query  364  NDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGDLI  543
            N  +  L++NE   FK AI DMA  SLRCVA+AY SY ++KIP  E+ L +W+LP  DL+
Sbjct  635  NGEMHSLEDNEDY-FKTAISDMAARSLRCVAIAYKSYQLEKIPIDEQRLDQWDLPTDDLV  693

Query  544  LLAILGIKDPCRPGVR  591
            LLAI+GIKDPCR GV+
Sbjct  694  LLAIVGIKDPCRDGVK  709



>ref|XP_009386789.1| PREDICTED: LOW QUALITY PROTEIN: calcium-transporting ATPase 9, 
plasma membrane-type-like, partial [Musa acuminata subsp. 
malaccensis]
Length=858

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +A +GG +++ PD+   L      LL+EGIAQNTTG+VFVPE G  EVSGSPTEKAIL +
Sbjct  284  EANVGGMKLSSPDNCDILTDAASHLLIEGIAQNTTGNVFVPEDGPAEVSGSPTEKAILSW  343

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHYI  357
            G+KLG+ FD +R+ +SI+H  PFNSEKK GGVA+K+ DS++H+HWKGAAE++L+ CT + 
Sbjct  344  GIKLGMKFDVVRAAASILHVVPFNSEKKHGGVAIKVADSKIHVHWKGAAELILAACTSWF  403

Query  358  DANDNVVPLDENEAIS-FKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            DA+ ++ P+  ++ ++ FK +IEDMA  SLRCVA AY  YD+DKIP  E++  +WELPE 
Sbjct  404  DADGSIRPMTSDKEMNEFKNSIEDMAALSLRCVAFAYRLYDLDKIPH-EDKRDKWELPED  462

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCRPGV+
Sbjct  463  ELVLLAIVGIKDPCRPGVK  481



>ref|XP_006845776.1| hypothetical protein AMTR_s00019p00251600 [Amborella trichopoda]
 gb|ERN07451.1| hypothetical protein AMTR_s00019p00251600 [Amborella trichopoda]
Length=1079

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +A++GG  ++PP++  ++  KV  L+ EGIAQNTTGSVF+PEGG  P+V+GSPTE+AIL 
Sbjct  499  EAFVGGAMVHPPENTEKMSPKVASLITEGIAQNTTGSVFIPEGGRAPDVTGSPTERAILS  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G++L ++FD +RS SS++H F FNSEKKRGGVA+KL +SEVHIHWKGAAEI+L+ CT +
Sbjct  559  WGLQLRMDFDVLRSISSVLHVFTFNSEKKRGGVAIKLSESEVHIHWKGAAEIILASCTQW  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D +     +D ++   F+KAI++MA  SLRCVA AY   +++ +P+ EEEL +W +PE 
Sbjct  619  LDKDGVEHRMDGDKIAEFQKAIDEMAAASLRCVAFAYRVCNVEGVPQGEEELEQWAMPED  678

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LLAI+GIKDPCRPGV
Sbjct  679  DLVLLAIVGIKDPCRPGV  696



>gb|KCW53956.1| hypothetical protein EUGRSUZ_J031612, partial [Eucalyptus grandis]
Length=698

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY G K+++PP+D S+L + V  LL EG+AQNT G+VFVP+GG   E+SGSPTEKAIL 
Sbjct  156  EAYAGRKKLDPPNDSSKLHEVVTSLLHEGVAQNTQGNVFVPKGGEDVEISGSPTEKAILL  215

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RSES+++H  PFNS KKRGGVA+K + SEV IHWKGAAE+VL  CT Y
Sbjct  216  WAVKLGMKFDVSRSESTVLHVVPFNSHKKRGGVAIKRNNSEVFIHWKGAAELVLDSCTRY  275

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N    P+D+ +   FK+AI+DMA  SLRCVA+A   +D+D +P  +E L +W LPE 
Sbjct  276  VDSNGQFQPIDKEKDF-FKQAIDDMAARSLRCVAIACRQHDLDSVPADKESLDKWVLPED  334

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDP RPGV+
Sbjct  335  DLVLLAIVGIKDPFRPGVK  353



>ref|NP_188755.2| calcium-transporting ATPase 9 [Arabidopsis thaliana]
 sp|Q9LU41.2|ACA9_ARATH RecName: Full=Calcium-transporting ATPase 9, plasma membrane-type; 
AltName: Full=Ca(2+)-ATPase isoform 9 [Arabidopsis thaliana]
 dbj|BAE99265.1| putative Ca2+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE76473.1| calcium-transporting ATPase 9 [Arabidopsis thaliana]
Length=1086

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  509  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  568

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  569  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  628

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  ++  +   F+ AI+ MA  SLRCVA+A  + +++++PK +E+L +W LPE 
Sbjct  629  MDSNGTLQSIESQKEF-FRVAIDSMAKNSLRCVAIACRTQELNQVPKEQEDLDKWALPED  687

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  688  ELILLAIVGIKDPCRPGVR  706



>dbj|BAB01709.1| Ca2+-transporting ATPase [Arabidopsis thaliana]
Length=1073

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG +++  D+ S L  K++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  496  ETYAGGSKMDVADNPSGLHPKLVALISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT Y
Sbjct  556  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQY  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  ++  +   F+ AI+ MA  SLRCVA+A  + +++++PK +E+L +W LPE 
Sbjct  616  MDSNGTLQSIESQKEF-FRVAIDSMAKNSLRCVAIACRTQELNQVPKEQEDLDKWALPED  674

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGVR
Sbjct  675  ELILLAIVGIKDPCRPGVR  693



>ref|XP_010063652.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Eucalyptus grandis]
Length=947

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+++PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL 
Sbjct  372  EAYVGRKKMDPPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILS  431

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FDA+R+ES+ +H FPFNSEKKRGGVA+ K  S+VHIHWKGAAEIVL+ CT +
Sbjct  432  WAVKLGMKFDAVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHIHWKGAAEIVLASCTKF  491

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
             D++ ++  +DE E   FK AI+DMA  SLRCVA+AY  +D DK+   +  L  W LP+ 
Sbjct  492  FDSDGHLRTIDE-EKDFFKLAIDDMAARSLRCVAIAYRPFDSDKVRGDDAGLDNWVLPDD  550

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LL+++GIKDPCRPGV
Sbjct  551  DLVLLSVVGIKDPCRPGV  568



>gb|KCW70887.1| hypothetical protein EUGRSUZ_F04017 [Eucalyptus grandis]
Length=994

