BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015F05 642 bp,

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004233382.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       221   1e-65   Solanum lycopersicum
ref|XP_006363427.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       220   2e-65   Solanum tuberosum [potatoes]
ref|XP_009587653.1|  PREDICTED: UDP-glycosyltransferase 83A1            219   7e-65   Nicotiana tomentosiformis
ref|XP_009796196.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       213   9e-63   Nicotiana sylvestris
emb|CDP02308.1|  unnamed protein product                                214   3e-62   Coffea canephora [robusta coffee]
ref|XP_002526116.1|  UDP-glucuronosyltransferase, putative              200   2e-57   
ref|XP_002306070.2|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    184   6e-52   Populus trichocarpa [western balsam poplar]
gb|KJB33429.1|  hypothetical protein B456_006G010800                    181   7e-51   Gossypium raimondii
ref|XP_009365867.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       181   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_011009404.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       181   1e-50   Populus euphratica
ref|XP_009365976.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       179   6e-50   Pyrus x bretschneideri [bai li]
ref|XP_008379414.1|  PREDICTED: UDP-glycosyltransferase 83A1            178   2e-49   Malus domestica [apple tree]
emb|CDY37551.1|  BnaA05g34160D                                          177   4e-49   Brassica napus [oilseed rape]
ref|XP_002276804.1|  PREDICTED: UDP-glycosyltransferase 83A1            176   8e-49   Vitis vinifera
ref|XP_002884302.1|  predicted protein                                  175   2e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_011085854.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       175   2e-48   Sesamum indicum [beniseed]
emb|CDY43260.1|  BnaC05g48530D                                          175   3e-48   Brassica napus [oilseed rape]
ref|XP_010442178.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       174   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009147384.1|  PREDICTED: UDP-glycosyltransferase 83A1            172   3e-47   Brassica rapa
ref|XP_002324098.1|  hypothetical protein POPTR_0017s12710g             171   5e-47   Populus trichocarpa [western balsam poplar]
ref|XP_008230872.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       171   7e-47   Prunus mume [ume]
ref|XP_010089623.1|  UDP-glycosyltransferase 83A1                       169   4e-46   Morus notabilis
ref|XP_007216885.1|  hypothetical protein PRUPE_ppa020867mg             168   6e-46   Prunus persica
ref|XP_006408448.1|  hypothetical protein EUTSA_v10020693mg             168   7e-46   Eutrema salsugineum
ref|NP_186859.1|  UDP-glycosyltransferase 83A1                          168   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485444.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       168   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002526107.1|  UDP-glucuronosyltransferase, putative              167   2e-45   Ricinus communis
emb|CDP20814.1|  unnamed protein product                                167   3e-45   Coffea canephora [robusta coffee]
ref|XP_002306038.2|  hypothetical protein POPTR_0004s12230g             166   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010550007.1|  PREDICTED: UDP-glycosyltransferase 83A1            166   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_008365421.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       166   5e-45   Malus domestica [apple tree]
ref|XP_006432638.1|  hypothetical protein CICLE_v10000944mg             166   8e-45   Citrus clementina
ref|XP_006471446.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    165   8e-45   Citrus sinensis [Valencia orange]
ref|XP_010463598.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       166   9e-45   Camelina sativa [gold-of-pleasure]
gb|KDO37511.1|  hypothetical protein CISIN_1g044384mg                   162   1e-44   Citrus sinensis [Valencia orange]
ref|XP_003554912.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       165   1e-44   Glycine max [soybeans]
ref|XP_008230871.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       165   1e-44   Prunus mume [ume]
ref|XP_007151308.1|  hypothetical protein PHAVU_004G035300g             165   1e-44   Phaseolus vulgaris [French bean]
ref|XP_008365515.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       157   1e-44   Malus domestica [apple tree]
gb|KDO58821.1|  hypothetical protein CISIN_1g009851mg                   164   2e-44   Citrus sinensis [Valencia orange]
ref|XP_006432636.1|  hypothetical protein CICLE_v10001071mg             164   3e-44   Citrus clementina
ref|XP_007216366.1|  hypothetical protein PRUPE_ppa019116mg             164   3e-44   Prunus persica
ref|XP_006432642.1|  hypothetical protein CICLE_v10000928mg             164   4e-44   Citrus clementina
ref|XP_006432640.1|  hypothetical protein CICLE_v10000928mg             163   5e-44   Citrus clementina
ref|XP_009365945.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       163   8e-44   Pyrus x bretschneideri [bai li]
ref|XP_006297658.1|  hypothetical protein CARUB_v10013680mg             162   9e-44   Capsella rubella
ref|XP_009365863.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       162   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_009365862.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       162   2e-43   Pyrus x bretschneideri [bai li]
gb|EYU44186.1|  hypothetical protein MIMGU_mgv1a024777mg                162   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_002276825.1|  PREDICTED: UDP-glycosyltransferase 83A1            161   3e-43   Vitis vinifera
ref|XP_006432643.1|  hypothetical protein CICLE_v10001095mg             161   3e-43   Citrus clementina
ref|XP_004306079.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       159   1e-42   Fragaria vesca subsp. vesca
ref|XP_007032721.1|  UDP-Glycosyltransferase superfamily protein,...    159   1e-42   Theobroma cacao [chocolate]
ref|XP_008365422.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       159   3e-42   Malus domestica [apple tree]
ref|XP_009360530.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       158   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_009365943.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       157   7e-42   Pyrus x bretschneideri [bai li]
ref|XP_009365864.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       157   8e-42   Pyrus x bretschneideri [bai li]
ref|XP_009365944.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       157   9e-42   Pyrus x bretschneideri [bai li]
gb|KDP27230.1|  hypothetical protein JCGZ_19929                         157   1e-41   Jatropha curcas
ref|XP_008230870.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       156   2e-41   Prunus mume [ume]
ref|XP_002279299.1|  PREDICTED: UDP-glycosyltransferase 83A1            156   3e-41   Vitis vinifera
gb|KHN48818.1|  UDP-glycosyltransferase 83A1                            155   3e-41   Glycine soja [wild soybean]
gb|AFO67245.1|  putative UDP-glucosyltransferase 83A                    148   3e-41   Aralia elata
dbj|BAD18098.1|  putative UDP-glucosyl transferase                      148   4e-41   Ipomoea batatas [batate]
ref|XP_004306080.2|  PREDICTED: UDP-glycosyltransferase 83A1-like       155   6e-41   Fragaria vesca subsp. vesca
ref|XP_007216285.1|  hypothetical protein PRUPE_ppa020470mg             155   6e-41   Prunus persica
ref|XP_006422469.1|  hypothetical protein CICLE_v100283952mg            154   1e-40   Citrus clementina
ref|XP_006431284.1|  hypothetical protein CICLE_v10012795mg             148   2e-40   Citrus clementina
ref|XP_009360531.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       154   2e-40   Pyrus x bretschneideri [bai li]
emb|CDP08528.1|  unnamed protein product                                153   3e-40   Coffea canephora [robusta coffee]
gb|KDO68269.1|  hypothetical protein CISIN_1g012652mg                   153   4e-40   Citrus sinensis [Valencia orange]
ref|XP_006478223.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       152   5e-40   Citrus sinensis [Valencia orange]
emb|CDP05459.1|  unnamed protein product                                152   5e-40   Coffea canephora [robusta coffee]
ref|XP_010923651.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       145   7e-40   Elaeis guineensis
ref|XP_010923595.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       151   1e-39   Elaeis guineensis
ref|XP_008341646.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       151   1e-39   Malus domestica [apple tree]
gb|KDO35902.1|  hypothetical protein CISIN_1g040291mg                   144   2e-39   Citrus sinensis [Valencia orange]
ref|XP_004981711.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    151   2e-39   
gb|KDO72750.1|  hypothetical protein CISIN_1g044266mg                   150   2e-39   Citrus sinensis [Valencia orange]
ref|XP_004981712.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    150   3e-39   
emb|CDP08526.1|  unnamed protein product                                150   3e-39   Coffea canephora [robusta coffee]
ref|XP_006431283.1|  hypothetical protein CICLE_v10013686mg             150   3e-39   Citrus clementina
ref|XP_006482788.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       150   4e-39   Citrus sinensis [Valencia orange]
ref|XP_006432637.1|  hypothetical protein CICLE_v10000944mg             150   4e-39   Citrus clementina
ref|XP_008348089.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       150   5e-39   Malus domestica [apple tree]
tpg|DAA51462.1|  TPA: hypothetical protein ZEAMMB73_540156              150   6e-39   Zea mays [maize]
ref|XP_007032718.1|  UDP-Glycosyltransferase superfamily protein,...    149   9e-39   Theobroma cacao [chocolate]
ref|NP_001169791.1|  uncharacterized protein LOC100383681               149   1e-38   Zea mays [maize]
gb|KDO58819.1|  hypothetical protein CISIN_1g009851mg                   148   3e-38   Citrus sinensis [Valencia orange]
gb|AIS39477.1|  flavonoid UDP-glucosyltransferase 11                    147   4e-38   Citrus x paradisi [grapefruit]
gb|KDO58820.1|  hypothetical protein CISIN_1g009851mg                   148   4e-38   Citrus sinensis [Valencia orange]
gb|AAM47590.1|  putative glucosyl transferase                           147   6e-38   Sorghum bicolor [broomcorn]
ref|XP_010923596.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       147   6e-38   Elaeis guineensis
ref|XP_006482740.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       146   9e-38   Citrus sinensis [Valencia orange]
gb|KDO72751.1|  hypothetical protein CISIN_1g012744mg                   146   1e-37   Citrus sinensis [Valencia orange]
ref|XP_008379418.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       139   1e-37   Malus domestica [apple tree]
ref|XP_006432641.1|  hypothetical protein CICLE_v10000928mg             146   1e-37   Citrus clementina
ref|XP_004306078.1|  PREDICTED: UDP-glycosyltransferase 83A1            146   1e-37   Fragaria vesca subsp. vesca
gb|EYU44188.1|  hypothetical protein MIMGU_mgv1a026943mg                139   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_006338769.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       145   2e-37   Solanum tuberosum [potatoes]
ref|XP_004233666.1|  PREDICTED: UDP-glycosyltransferase 83A1            145   2e-37   Solanum lycopersicum