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+++PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL 
Sbjct  419  EAYVGRKKMDPPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILS  478

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FDA+R+ES+ +H FPFNSEKKRGGVA+ K  S+VHIHWKGAAEIVL+ CT +
Sbjct  479  WAVKLGMKFDAVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHIHWKGAAEIVLASCTKF  538

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
             D++ ++  +DE E   FK AI+DMA  SLRCVA+AY  +D DK+   +  L  W LP+ 
Sbjct  539  FDSDGHLRTIDE-EKDFFKLAIDDMAARSLRCVAIAYRPFDSDKVRGDDAGLDNWVLPDD  597

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LL+++GIKDPCRPGV
Sbjct  598  DLVLLSVVGIKDPCRPGV  615



>gb|KFK39423.1| hypothetical protein AALP_AA3G243100 [Arabis alpina]
Length=1087

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 154/199 (77%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            + Y GG ++   D+ S L   ++ L+ EG+AQNTTG++F P +GG  E+SGSPTEKAIL 
Sbjct  510  ETYAGGAKMEVADNPSGLHPNLVHLISEGVAQNTTGNIFHPKDGGEVEISGSPTEKAILS  569

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +  KLG+ FD IRSES+IIHAFPFNSEKKRGGVAV + DSEV IHWKGAAEIVL+CCT +
Sbjct  570  WAYKLGMKFDTIRSESAIIHAFPFNSEKKRGGVAVLRGDSEVFIHWKGAAEIVLACCTQF  629

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  + P+D  +   F+ AI+ MA  SLRCVA+A  + +++K+PK +E+L +W+LPE 
Sbjct  630  MDSNGTLQPIDSQKEF-FRLAIDAMAKNSLRCVAIACRTQELNKVPKEQEDLDKWDLPED  688

Query  535  DLILLAILGIKDPCRPGVR  591
            +L LLAI+GIKDPCRPGVR
Sbjct  689  ELTLLAIVGIKDPCRPGVR  707



>ref|XP_010063651.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Eucalyptus grandis]
Length=1070

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+++PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL 
Sbjct  495  EAYVGRKKMDPPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILS  554

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FDA+R+ES+ +H FPFNSEKKRGGVA+ K  S+VHIHWKGAAEIVL+ CT +
Sbjct  555  WAVKLGMKFDAVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHIHWKGAAEIVLASCTKF  614

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
             D++ ++  +DE E   FK AI+DMA  SLRCVA+AY  +D DK+   +  L  W LP+ 
Sbjct  615  FDSDGHLRTIDE-EKDFFKLAIDDMAARSLRCVAIAYRPFDSDKVRGDDAGLDNWVLPDD  673

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LL+++GIKDPCRPGV
Sbjct  674  DLVLLSVVGIKDPCRPGV  691



>ref|XP_010063650.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Eucalyptus grandis]
Length=1072

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +AY+G K+++PPDD SQL   +  LL+EGIA NT G+V+VP +GG  EV+GSPTEKAIL 
Sbjct  497  EAYVGRKKMDPPDDASQLHHLISSLLIEGIAHNTQGNVYVPKDGGDAEVTGSPTEKAILS  556

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FDA+R+ES+ +H FPFNSEKKRGGVA+ K  S+VHIHWKGAAEIVL+ CT +
Sbjct  557  WAVKLGMKFDAVRAESTELHVFPFNSEKKRGGVAIQKTSSDVHIHWKGAAEIVLASCTKF  616

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
             D++ ++  +DE E   FK AI+DMA  SLRCVA+AY  +D DK+   +  L  W LP+ 
Sbjct  617  FDSDGHLRTIDE-EKDFFKLAIDDMAARSLRCVAIAYRPFDSDKVRGDDAGLDNWVLPDD  675

Query  535  DLILLAILGIKDPCRPGV  588
            DL+LL+++GIKDPCRPGV
Sbjct  676  DLVLLSVVGIKDPCRPGV  693



>ref|XP_008663568.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Zea mays]
Length=1089

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 148/199 (74%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK+++ PD+   L   V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL 
Sbjct  498  EAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILS  557

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ F   RS+SSI+H FPFNSEKKRGGVAV L  SEVHIHWKGAAEI+L  CT +
Sbjct  558  WGLKLGMKFSETRSKSSILHVFPFNSEKKRGGVAVYLAGSEVHIHWKGAAEIILDSCTSW  617

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D   +   +   +   FKK IEDMA  SLRCVA AY +++MD +P  E+    W+LPE 
Sbjct  618  VDTGGSKHSMTPEKVAEFKKFIEDMAAASLRCVAFAYRTHEMDDVP-DEDRREEWQLPED  676

Query  535  DLILLAILGIKDPCRPGVR  591
            +LI+L I+GIKDPCRPGVR
Sbjct  677  NLIMLGIVGIKDPCRPGVR  695



>ref|XP_009594203.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009594204.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana tomentosiformis]
 ref|XP_009594205.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana tomentosiformis]
Length=1079

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AYIG K+++PP+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL 
Sbjct  501  EAYIGEKKLDPPEDGSQLHSAVSSLLDEGITQNTSGSVFASKDGKGIEVSGSPTEKAILS  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK--LDSEVHIHWKGAAEIVLSCCTH  351
            +GVK+G+ F  +RS+S I+H  PFNS KKRGGVAV+    S+VH+HWKGAAEI+L+ CT 
Sbjct  561  WGVKMGMKFKVVRSQSIILHVSPFNSTKKRGGVAVRERSGSQVHMHWKGAAEIILASCTE  620

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  +  + E E   FK+AIEDMA +SLRCVA+AY + ++D++P  EE+L+RW LPE
Sbjct  621  YLDSNGCLQSI-EKEKDFFKEAIEDMAAKSLRCVAMAYRTCNVDEVPTDEEQLARWVLPE  679

Query  532  GDLILLAILGIKDPCRPGVR  591
              LILLAILGIKDPCRPGV+
Sbjct  680  DGLILLAILGIKDPCRPGVK  699



>ref|XP_004973946.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Setaria italica]
Length=1083

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AY  G +++P DD SQ+      ++LEGIAQNTTG+VF+PE GG PE++GSPTEKAIL 
Sbjct  503  EAYFAGTKLDPCDDISQISDDSAAIILEGIAQNTTGTVFLPEDGGEPELTGSPTEKAILS  562