emb|CAN82798.1|  hypothetical protein VITISV_007532                     143   3e-37   Vitis vinifera
emb|CAN79737.1|  hypothetical protein VITISV_003350                     144   6e-37   Vitis vinifera
ref|XP_004168844.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    140   6e-37   
ref|XP_010089622.1|  UDP-glycosyltransferase 83A1                       144   7e-37   Morus notabilis
ref|XP_010923603.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       143   1e-36   Elaeis guineensis
ref|XP_008365423.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    143   1e-36   Malus domestica [apple tree]
emb|CBI33785.3|  unnamed protein product                                142   3e-36   Vitis vinifera
gb|KJB40914.1|  hypothetical protein B456_007G082200                    142   4e-36   Gossypium raimondii
ref|XP_008792721.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       142   4e-36   Phoenix dactylifera
ref|XP_002272457.1|  PREDICTED: UDP-glycosyltransferase 83A1            142   4e-36   Vitis vinifera
ref|XP_009365961.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       141   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_009794377.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       141   9e-36   Nicotiana sylvestris
ref|XP_008779307.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       139   1e-35   
ref|XP_004141583.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       140   1e-35   
ref|XP_007151310.1|  hypothetical protein PHAVU_004G035500g             140   1e-35   Phaseolus vulgaris [French bean]
ref|XP_004141584.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       140   2e-35   
gb|AGZ84548.1|  glycosyltransferase KGT22                               139   2e-35   Pueraria montana var. lobata [kudzu]
ref|XP_002466427.1|  hypothetical protein SORBIDRAFT_01g007620          140   3e-35   Sorghum bicolor [broomcorn]
ref|XP_011098740.1|  PREDICTED: UDP-glycosyltransferase 83A1            139   3e-35   Sesamum indicum [beniseed]
ref|XP_007032716.1|  UDP-Glycosyltransferase superfamily protein,...    139   4e-35   Theobroma cacao [chocolate]
gb|KGN52509.1|  hypothetical protein Csa_5G638465                       139   5e-35   Cucumis sativus [cucumbers]
ref|XP_008778171.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       138   6e-35   
ref|XP_003552563.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       138   6e-35   Glycine max [soybeans]
ref|XP_010923602.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       139   6e-35   Elaeis guineensis
ref|XP_006603906.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       138   6e-35   Glycine max [soybeans]
gb|KHG18069.1|  hypothetical protein F383_21636                         138   7e-35   Gossypium arboreum [tree cotton]
ref|XP_004981716.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       138   7e-35   Setaria italica
gb|KHN13563.1|  UDP-glycosyltransferase 83A1                            138   1e-34   Glycine soja [wild soybean]
ref|XP_010923598.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       138   1e-34   Elaeis guineensis
ref|XP_008459382.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       137   2e-34   Cucumis melo [Oriental melon]
gb|KGN52506.1|  hypothetical protein Csa_5G638455                       137   3e-34   Cucumis sativus [cucumbers]
gb|KJB75628.1|  hypothetical protein B456_012G048900                    136   3e-34   Gossypium raimondii
ref|XP_007217239.1|  hypothetical protein PRUPE_ppa006338mg             136   4e-34   Prunus persica
ref|XP_002514679.1|  UDP-glucuronosyltransferase, putative              135   6e-34   Ricinus communis
ref|XP_002466428.1|  hypothetical protein SORBIDRAFT_01g007630          136   7e-34   Sorghum bicolor [broomcorn]
gb|KDP31327.1|  hypothetical protein JCGZ_11703                         135   7e-34   Jatropha curcas
ref|XP_004981717.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       135   7e-34   Setaria italica
emb|CBI15140.3|  unnamed protein product                                137   8e-34   Vitis vinifera
ref|XP_002281128.1|  PREDICTED: UDP-glycosyltransferase 83A1            135   9e-34   Vitis vinifera
ref|XP_006650614.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       135   9e-34   
gb|EYU44185.1|  hypothetical protein MIMGU_mgv1a020666mg                135   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_009599633.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       134   2e-33   Nicotiana tomentosiformis
ref|XP_009790320.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       134   3e-33   Nicotiana sylvestris
emb|CDP20467.1|  unnamed protein product                                134   3e-33   Coffea canephora [robusta coffee]
ref|XP_002526117.1|  UDP-glucuronosyltransferase, putative              134   3e-33   Ricinus communis
emb|CBI21226.3|  unnamed protein product                                134   3e-33   Vitis vinifera
ref|XP_002279246.1|  PREDICTED: UDP-glycosyltransferase 83A1            134   3e-33   Vitis vinifera
dbj|BAJ90186.1|  predicted protein                                      134   3e-33   Hordeum vulgare subsp. vulgare [barley]
gb|KDO42893.1|  hypothetical protein CISIN_1g043556mg                   127   4e-33   Citrus sinensis [Valencia orange]
ref|XP_002526109.1|  UDP-glucuronosyltransferase, putative              133   5e-33   
emb|CAN60198.1|  hypothetical protein VITISV_004920                     134   5e-33   Vitis vinifera
gb|KDO58817.1|  hypothetical protein CISIN_1g040997mg                   126   6e-33   Citrus sinensis [Valencia orange]
ref|XP_003531850.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       133   7e-33   Glycine max [soybeans]
emb|CDM81053.1|  unnamed protein product                                132   1e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010936390.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       132   1e-32   Elaeis guineensis
ref|XP_004981710.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       132   2e-32   
ref|XP_008379417.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       131   2e-32   Malus domestica [apple tree]
ref|XP_004981715.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    131   2e-32   
gb|KJB51019.1|  hypothetical protein B456_008G197800                    131   3e-32   Gossypium raimondii
ref|XP_003621425.1|  UDP-glucosyltransferase HRA25                      131   3e-32   Medicago truncatula
gb|AFK45986.1|  unknown                                                 130   4e-32   Medicago truncatula
gb|KCW83702.1|  hypothetical protein EUGRSUZ_B00577                     130   4e-32   Eucalyptus grandis [rose gum]
ref|XP_010030531.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       130   4e-32   Eucalyptus grandis [rose gum]
ref|XP_010026704.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       127   5e-32   Eucalyptus grandis [rose gum]
ref|XP_004981713.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       130   7e-32   
ref|XP_004489460.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       130   7e-32   Cicer arietinum [garbanzo]
gb|EAZ28639.1|  hypothetical protein OsJ_12648                          130   8e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051321.2|  Os03g0757100                                       130   8e-32   
ref|XP_010039073.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       129   1e-31   Eucalyptus grandis [rose gum]
gb|EMT00593.1|  Putative UDP-glucosyltransferase                        128   1e-31   Aegilops tauschii
gb|AFK49004.1|  unknown                                                 129   1e-31   Lotus japonicus
gb|EMT00420.1|  Putative UDP-glucosyltransferase                        129   1e-31   Aegilops tauschii
gb|EAZ28640.1|  hypothetical protein OsJ_12649                          129   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006837097.1|  hypothetical protein AMTR_s00110p00115790          129   2e-31   Amborella trichopoda
gb|EAY91915.1|  hypothetical protein OsI_13600                          129   2e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001051322.1|  Os03g0757200                                       129   2e-31   
ref|XP_006602936.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       128   2e-31   
emb|CDY37552.1|  BnaA05g34170D                                          123   3e-31   Brassica napus [oilseed rape]
ref|XP_009388394.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       128   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003621428.1|  UDP-glucosyltransferase HRA25                      128   4e-31   
gb|AES77646.2|  UDP-glucosyltransferase family protein                  128   4e-31   Medicago truncatula
gb|KCW59976.1|  hypothetical protein EUGRSUZ_H02704                     127   5e-31   Eucalyptus grandis [rose gum]
ref|NP_001168592.1|  hypothetical protein                               127   5e-31   Zea mays [maize]
gb|EMT15057.1|  Putative UDP-glucosyltransferase                        127   5e-31   Aegilops tauschii
gb|KCW59981.1|  hypothetical protein EUGRSUZ_H02712                     127   6e-31   Eucalyptus grandis [rose gum]
ref|XP_010026710.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       127   6e-31   Eucalyptus grandis [rose gum]
ref|XP_008348241.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       127   8e-31   Malus domestica [apple tree]
gb|KHN13560.1|  UDP-glycosyltransferase 83A1                            128   8e-31   Glycine soja [wild soybean]
ref|XP_010026718.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       127   1e-30   Eucalyptus grandis [rose gum]
ref|XP_003621430.1|  UDP-glucosyltransferase HRA25                      126   1e-30   Medicago truncatula
ref|XP_007139509.1|  hypothetical protein PHAVU_008G035800g             125   2e-30   Phaseolus vulgaris [French bean]
ref|XP_004981714.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    125   2e-30   
ref|XP_010039072.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       125   3e-30   Eucalyptus grandis [rose gum]
ref|XP_003621427.1|  UDP-glucosyltransferase HRA25                      125   4e-30   Medicago truncatula
ref|XP_007139491.1|  hypothetical protein PHAVU_008G034000g             125   4e-30   Phaseolus vulgaris [French bean]
ref|XP_010026719.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       125   4e-30   Eucalyptus grandis [rose gum]
gb|KDP27232.1|  hypothetical protein JCGZ_19931                         124   5e-30   Jatropha curcas
emb|CDP11402.1|  unnamed protein product                                125   5e-30   Coffea canephora [robusta coffee]
ref|XP_003530432.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       124   5e-30   Glycine max [soybeans]
ref|XP_003559289.2|  PREDICTED: uncharacterized protein LOC100829644    127   9e-30   
ref|XP_009396737.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       124   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007139492.1|  hypothetical protein PHAVU_008G034100g             123   1e-29   Phaseolus vulgaris [French bean]
gb|KCW59998.1|  hypothetical protein EUGRSUZ_H02732                     125   2e-29   Eucalyptus grandis [rose gum]
dbj|BAJ86871.1|  predicted protein                                      123   2e-29   Hordeum vulgare subsp. vulgare [barley]
emb|CAN66174.1|  hypothetical protein VITISV_022262                     123   3e-29   Vitis vinifera
ref|XP_010037222.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       122   3e-29   Eucalyptus grandis [rose gum]
ref|XP_010039070.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       122   4e-29   Eucalyptus grandis [rose gum]