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+K+G++F  +RS+SS+IH FPFNS+KKRG VAV+ D  VH+HWKGAAEIVLS C  ++
Sbjct  563  WGLKIGMDFHDMRSKSSVIHVFPFNSDKKRGAVAVQSDEGVHVHWKGAAEIVLSSCKSWL  622

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
              + +V P+   +   +KK+IEDMA  SLRCVA AY + D + IPK  E+++ W+LPE D
Sbjct  623  SVDGSVQPMSTEKHDEYKKSIEDMAVNSLRCVAFAYCAPDGEMIPK--EDIANWKLPEDD  680

Query  538  LILLAILGIKDPCRPGVR  591
            LILL I+GIKDPCRPGVR
Sbjct  681  LILLGIVGIKDPCRPGVR  698



>ref|XP_004976722.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X2 [Setaria italica]
Length=1092

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 151/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK++  PD+   L   V  L++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL 
Sbjct  499  EAYFGGKKMESPDNAQVLSADVTSLIVEGIAQNTSGSIFEPEGGQEPEVTGSPTEKAILS  558

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ F+  RS+SSI+H FPFNSEKKRGGVAV L  SEVHIHWKGAAEI+L  CT +
Sbjct  559  WGLKLGMKFNETRSKSSILHVFPFNSEKKRGGVAVHLGGSEVHIHWKGAAEIILDSCTSW  618

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D + +   +   +   FKK IEDMA  SLRCVA AY +Y++D +P +E+  + W+LPE 
Sbjct  619  LDTDGSKHSMTPEKVAEFKKFIEDMAAASLRCVAFAYRTYEIDDVP-NEDLRAEWKLPED  677

Query  535  DLILLAILGIKDPCRPGVR  591
            +LI+L I+GIKDPCRPG+R
Sbjct  678  NLIMLGIVGIKDPCRPGLR  696



>ref|XP_009786114.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana sylvestris]
 ref|XP_009786115.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
[Nicotiana sylvestris]
Length=1079

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AYIG K+++PP+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL 
Sbjct  501  EAYIGEKKLDPPEDGSQLHSAVSSLLDEGITQNTSGSVFASKDGKGIEVSGSPTEKAILT  560

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK--LDSEVHIHWKGAAEIVLSCCTH  351
            +GVK+G+ F+ +RS+S I+H  PFNS KKRGGVAV+    S+VH+HWKGAAEI+L+ CT 
Sbjct  561  WGVKMGMKFEVVRSQSIILHVSPFNSTKKRGGVAVRERSGSQVHMHWKGAAEIILASCTQ  620

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  +  + E E   FK+AIEDMA +SLRCVA+AY + ++D++P  EE+L+RW LPE
Sbjct  621  YLDSNGCLQSI-EKEKDLFKEAIEDMAAKSLRCVAMAYRTCNIDEVPSDEEQLARWVLPE  679

Query  532  GDLILLAILGIKDPCRPGVR  591
              LILLAI GIKDPCRPGV+
Sbjct  680  DGLILLAIFGIKDPCRPGVK  699



>gb|EMT28209.1| Calcium-transporting ATPase 9, plasma membrane-type [Aegilops 
tauschii]
Length=973

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +A+  G R++P DD   +      LL+EGIAQNTTG+VF+PE GG  +V+GSPTEKAIL 
Sbjct  232  EAHFIGTRLDPCDDVRAISSSSAALLIEGIAQNTTGTVFLPEDGGAADVTGSPTEKAILS  291

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
            +G+K+G++F+ +RS+SS++H FPFNSEKKRGGVAV+ D+ VHIHWKGAAE+VLS C  ++
Sbjct  292  WGLKIGMDFNDVRSKSSVLHVFPFNSEKKRGGVAVQSDTGVHIHWKGAAELVLSSCKSWL  351

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
              + +V P+   +   +KK+IEDMA  SLRCVA AY   D++KIPK  E+++ W+LPE D
Sbjct  352  SLDGSVQPMGAQKRNEYKKSIEDMAKSSLRCVAFAYCQCDIEKIPK--EDIADWKLPEED  409

Query  538  LILLAILGIKDPCRPGVR  591
            L LL I+GIKDPCRPGVR
Sbjct  410  LTLLGIVGIKDPCRPGVR  427



>ref|XP_010034879.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Eucalyptus grandis]
Length=1036

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVP-EVSGSPTEKAILQ  177
            +AY G K+++PP+D S+L + V  LL EG+AQNT G+VFVP+GG   E+SGSPTEKAIL 
Sbjct  450  EAYAGRKKLDPPNDSSKLHEVVTSLLHEGVAQNTQGNVFVPKGGEDVEISGSPTEKAILL  509

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD  RSES+++H  PFNS KKRGGVA+K + SEV IHWKGAAE+VL  CT Y
Sbjct  510  WAVKLGMKFDVSRSESTVLHVVPFNSHKKRGGVAIKRNNSEVFIHWKGAAELVLDSCTRY  569

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N    P+D+ +   FK+AI+DMA  SLRCVA+A   +D+D +P  +E L +W LPE 
Sbjct  570  VDSNGQFQPIDKEKDF-FKQAIDDMAARSLRCVAIACRQHDLDSVPADKESLDKWVLPED  628

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LLAI+GIKDP RPGV+
Sbjct  629  DLVLLAIVGIKDPFRPGVK  647



>ref|XP_002448481.1| hypothetical protein SORBIDRAFT_06g027770 [Sorghum bicolor]
 gb|EES12809.1| hypothetical protein SORBIDRAFT_06g027770 [Sorghum bicolor]
Length=1092

 Score =   240 bits (612),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 149/200 (75%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE--GGVPEVSGSPTEKAIL  174
            +AY GGK+++ PD+   L   V  L++EGIAQNT+GS+F PE  G  PEV+GSPTEKAIL
Sbjct  502  EAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEHGGQEPEVTGSPTEKAIL  561

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
             +G+KLG+ F+  RS+SSI+H FPFNSEKKRGGVAV L  SEVHIHWKGAAEI+L  CT 
Sbjct  562  SWGLKLGMKFNETRSKSSILHVFPFNSEKKRGGVAVHLGGSEVHIHWKGAAEIILDSCTG  621

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            ++D + +   +   +   FKK IEDMA  SLRCVA AY +++MD +P  E+    W+LPE
Sbjct  622  WVDTDGSKHSMTPEKVAEFKKFIEDMAAASLRCVAFAYRTHEMDDVP-DEDHREEWKLPE  680