ref|XP_002281262.1|  PREDICTED: UDP-glycosyltransferase 83A1            122   4e-29   Vitis vinifera
gb|KCW48891.1|  hypothetical protein EUGRSUZ_K02513                     122   4e-29   Eucalyptus grandis [rose gum]
ref|XP_007037524.1|  UDP-Glycosyltransferase superfamily protein ...    122   5e-29   Theobroma cacao [chocolate]
ref|XP_006440717.1|  hypothetical protein CICLE_v10024412mg             122   7e-29   Citrus clementina
ref|XP_002466429.1|  hypothetical protein SORBIDRAFT_01g007640          120   1e-28   Sorghum bicolor [broomcorn]
ref|XP_011465691.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       119   1e-28   Fragaria vesca subsp. vesca
gb|AFK36901.1|  unknown                                                 120   1e-28   Medicago truncatula
gb|KDP27235.1|  hypothetical protein JCGZ_19934                         120   1e-28   Jatropha curcas
ref|XP_009397258.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       120   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM47589.1|  putative glucosyl transferase                           120   2e-28   Sorghum bicolor [broomcorn]
ref|XP_010273391.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    120   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009147383.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       114   3e-28   Brassica rapa
ref|XP_010273390.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    120   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008786148.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       114   3e-28   
ref|XP_007037532.1|  UDP-Glycosyltransferase superfamily protein        119   4e-28   Theobroma cacao [chocolate]
gb|KCW48890.1|  hypothetical protein EUGRSUZ_K02512                     119   5e-28   Eucalyptus grandis [rose gum]
ref|XP_003531851.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       119   5e-28   Glycine max [soybeans]
ref|XP_006477727.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       119   5e-28   Citrus sinensis [Valencia orange]
ref|XP_010273509.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       119   6e-28   Nelumbo nucifera [Indian lotus]
ref|XP_004489530.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       118   6e-28   Cicer arietinum [garbanzo]
ref|XP_006837103.1|  hypothetical protein AMTR_s00110p00117920          114   1e-27   
ref|XP_010663276.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    118   1e-27   Vitis vinifera
gb|KHN13562.1|  UDP-glycosyltransferase 83A1                            118   1e-27   Glycine soja [wild soybean]
ref|XP_003551756.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       118   1e-27   Glycine max [soybeans]
ref|XP_002284355.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    118   1e-27   Vitis vinifera
ref|XP_010663277.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    118   1e-27   Vitis vinifera
gb|KHN19240.1|  UDP-glycosyltransferase 83A1                            118   1e-27   Glycine soja [wild soybean]
gb|AAK16181.1|AC079887_13  putative glucosyltransferase                 118   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008786154.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       113   2e-27   Phoenix dactylifera
ref|XP_007032717.1|  UDP-Glycosyltransferase superfamily protein,...    116   2e-27   Theobroma cacao [chocolate]
ref|XP_002281210.2|  PREDICTED: UDP-glycosyltransferase 83A1-like       117   3e-27   Vitis vinifera
ref|XP_009392508.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       112   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004489506.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       116   5e-27   Cicer arietinum [garbanzo]
ref|XP_003530433.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       115   8e-27   Glycine max [soybeans]
ref|XP_007037530.1|  UDP-Glycosyltransferase superfamily protein,...    115   1e-26   Theobroma cacao [chocolate]
emb|CBI15141.3|  unnamed protein product                                115   1e-26   Vitis vinifera
gb|ACU24307.1|  unknown                                                 115   1e-26   Glycine max [soybeans]
ref|XP_003559280.2|  PREDICTED: UDP-glycosyltransferase 83A1-like       117   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_002281187.1|  PREDICTED: UDP-glycosyltransferase 83A1            115   1e-26   Vitis vinifera
ref|XP_003516842.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       115   1e-26   Glycine max [soybeans]
ref|XP_002281171.2|  PREDICTED: UDP-glycosyltransferase 83A1-like       115   1e-26   Vitis vinifera
gb|KJB40917.1|  hypothetical protein B456_007G082400                    110   2e-26   Gossypium raimondii
ref|XP_002284350.1|  PREDICTED: UDP-glycosyltransferase 83A1            114   2e-26   Vitis vinifera
emb|CBI15142.3|  unnamed protein product                                116   2e-26   Vitis vinifera
ref|XP_003543870.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       114   4e-26   Glycine max [soybeans]
gb|KJB51016.1|  hypothetical protein B456_008G197600                    114   4e-26   Gossypium raimondii
gb|EMT19414.1|  Cytokinin-O-glucosyltransferase 2                       114   5e-26   Aegilops tauschii
ref|XP_002284331.1|  PREDICTED: UDP-glycosyltransferase 83A1            113   5e-26   Vitis vinifera
ref|XP_008678426.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       114   5e-26   Zea mays [maize]
ref|XP_003543952.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       113   5e-26   Glycine max [soybeans]
ref|XP_002466424.1|  hypothetical protein SORBIDRAFT_01g007590          109   6e-26   Sorghum bicolor [broomcorn]
ref|XP_010273514.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       113   6e-26   Nelumbo nucifera [Indian lotus]
ref|XP_011073048.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       113   6e-26   Sesamum indicum [beniseed]
ref|XP_011081135.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       113   8e-26   Sesamum indicum [beniseed]
emb|CAN75031.1|  hypothetical protein VITISV_004853                     113   8e-26   Vitis vinifera
gb|KHN07137.1|  UDP-glycosyltransferase 83A1                            108   9e-26   Glycine soja [wild soybean]
ref|XP_006837107.1|  hypothetical protein AMTR_s00110p00118610          108   9e-26   
gb|KJB51017.1|  hypothetical protein B456_008G197600                    112   2e-25   Gossypium raimondii
gb|KHN19238.1|  UDP-glycosyltransferase 83A1                            108   2e-25   Glycine soja [wild soybean]
ref|XP_006440714.1|  hypothetical protein CICLE_v10020076mg             112   2e-25   Citrus clementina
gb|EYU23403.1|  hypothetical protein MIMGU_mgv1a005998mg                111   2e-25   Erythranthe guttata [common monkey flower]
gb|KDO54612.1|  hypothetical protein CISIN_1g012594mg                   111   2e-25   Citrus sinensis [Valencia orange]
emb|CDP05471.1|  unnamed protein product                                110   4e-25   Coffea canephora [robusta coffee]
ref|XP_009365942.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       110   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_003571510.2|  PREDICTED: UDP-glycosyltransferase 83A1            110   8e-25   Brachypodium distachyon [annual false brome]
ref|NP_001051326.1|  Os03g0757600                                       110   9e-25   
gb|KHN48820.1|  UDP-glycosyltransferase 83A1                            109   1e-24   Glycine soja [wild soybean]
ref|XP_009396429.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       109   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT00595.1|  Cytokinin-O-glucosyltransferase 2                       109   1e-24   Aegilops tauschii
ref|XP_003552562.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       109   2e-24   Glycine max [soybeans]
ref|XP_007139493.1|  hypothetical protein PHAVU_008G034200g             108   2e-24   Phaseolus vulgaris [French bean]
gb|KHN13564.1|  UDP-glycosyltransferase 83A1                            109   2e-24   
gb|EMT03600.1|  Cytokinin-O-glucosyltransferase 2                       108   2e-24   
ref|XP_010923650.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       105   3e-24   
ref|XP_004981709.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       108   4e-24   
ref|XP_008240037.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       108   5e-24   
ref|XP_006650615.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       107   5e-24   
ref|XP_003554914.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...    107   6e-24   
ref|XP_007151329.1|  hypothetical protein PHAVU_004G037100g             107   6e-24   
gb|ACZ74667.1|  UDP-glucosyl transferase                                107   7e-24   
ref|XP_006573253.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       107   7e-24   
ref|XP_002514682.1|  UDP-glucuronosyltransferase, putative              107   7e-24   
gb|AAM47594.1|  putative glucosyl transferase                           107   7e-24   
gb|AAM47588.1|  putative glucosyl transferase                           102   1e-23   
ref|XP_006661698.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       107   1e-23   
ref|NP_001151223.1|  cytokinin-O-glucosyltransferase 2                  107   1e-23   
ref|XP_006431282.1|  hypothetical protein CICLE_v10012136mg             105   2e-23   
ref|XP_004986744.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       106   2e-23   
ref|NP_001131902.2|  uncharacterized protein LOC100193288               107   2e-23   
gb|AFJ52987.1|  UDP-glycosyltransferase 1                               106   2e-23   
gb|EMS60087.1|  UDP-glycosyltransferase 83A1                            108   2e-23   
ref|XP_010026715.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       102   2e-23   
ref|XP_002443889.1|  hypothetical protein SORBIDRAFT_07g003850          106   3e-23   
ref|NP_001051324.1|  Os03g0757500                                       105   3e-23   
ref|XP_004489505.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       105   3e-23   
gb|KDP31325.1|  hypothetical protein JCGZ_11701                         105   3e-23   
dbj|BAJ96152.1|  predicted protein                                      105   4e-23   
ref|XP_002514680.1|  UDP-glucuronosyltransferase, putative              105   4e-23   
ref|XP_002281326.3|  PREDICTED: UDP-glycosyltransferase 83A1-like       105   4e-23   
ref|XP_007209049.1|  hypothetical protein PRUPE_ppa022508mg             105   5e-23   
tpg|DAA52097.1|  TPA: cytokinin-O-glucosyltransferase 2                 105   5e-23   
gb|ACZ74668.1|  UDP-glucosyl transferase                                105   5e-23   
ref|XP_006477639.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       105   5e-23   
ref|XP_007151314.1|  hypothetical protein PHAVU_004G035900g             105   6e-23   
ref|XP_007151315.1|  hypothetical protein PHAVU_004G036000g             105   7e-23   
gb|EYU23397.1|  hypothetical protein MIMGU_mgv1a024506mg                104   8e-23   
gb|EMT03601.1|  Putative UDP-glucosyltransferase                        104   8e-23   
tpg|DAA52098.1|  TPA: cytokinin-O-glucosyltransferase 2                 105   1e-22   
gb|EAY78064.1|  hypothetical protein OsI_33108                          104   1e-22   
gb|KCW59996.1|  hypothetical protein EUGRSUZ_H02730                     103   2e-22   
tpg|DAA52099.1|  TPA: cytokinin-O-glucosyltransferase 2                 105   2e-22   
ref|XP_008778169.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       103   2e-22   
gb|EMT00419.1|  Putative UDP-glucosyltransferase                        102   2e-22   
ref|NP_001176085.1|  Os10g0331700                                       103   2e-22   