Query  532  GDLILLAILGIKDPCRPGVR  591
             +LI+L I+GIKDPCRPGVR
Sbjct  681  DNLIMLGIVGIKDPCRPGVR  700



>ref|XP_010447799.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X3 [Camelina sativa]
Length=1057

 Score =   239 bits (611),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 150/205 (73%), Gaps = 8/205 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  494  ECYAGFQKMDPPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  553

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK--------LDSEVHIHWKGAAEIVL  336
             +KLG++FDA++S SS +  +PFNSEKKRGGVAVK         DS VH+HWKGAAEIVL
Sbjct  554  AIKLGMDFDALKSGSSAVQFYPFNSEKKRGGVAVKSVTFSSVFSDSSVHVHWKGAAEIVL  613

Query  337  SCCTHYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSR  516
              CT Y+D N++ V + E++      AI DMA  SLRCVA+A   +++DKIP  EE+LSR
Sbjct  614  GSCTQYMDENESFVDMSEDKMAGLIDAINDMAARSLRCVAIAVRKFEVDKIPTDEEQLSR  673

Query  517  WELPEGDLILLAILGIKDPCRPGVR  591
            W LPE DL+LLAI+GIKDPCRPGV+
Sbjct  674  WVLPEDDLVLLAIVGIKDPCRPGVK  698



>ref|XP_010447795.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Camelina sativa]
 ref|XP_010447796.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Camelina sativa]
 ref|XP_010447797.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Camelina sativa]
Length=1074

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 150/205 (73%), Gaps = 8/205 (4%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            + Y G ++++PPD  ++LP     +L+EGIA NTTGSVF  E G  +VSGSPTE+AIL +
Sbjct  494  ECYAGFQKMDPPDSSAKLPSAFTSILVEGIAHNTTGSVFRSESGEIQVSGSPTERAILNW  553

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK--------LDSEVHIHWKGAAEIVL  336
             +KLG++FDA++S SS +  +PFNSEKKRGGVAVK         DS VH+HWKGAAEIVL
Sbjct  554  AIKLGMDFDALKSGSSAVQFYPFNSEKKRGGVAVKSVTFSSVFSDSSVHVHWKGAAEIVL  613

Query  337  SCCTHYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSR  516
              CT Y+D N++ V + E++      AI DMA  SLRCVA+A   +++DKIP  EE+LSR
Sbjct  614  GSCTQYMDENESFVDMSEDKMAGLIDAINDMAARSLRCVAIAVRKFEVDKIPTDEEQLSR  673

Query  517  WELPEGDLILLAILGIKDPCRPGVR  591
            W LPE DL+LLAI+GIKDPCRPGV+
Sbjct  674  WVLPEDDLVLLAIVGIKDPCRPGVK  698



>emb|CDO97752.1| unnamed protein product [Coffea canephora]
Length=1134

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AY+G  +++PP+D S+L   V  LL EGI+QN+ GSVF+ + G  EVSGSPTEKAIL +
Sbjct  557  EAYVGKNKMDPPEDGSKLHAVVSSLLDEGISQNSAGSVFLSKDGGVEVSGSPTEKAILSW  616

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV--KLDSEVHIHWKGAAEIVLSCCTHY  354
             VKLG+ FD +RSES ++H  PFNS KKRGGVAV  K +SEVHIHWKGAAEI+L  CT Y
Sbjct  617  AVKLGMKFDVVRSESIVLHVSPFNSTKKRGGVAVRGKSNSEVHIHWKGAAEIILDSCTEY  676

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N  +  +D+++   FK AIE MA +SLRCVA+AY   +++K+P  EE+L+ W LPE 
Sbjct  677  LDINGRLQSIDQDKEF-FKSAIETMAAKSLRCVAIAYRKCEVEKVPTDEEQLAGWVLPED  735

Query  535  DLILLAILGIKDPCRPGVR  591
            +LILLAI+GIKDPCRPGV+
Sbjct  736  ELILLAIVGIKDPCRPGVK  754



>ref|XP_008462221.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Cucumis melo]
Length=994

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A +G K INPPDD  QL   V+ LL EG+A N+TG+VFV  +GG  EVSGSPTEKAIL 
Sbjct  417  EACVGRKMINPPDDPLQLNSLVLTLLHEGVALNSTGNVFVAKDGGGIEVSGSPTEKAILS  476

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD I+SES ++H  PFNSEKKRGGVA+K  +SEV IHWKGAAE+VLS CT +
Sbjct  477  WAVKLGMKFDDIKSESKVLHVVPFNSEKKRGGVAIKRANSEVCIHWKGAAEMVLSSCTKF  536

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N  V  ++ NE   FK AI DMA  SLRCVA+AY SY ++KIP  E+ L +W+LP  
Sbjct  537  MDLNGEVHSIEGNEDY-FKAAISDMAARSLRCVAIAYRSYQLEKIPIDEQRLDQWDLPAD  595

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LL+I+GIKDPCR GV+
Sbjct  596  DLVLLSIVGIKDPCRDGVK  614



>ref|XP_008663567.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Zea mays]
 gb|AFW59362.1| hypothetical protein ZEAMMB73_703991 [Zea mays]
Length=1090

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 147/200 (74%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG--VPEVSGSPTEKAIL  174
            +AY GGK+++ PD+   L   V  L++EGIAQNT+GS+F PE G   PEV+GSPTEKAIL
Sbjct  498  EAYFGGKKMDSPDNAQMLSADVTSLIVEGIAQNTSGSIFEPEQGGQEPEVTGSPTEKAIL  557

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
             +G+KLG+ F   RS+SSI+H FPFNSEKKRGGVAV L  SEVHIHWKGAAEI+L  CT 
Sbjct  558  SWGLKLGMKFSETRSKSSILHVFPFNSEKKRGGVAVYLAGSEVHIHWKGAAEIILDSCTS  617

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            ++D   +   +   +   FKK IEDMA  SLRCVA AY +++MD +P  E+    W+LPE
Sbjct  618  WVDTGGSKHSMTPEKVAEFKKFIEDMAAASLRCVAFAYRTHEMDDVP-DEDRREEWQLPE  676

Query  532  GDLILLAILGIKDPCRPGVR  591
             +LI+L I+GIKDPCRPGVR
Sbjct  677  DNLIMLGIVGIKDPCRPGVR  696



>ref|XP_008462219.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Cucumis melo]
Length=1089