ref|XP_006375759.1|  hypothetical protein POPTR_0013s02370g             103   2e-22   
ref|XP_003516841.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       103   2e-22   
ref|XP_008374607.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       103   3e-22   
gb|AGU14129.1|  UDP-glycosyltransferase                                 104   3e-22   
ref|XP_011023605.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       103   3e-22   
gb|KDO54613.1|  hypothetical protein CISIN_1g012212mg                   103   3e-22   
ref|XP_006440715.1|  hypothetical protein CICLE_v10019991mg             103   3e-22   
emb|CDP16521.1|  unnamed protein product                                102   4e-22   
gb|KHN41572.1|  UDP-glycosyltransferase 83A1                            102   4e-22   
ref|XP_002449160.1|  hypothetical protein SORBIDRAFT_05g005890          102   4e-22   
gb|KHN09782.1|  UDP-glycosyltransferase 83A1                          98.6    8e-22   
ref|XP_002466426.1|  hypothetical protein SORBIDRAFT_01g007610          101   9e-22   
gb|AAM47592.1|  putative glucosyl transferase                           101   9e-22   
dbj|BAK00429.1|  predicted protein                                      101   1e-21   
ref|XP_008646498.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       102   1e-21   
ref|XP_006650616.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       101   1e-21   
ref|XP_003559257.2|  PREDICTED: UDP-glycosyltransferase 83A1-like       103   1e-21   
tpg|DAA51474.1|  TPA: hypothetical protein ZEAMMB73_769140              101   1e-21   
gb|ABF98967.1|  Glucosyl transferase, putative, expressed               100   2e-21   
gb|ACN28695.1|  unknown                                                 100   2e-21   
ref|XP_006477641.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       100   3e-21   
ref|XP_002466425.1|  hypothetical protein SORBIDRAFT_01g007600          100   3e-21   
ref|XP_009800061.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       100   3e-21   
ref|XP_008680797.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       100   3e-21   
gb|ACZ74670.1|  UDP-glucosyl transferase                                100   4e-21   
gb|KHN13565.1|  UDP-glycosyltransferase 83A1                          99.8    4e-21   
ref|XP_003551755.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     99.8    5e-21   
ref|XP_007151328.1|  hypothetical protein PHAVU_004G037000g           99.8    6e-21   
ref|XP_004981708.1|  PREDICTED: UDP-glycosyltransferase 83A1-like       100   6e-21   
ref|XP_003621424.1|  UDP-glucosyltransferase HRA25                    99.0    8e-21   
ref|XP_007151313.1|  hypothetical protein PHAVU_004G035800g           98.6    1e-20   
ref|XP_004981707.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     98.2    2e-20   
ref|XP_006440713.1|  hypothetical protein CICLE_v10020077mg           98.6    2e-20   
ref|XP_004952942.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     98.2    2e-20   
ref|XP_007139494.1|  hypothetical protein PHAVU_008G034300g           97.8    2e-20   
gb|AFJ52988.1|  UDP-glycosyltransferase 1                             98.2    3e-20   
gb|AFW67573.1|  hypothetical protein ZEAMMB73_646912                  97.8    4e-20   
tpg|DAA52096.1|  TPA: hypothetical protein ZEAMMB73_927961            93.2    6e-20   
ref|XP_004489504.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     96.3    7e-20   
ref|XP_009600802.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     96.7    7e-20   
ref|XP_007151312.1|  hypothetical protein PHAVU_004G035700g           96.7    7e-20   
ref|XP_002514676.1|  glucosyl/glucuronosyl transferases, putative     96.3    9e-20   
ref|XP_002463679.1|  hypothetical protein SORBIDRAFT_01g004090        96.3    9e-20   
ref|XP_007151316.1|  hypothetical protein PHAVU_004G036100g           96.3    9e-20   
ref|XP_007214872.1|  hypothetical protein PRUPE_ppa024744mg           94.0    1e-19   
gb|EMT23024.1|  Cytokinin-O-glucosyltransferase 2                     95.9    1e-19   
ref|XP_006477640.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     95.1    2e-19   
dbj|BAK02647.1|  predicted protein                                    95.5    2e-19   
ref|NP_001176084.1|  Os10g0333400                                     91.3    3e-19   
ref|XP_002450476.1|  hypothetical protein SORBIDRAFT_05g005880        93.2    1e-18   
ref|XP_011030664.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     93.2    1e-18   
ref|XP_002314683.2|  hypothetical protein POPTR_0010s09500g           92.4    2e-18   
gb|EMT23576.1|  Cytokinin-O-glucosyltransferase 2                     90.5    2e-18   
ref|XP_002266304.1|  PREDICTED: UDP-glycosyltransferase 82A1          92.0    2e-18   
gb|KHN07138.1|  UDP-glycosyltransferase 83A1                          92.0    3e-18   
gb|EMT23577.1|  Cytokinin-O-glucosyltransferase 2                     89.4    3e-18   
gb|KJB51018.1|  hypothetical protein B456_008G197700                  90.9    4e-18   
emb|CBI27396.3|  unnamed protein product                              92.0    4e-18   
ref|XP_006837101.1|  hypothetical protein AMTR_s00110p00117120        86.7    5e-18   
gb|KHN24664.1|  UDP-glycosyltransferase 83A1                          90.9    6e-18   
emb|CDP16523.1|  unnamed protein product                              90.9    9e-18   
emb|CBI21225.3|  unnamed protein product                              88.6    1e-17   
gb|EMS52500.1|  UDP-glycosyltransferase 85A3                          90.5    2e-17   
ref|XP_006440684.1|  hypothetical protein CICLE_v10023293mg           89.0    2e-17   
gb|AFJ52982.1|  UDP-glycosyltransferase 1                             89.7    2e-17   
gb|KDO54569.1|  hypothetical protein CISIN_1g042709mg                 89.0    2e-17   