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A +G K INPPDD  QL   V+ LL EG+A N+TG+VFV  +GG  EVSGSPTEKAIL 
Sbjct  512  EACVGRKMINPPDDPLQLNSLVLTLLHEGVALNSTGNVFVAKDGGGIEVSGSPTEKAILS  571

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVK-LDSEVHIHWKGAAEIVLSCCTHY  354
            + VKLG+ FD I+SES ++H  PFNSEKKRGGVA+K  +SEV IHWKGAAE+VLS CT +
Sbjct  572  WAVKLGMKFDDIKSESKVLHVVPFNSEKKRGGVAIKRANSEVCIHWKGAAEMVLSSCTKF  631

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D N  V  ++ NE   FK AI DMA  SLRCVA+AY SY ++KIP  E+ L +W+LP  
Sbjct  632  MDLNGEVHSIEGNEDY-FKAAISDMAARSLRCVAIAYRSYQLEKIPIDEQRLDQWDLPAD  690

Query  535  DLILLAILGIKDPCRPGVR  591
            DL+LL+I+GIKDPCR GV+
Sbjct  691  DLVLLSIVGIKDPCRDGVK  709



>ref|XP_006342864.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type-like 
[Solanum tuberosum]
Length=1074

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY+G +++N P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL 
Sbjct  496  EAYVGERKLNSPEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILS  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS--EVHIHWKGAAEIVLSCCTH  351
            +GVK+G+ FD +RS+S ++H  PFNS KKRGGVAV+  S  +VH+HWKGAAEI+L+ CT 
Sbjct  556  WGVKIGMKFDVVRSQSIVLHVSPFNSTKKRGGVAVREQSGSQVHMHWKGAAEIILASCTG  615

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  +  + E E    K+AIEDMA +SLRCVA+AY + +++++P  EE+L++W LPE
Sbjct  616  YLDSNGCLQSI-ETEKDFLKEAIEDMAAKSLRCVAIAYQTCNVNEVPTDEEQLAQWILPE  674

Query  532  GDLILLAILGIKDPCRPGVR  591
             DLILLAILGIKDPCRPGV+
Sbjct  675  DDLILLAILGIKDPCRPGVK  694



>gb|EMS62084.1| Calcium-transporting ATPase 9, plasma membrane-type [Triticum 
urartu]
Length=1525

 Score =   240 bits (613),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = +1

Query  1     DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
             +A+  G R++P DD   +      LL+EGIAQNTTG+VF+PE GG  +V+GSPTEKAIL 
Sbjct  984   EAHFIGTRLDPCDDVRAISSSSAALLIEGIAQNTTGTVFLPEDGGAADVTGSPTEKAILS  1043

Query  178   FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYI  357
             +G+K+G++F+ +RS+SS++H FPFNSEKKRGGVAV+ D+EVHIHWKGAAE+VLS C  ++
Sbjct  1044  WGLKIGMDFNNVRSKSSVLHVFPFNSEKKRGGVAVQSDTEVHIHWKGAAELVLSSCKSWL  1103

Query  358   DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
               + +V P+   +   +KK+IEDMA  SLRCVA AY   D++KIPK  E+++ W+LPE D
Sbjct  1104  SLDGSVQPMGAQKRNEYKKSIEDMAKSSLRCVAFAYCLCDIEKIPK--EDIADWKLPEED  1161

Query  538   LILLAILGIKDPCRPGVR  591
             L LL I+GIKDPCRPGVR
Sbjct  1162  LTLLGIVGIKDPCRPGVR  1179



>ref|XP_009385964.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1103

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AYIGGK+I+PPD+   +   V  LL EGIAQNTTGSVF PE G  E+SGSPTEKAIL +
Sbjct  519  EAYIGGKKIDPPDNVRLISSSVSSLLYEGIAQNTTGSVFKPESGALELSGSPTEKAILHW  578

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHYI  357
            G KL + FD  +S+SSII+ FPFNSEKKRGGVAV L  SEVH+HWKGAAEIVL+ C  ++
Sbjct  579  GFKLEMEFDYAKSKSSIIYVFPFNSEKKRGGVAVHLSGSEVHVHWKGAAEIVLASCIGWL  638

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +  + P+  ++   FKK IEDMA+ SLRC+A AY  ++++ IP +EE+ + W LPE D
Sbjct  639  DIDGAMQPMTADKVNEFKKYIEDMASASLRCIAFAYRHFNLENIP-NEEQRNDWLLPEDD  697

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+G+KDPCRPGV+
Sbjct  698  LILLAIVGMKDPCRPGVK  715



>ref|XP_009385965.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009385966.1| PREDICTED: calcium-transporting ATPase 10, plasma membrane-type-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1078

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGVPEVSGSPTEKAILQF  180
            +AYIGGK+I+PPD+   +   V  LL EGIAQNTTGSVF PE G  E+SGSPTEKAIL +
Sbjct  494  EAYIGGKKIDPPDNVRLISSSVSSLLYEGIAQNTTGSVFKPESGALELSGSPTEKAILHW  553

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHYI  357
            G KL + FD  +S+SSII+ FPFNSEKKRGGVAV L  SEVH+HWKGAAEIVL+ C  ++
Sbjct  554  GFKLEMEFDYAKSKSSIIYVFPFNSEKKRGGVAVHLSGSEVHVHWKGAAEIVLASCIGWL  613

Query  358  DANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGD  537
            D +  + P+  ++   FKK IEDMA+ SLRC+A AY  ++++ IP +EE+ + W LPE D
Sbjct  614  DIDGAMQPMTADKVNEFKKYIEDMASASLRCIAFAYRHFNLENIP-NEEQRNDWLLPEDD  672

Query  538  LILLAILGIKDPCRPGVR  591
            LILLAI+G+KDPCRPGV+
Sbjct  673  LILLAIVGMKDPCRPGVK  690



>ref|XP_004976721.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
isoform X1 [Setaria italica]
Length=1093

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 150/200 (75%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG--VPEVSGSPTEKAIL  174
            +AY GGK++  PD+   L   V  L++EGIAQNT+GS+F PE G   PEV+GSPTEKAIL
Sbjct  499  EAYFGGKKMESPDNAQVLSADVTSLIVEGIAQNTSGSIFEPEQGGQEPEVTGSPTEKAIL  558

Query  175  QFGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTH  351
             +G+KLG+ F+  RS+SSI+H FPFNSEKKRGGVAV L  SEVHIHWKGAAEI+L  CT 
Sbjct  559  SWGLKLGMKFNETRSKSSILHVFPFNSEKKRGGVAVHLGGSEVHIHWKGAAEIILDSCTS  618

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            ++D + +   +   +   FKK IEDMA  SLRCVA AY +Y++D +P +E+  + W+LPE
Sbjct  619  WLDTDGSKHSMTPEKVAEFKKFIEDMAAASLRCVAFAYRTYEIDDVP-NEDLRAEWKLPE  677

Query  532  GDLILLAILGIKDPCRPGVR  591
             +LI+L I+GIKDPCRPG+R
Sbjct  678  DNLIMLGIVGIKDPCRPGLR  697



>emb|CAC40035.1| P-type ATPase [Hordeum vulgare]
Length=599

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +AY GG++++PPD+  +L   V  +++EGIAQNT+GS+F PEGG  PEV+GSPTEKAIL 
Sbjct  11   EAYFGGEKMDPPDNTQKLSAPVSTMIIEGIAQNTSGSIFEPEGGQAPEVTGSPTEKAILS  70

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G++LG+ F   RS+SSI+  FPFNSEKKRGGVAV++ DSEVH++WKGAAE++L  CT +
Sbjct  71   WGLQLGMKFSETRSKSSILQVFPFNSEKKRGGVAVQVGDSEVHVYWKGAAELILESCTSW  130

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D + +   +   +A  FKK IEDMA  +LRCVA AY   +M  +PK E++ + W LPE 
Sbjct  131  VDMDGSNHSMTPEKAAEFKKFIEDMAVANLRCVAFAYRPCEMSDVPK-EDQRADWVLPED  189

Query  535  DLILLAILGIKDPCRPGVR  591
            +LI+L I+GIKDPCRPGV+
Sbjct  190  NLIMLGIVGIKDPCRPGVQ  208



>gb|KJB70754.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
Length=902

 Score =   236 bits (602),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP + SQL   V+ LL EG+AQ+TTG+VFV  +G   E+SGSPTEKAIL 
Sbjct  506  EAFVGKKKINPPAESSQLHLSVVSLLSEGVAQSTTGNVFVSKDGDDVEISGSPTEKAILS  565

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + ++LG+ FDAIRSES+I+H FPFNSEKKRGGVA++  D+EVHIHWKGAAEIVL+ C+ Y
Sbjct  566  WAIELGMKFDAIRSESTILHVFPFNSEKKRGGVALRRSDAEVHIHWKGAAEIVLAACSGY  625

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  ++E++   F+ AI++MA   LRC+A+AY   + +K+P +EE    W LPE 
Sbjct  626  LDSNGCLQSMNEDKEF-FEAAIDEMAANCLRCIALAYRLCEQEKVPSNEESFDDWVLPED  684

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCR GV+
Sbjct  685  NLVLLAIVGIKDPCRQGVK  703



>ref|XP_010318441.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X3 [Solanum lycopersicum]
Length=975

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY+G K+++ P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL 
Sbjct  487  EAYVGKKKLDSPEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILS  546

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS--EVHIHWKGAAEIVLSCCTH  351
            +GVK+G+ FD +RS+S ++H  PFNS KKRGGV V+  S  +VH+HWKGAAEI+L+ CT 
Sbjct  547  WGVKIGMKFDVVRSQSIVLHVSPFNSTKKRGGVVVREQSGSQVHMHWKGAAEIILASCTG  606

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  +  + E E    K+AIEDMA +SLRCVA+AY + +++++P  EE+L++W LPE
Sbjct  607  YLDSNGCLQSI-EKEKDFLKEAIEDMAAKSLRCVAIAYQTCNVNEVPTDEEQLAQWILPE  665

Query  532  GDLILLAILGIKDPCRPGVR  591
             DLILLAILGIKDPCRPGV+
Sbjct  666  DDLILLAILGIKDPCRPGVK  685



>ref|NP_001053795.1| Os04g0605500 [Oryza sativa Japonica Group]
 emb|CAD41784.2| OSJNBa0035M09.2 [Oryza sativa Japonica Group]
 emb|CAE03884.2| OSJNBb0015N08.12 [Oryza sativa Japonica Group]
 dbj|BAF15709.1| Os04g0605500 [Oryza sativa Japonica Group]
 gb|EEC77944.1| hypothetical protein OsI_17291 [Oryza sativa Indica Group]
 gb|EEE61631.1| hypothetical protein OsJ_16068 [Oryza sativa Japonica Group]
Length=1088

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK+++PPD+   L   +  L++EGIAQNT+GS+F PE G  PEV+GSPTEKAIL 
Sbjct  500  EAYFGGKKMDPPDNVQVLSASISSLIVEGIAQNTSGSIFEPENGQDPEVTGSPTEKAILS  559

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL---DSEVHIHWKGAAEIVLSCCT  348
            +G+KLG+ F+  R++SSI+H FPFNSEKKRGGVAV L   +SEVHIHWKGAAEI+L  C 
Sbjct  560  WGLKLGMRFNDTRTKSSILHVFPFNSEKKRGGVAVHLGGSESEVHIHWKGAAEIILDSCK  619

Query  349  HYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELP  528
             ++ A+ +   +   +   FKK IEDMA  SLRCVA AY +Y+M  +P SE+  + W LP
Sbjct  620  SWLAADGSKHSMTPEKISEFKKFIEDMAASSLRCVAFAYRTYEMVDVP-SEDRRADWILP  678

Query  529  EGDLILLAILGIKDPCRPGVR  591
            E DLI+L I+GIKDPCRPGV+
Sbjct  679  EDDLIMLGIVGIKDPCRPGVK  699



>gb|AGW24530.1| type IIB Ca2+ATPase [Oryza sativa]
Length=1088

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 5/201 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK+++PPD+   L   +  L++EGIAQNT+GS+F PE G  PEV+GSPTEKAIL 
Sbjct  500  EAYFGGKKMDPPDNVQVLSASISSLIVEGIAQNTSGSIFEPENGQDPEVTGSPTEKAILS  559

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL---DSEVHIHWKGAAEIVLSCCT  348
            +G+KLG+ F+  R++SSI+H FPFNSEKKRGGVAV L   +SEVHIHWKGAAEI+L  C 
Sbjct  560  WGLKLGMRFNDTRTKSSILHVFPFNSEKKRGGVAVHLGGSESEVHIHWKGAAEIILDSCK  619

Query  349  HYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELP  528
             ++ A+ +   +   +   FKK IEDMA  SLRCVA AY +Y+M  +P SE+  + W LP
Sbjct  620  SWLAADGSKHSMTPEKISEFKKFIEDMAASSLRCVAFAYRTYEMVDVP-SEDRRADWILP  678

Query  529  EGDLILLAILGIKDPCRPGVR  591
            E DLI+L I+GIKDPCRPGV+
Sbjct  679  EDDLIMLGIVGIKDPCRPGVK  699



>ref|XP_010318439.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X2 [Solanum lycopersicum]
Length=1047

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY+G K+++ P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL 
Sbjct  487  EAYVGKKKLDSPEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILS  546

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS--EVHIHWKGAAEIVLSCCTH  351
            +GVK+G+ FD +RS+S ++H  PFNS KKRGGV V+  S  +VH+HWKGAAEI+L+ CT 
Sbjct  547  WGVKIGMKFDVVRSQSIVLHVSPFNSTKKRGGVVVREQSGSQVHMHWKGAAEIILASCTG  606

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  +  + E E    K+AIEDMA +SLRCVA+AY + +++++P  EE+L++W LPE
Sbjct  607  YLDSNGCLQSI-EKEKDFLKEAIEDMAAKSLRCVAIAYQTCNVNEVPTDEEQLAQWILPE  665

Query  532  GDLILLAILGIKDPCRPGVR  591
             DLILLAILGIKDPCRPGV+
Sbjct  666  DDLILLAILGIKDPCRPGVK  685



>gb|KJB70750.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
 gb|KJB70751.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
 gb|KJB70752.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
 gb|KJB70753.1| hypothetical protein B456_011G090300 [Gossypium raimondii]
Length=1084

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP + SQL   V+ LL EG+AQ+TTG+VFV  +G   E+SGSPTEKAIL 
Sbjct  506  EAFVGKKKINPPAESSQLHLSVVSLLSEGVAQSTTGNVFVSKDGDDVEISGSPTEKAILS  565

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            + ++LG+ FDAIRSES+I+H FPFNSEKKRGGVA++  D+EVHIHWKGAAEIVL+ C+ Y
Sbjct  566  WAIELGMKFDAIRSESTILHVFPFNSEKKRGGVALRRSDAEVHIHWKGAAEIVLAACSGY  625

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D+N  +  ++E++   F+ AI++MA   LRC+A+AY   + +K+P +EE    W LPE 
Sbjct  626  LDSNGCLQSMNEDKEF-FEAAIDEMAANCLRCIALAYRLCEQEKVPSNEESFDDWVLPED  684

Query  535  DLILLAILGIKDPCRPGVR  591
            +L+LLAI+GIKDPCR GV+
Sbjct  685  NLVLLAIVGIKDPCRQGVK  703



>ref|XP_004235507.1| PREDICTED: calcium-transporting ATPase 9, plasma membrane-type 
isoform X1 [Solanum lycopersicum]
Length=1061

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY+G K+++ P+D SQL   V  LL EGI QNT+GSVF  + G   EVSGSPTEKAIL 
Sbjct  487  EAYVGKKKLDSPEDGSQLHSAVSSLLDEGITQNTSGSVFTSKDGKGTEVSGSPTEKAILS  546

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDS--EVHIHWKGAAEIVLSCCTH  351
            +GVK+G+ FD +RS+S ++H  PFNS KKRGGV V+  S  +VH+HWKGAAEI+L+ CT 
Sbjct  547  WGVKIGMKFDVVRSQSIVLHVSPFNSTKKRGGVVVREQSGSQVHMHWKGAAEIILASCTG  606

Query  352  YIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPE  531
            Y+D+N  +  + E E    K+AIEDMA +SLRCVA+AY + +++++P  EE+L++W LPE
Sbjct  607  YLDSNGCLQSI-EKEKDFLKEAIEDMAAKSLRCVAIAYQTCNVNEVPTDEEQLAQWILPE  665

Query  532  GDLILLAILGIKDPCRPGVR  591
             DLILLAILGIKDPCRPGV+
Sbjct  666  DDLILLAILGIKDPCRPGVK  685



>ref|XP_006652779.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Oryza brachyantha]
Length=1084

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 151/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGGV-PEVSGSPTEKAILQ  177
            +AY GGK+++PPD+   L   V  L++EGIAQNT+GS+F P+ G  PEV+GSPTEKAIL 
Sbjct  498  EAYFGGKKMDPPDNVQVLSATVSSLIVEGIAQNTSGSIFEPDNGQDPEVTGSPTEKAILS  557

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL-DSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ F+  R++SSI+H FPFNSEKKRGGVAV L  SEVHIHWKGAAEI+L  C  +
Sbjct  558  WGLKLGMRFNDTRAKSSILHVFPFNSEKKRGGVAVHLGGSEVHIHWKGAAEIILDSCKSW  617

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            + A+ +   +   +   FKK IE+MAT SLRCVA AY +Y+M  +P +E++ S W LPE 
Sbjct  618  VAADGSKHSMTPEKTSEFKKFIEEMATLSLRCVAFAYRTYEMGDVP-NEDQRSDWILPED  676

Query  535  DLILLAILGIKDPCRPGVR  591
            DLI+L I+GIKDPCRPGV+
Sbjct  677  DLIMLGIVGIKDPCRPGVQ  695



>ref|XP_003580413.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type 
[Brachypodium distachyon]
Length=1082

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 150/199 (75%), Gaps = 3/199 (2%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPEGG-VPEVSGSPTEKAILQ  177
            +AY GGK++ P D+   L   ++ L++EGIAQNTTGS+F PEGG  PEV+GSPTEKAIL 
Sbjct  496  EAYFGGKKLAPADNTQMLSAAMLSLIIEGIAQNTTGSIFEPEGGQAPEVTGSPTEKAILS  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLD-SEVHIHWKGAAEIVLSCCTHY  354
            +G++LG+ F   RS+SS++  FPFNSEKKRGGVAV L  SEVH++WKGAAE++L  CT++
Sbjct  556  WGLQLGMKFSETRSKSSVLQVFPFNSEKKRGGVAVHLGGSEVHVYWKGAAELILESCTNW  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +DA+ +   +   +   FKK IEDMA  SLRCVA AY   DMD +P +E++ + W LPE 
Sbjct  616  LDADGSKNSMTPEKVGEFKKFIEDMAIASLRCVAFAYRPCDMDDVP-NEDQRADWVLPED  674

Query  535  DLILLAILGIKDPCRPGVR  591
            +LI+L I+GIKDPCRPGV+
Sbjct  675  NLIMLGIVGIKDPCRPGVQ  693



>ref|XP_009395465.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like 
[Musa acuminata subsp. malaccensis]
Length=1082

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 157/199 (79%), Gaps = 5/199 (3%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQ  177
            +AYIGG++IN  ++  +L      LL+EGIA NT+GSVF PE GGV EV+GSPTEKAIL 
Sbjct  497  EAYIGGRKINHLEN-VELSPITASLLIEGIAHNTSGSVFEPEDGGVIEVTGSPTEKAILL  555

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAV-KLDSEVHIHWKGAAEIVLSCCTHY  354
            +G+KLG+ FD+ RS++SI+H FPFNSEKKRGGVAV +  SEVH+HWKGAAEIVL+ CT +
Sbjct  556  WGLKLGMKFDSERSKTSILHVFPFNSEKKRGGVAVYQAGSEVHVHWKGAAEIVLASCTSW  615

Query  355  IDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEG  534
            +D + +  P+  +EA +FKK I++MA  SLRCVA AY S++++K+P  EE+   W LPE 
Sbjct  616  LDTDGSKKPM-TSEADTFKKYIDNMAEVSLRCVAFAYRSFELEKVP-DEEQRENWLLPED  673

Query  535  DLILLAILGIKDPCRPGVR  591
            DLIL+AI+GIKDPCRPGV+
Sbjct  674  DLILVAIVGIKDPCRPGVK  692



>gb|KHG22770.1| Calcium-transporting ATPase 9, plasma membrane-type [Gossypium 
arboreum]
Length=1109

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 156/218 (72%), Gaps = 22/218 (10%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQL   V+ LL EG+AQ+T G+VFV  +GG  E+SGSPTEKAIL 
Sbjct  512  EAFVGKKKINPPADSSQLHLSVVSLLSEGVAQSTMGNVFVSKDGGDVEISGSPTEKAILS  571

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL--------------------DSE  297
            + ++LG+ FDAIRSES+I+H FPFNSEKKRGGVA++                     D+E
Sbjct  572  WAIELGMKFDAIRSESTILHVFPFNSEKKRGGVALRRDRNKDMNGRNICCPGLVDRSDAE  631

Query  298  VHIHWKGAAEIVLSCCTHYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYD  477
            VHIHWKGAAEIVL+ C+ Y+D+N  +  ++E++   F+ AI++MA   LRC+A+AY   +
Sbjct  632  VHIHWKGAAEIVLAACSGYLDSNGCLQSMNEDKEF-FEAAIDEMAANCLRCIALAYRLCE  690

Query  478  MDKIPKSEEELSRWELPEGDLILLAILGIKDPCRPGVR  591
             +K+P +EE    W LPE +L+LLAI+GIKDPCRPGV+
Sbjct  691  QEKVPSNEESFDDWVLPEDNLVLLAIVGIKDPCRPGVK  728



>gb|KHG22771.1| Calcium-transporting ATPase 9, plasma membrane-type [Gossypium 
arboreum]
Length=1140

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 156/218 (72%), Gaps = 22/218 (10%)
 Frame = +1

Query  1    DAYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVP-EGGVPEVSGSPTEKAILQ  177
            +A++G K+INPP D SQL   V+ LL EG+AQ+T G+VFV  +GG  E+SGSPTEKAIL 
Sbjct  543  EAFVGKKKINPPADSSQLHLSVVSLLSEGVAQSTMGNVFVSKDGGDVEISGSPTEKAILS  602

Query  178  FGVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKL--------------------DSE  297
            + ++LG+ FDAIRSES+I+H FPFNSEKKRGGVA++                     D+E
Sbjct  603  WAIELGMKFDAIRSESTILHVFPFNSEKKRGGVALRRDRNKDMNGRNICCPGLVDRSDAE  662

Query  298  VHIHWKGAAEIVLSCCTHYIDANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYD  477
            VHIHWKGAAEIVL+ C+ Y+D+N  +  ++E++   F+ AI++MA   LRC+A+AY   +
Sbjct  663  VHIHWKGAAEIVLAACSGYLDSNGCLQSMNEDKEF-FEAAIDEMAANCLRCIALAYRLCE  721

Query  478  MDKIPKSEEELSRWELPEGDLILLAILGIKDPCRPGVR  591
             +K+P +EE    W LPE +L+LLAI+GIKDPCRPGV+
Sbjct  722  QEKVPSNEESFDDWVLPEDNLVLLAIVGIKDPCRPGVK  759



>gb|EEE68995.1| hypothetical protein OsJ_27935 [Oryza sativa Japonica Group]
Length=1080

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = +1

Query  4    AYIGGKRINPPDDKSQLPQKVIPLLLEGIAQNTTGSVFVPE-GGVPEVSGSPTEKAILQF  180
            AY GG  ++P DD   +      LL+EGIAQNTTG++FVPE GG  E+SGSPTEKAIL +
Sbjct  500  AYFGGTMLDPCDDIRAVSCGATELLIEGIAQNTTGTIFVPEDGGDAELSGSPTEKAILSW  559

Query  181  GVKLGLNFDAIRSESSIIHAFPFNSEKKRGGVAVKLDSEVHIHWKGAAEIVLSCCTHYID  360
            G+K+G++F+  RS+S I+H FPFNSEKKRGGVAV+ D+ VH+HWKGAAE+VLS C  ++ 
Sbjct  560  GLKIGMDFNDARSKSQILHVFPFNSEKKRGGVAVQSDAGVHVHWKGAAELVLSSCKSWLA  619

Query  361  ANDNVVPLDENEAISFKKAIEDMATESLRCVAVAYVSYDMDKIPKSEEELSRWELPEGDL  540
             + +V P+   +    KK+IEDMAT SLRCVA AY   ++++IPK  E+++ W+LPE DL
Sbjct  620  LDGSVQPMSAEKYNECKKSIEDMATSSLRCVAFAYCPCEIERIPK--EDIADWKLPEDDL  677

Query  541  ILLAILGIKDPCRPGVR  591
             LL I+GIKDPCRPGV+
Sbjct  678  TLLCIVGIKDPCRPGVK  694



Lambda      K        H        a         alpha
   0.316    0.137    0.402    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160