ref|XP_010905170.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     84.7    3e-17   
gb|KFK37670.1|  hypothetical protein AALP_AA3G013400                  83.6    5e-17   
gb|KHN41573.1|  UDP-glycosyltransferase 83A1                          87.8    6e-17   
ref|NP_001064343.1|  Os10g0322200                                     88.6    6e-17   
ref|XP_003577436.1|  PREDICTED: UDP-glycosyltransferase 83A1-like     88.2    7e-17   
gb|AFK42095.1|  unknown                                               84.3    1e-16   
gb|AFJ52986.1|  UDP-glycosyltransferase 1                             87.4    1e-16   
ref|XP_004958356.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     87.4    2e-16   
emb|CBI15143.3|  unnamed protein product                              85.9    3e-16   
gb|AFJ52985.1|  UDP-glycosyltransferase 1                             86.7    3e-16   
gb|KCW59975.1|  hypothetical protein EUGRSUZ_H02703                   85.9    3e-16   
ref|XP_006837109.1|  hypothetical protein AMTR_s00110p00119150        81.6    7e-16   
gb|AFJ52984.1|  UDP-glycosyltransferase 1                             85.1    8e-16   
gb|EEE50761.1|  hypothetical protein OsJ_31111                        82.4    8e-16   
ref|XP_002981094.1|  hypothetical protein SELMODRAFT_22903            84.7    1e-15   
ref|XP_002281117.2|  PREDICTED: UDP-glycosyltransferase 83A1 isof...  84.3    1e-15   
gb|EMT24598.1|  Cytokinin-O-glucosyltransferase 2                     84.3    2e-15   
gb|AAM01109.1|AC098682_13  Putative glucosyltransferase               80.5    3e-15   
ref|XP_009598263.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  80.1    3e-15   
gb|AEB61488.1|  UDP-glucosyltransferase                               83.2    4e-15   
ref|NP_001168449.1|  hypothetical protein                             83.2    4e-15   
gb|KDP31328.1|  hypothetical protein JCGZ_11704                       82.4    6e-15   
ref|XP_007037529.1|  UDP-Glycosyltransferase superfamily protein      82.0    8e-15   
ref|XP_006837100.1|  hypothetical protein AMTR_s00110p00117030        78.2    9e-15   
ref|XP_006440716.1|  hypothetical protein CICLE_v10023795mg           81.6    1e-14   
gb|AFJ52981.1|  UDP-glycosyltransferase 1                             81.6    1e-14   
dbj|BAJ94765.1|  predicted protein                                    81.6    1e-14   
gb|EMT13631.1|  Cytokinin-O-glucosyltransferase 2                     81.6    2e-14   
gb|AAN04955.1|  Putative glucosyltransferase                          78.2    2e-14   
ref|XP_002461042.1|  hypothetical protein SORBIDRAFT_02g039670        81.3    2e-14   
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein       81.3    2e-14   
ref|XP_011465456.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  81.3    2e-14   
ref|XP_009610295.1|  PREDICTED: UDP-glycosyltransferase 82A1-like     79.0    2e-14   
gb|ABB47192.2|  retrotransposon protein, putative, Ty3-gypsy subc...  82.0    3e-14   
ref|XP_010691333.1|  PREDICTED: UDP-glycosyltransferase 82A1          80.5    3e-14   
ref|XP_006603907.1|  PREDICTED: UDP-glycosyltransferase 83A1-like...  80.5    3e-14   
gb|KHN48822.1|  UDP-glycosyltransferase 83A1                          80.5    3e-14   
gb|EMS51148.1|  UDP-glycosyltransferase 85A3                          80.5    3e-14   
gb|ABK24601.1|  unknown                                               78.6    3e-14   
gb|KJB79645.1|  hypothetical protein B456_013G060500                  80.5    4e-14   
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  80.5    4e-14   
ref|XP_003618097.1|  Cytokinin-O-glucosyltransferase                  80.1    4e-14   
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     80.1    4e-14   
gb|AET01056.2|  UDP-glucosyltransferase family protein                80.1    4e-14   
gb|KEH35119.1|  UDP-glucosyltransferase family protein                80.1    4e-14   
ref|XP_009387949.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     77.8    6e-14   
ref|XP_003519003.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     79.7    6e-14   
ref|XP_002445537.1|  hypothetical protein SORBIDRAFT_07g021090        79.7    6e-14   
gb|EAY78680.1|  hypothetical protein OsI_33782                        77.4    6e-14   
ref|XP_011468341.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  79.3    8e-14   
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     79.3    8e-14   
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     79.3    8e-14   
gb|EMT00068.1|  hypothetical protein F775_43139                       76.3    8e-14   
ref|XP_008386313.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     79.0    1e-13   
gb|AFW64431.1|  hypothetical protein ZEAMMB73_262515                  76.3    1e-13   
ref|XP_002322553.2|  hypothetical protein POPTR_0016s02070g           78.6    1e-13   
ref|XP_004308659.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  78.6    1e-13   
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                     78.6    2e-13   
gb|ADE76226.1|  unknown                                               78.6    2e-13   
gb|EMS64923.1|  UDP-glycosyltransferase 85A5                          78.6    2e-13   
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  78.6    2e-13   
ref|XP_006593894.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     78.6    2e-13   
ref|NP_001152029.1|  cytokinin-O-glucosyltransferase 2                78.6    2e-13   
ref|XP_008350015.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     77.8    2e-13   
gb|EEC67042.1|  hypothetical protein OsI_33784                        75.5    2e-13   
emb|CBI21223.3|  unnamed protein product                              77.8    2e-13   
gb|KDO36703.1|  hypothetical protein CISIN_1g029948mg                 75.5    2e-13   
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  78.2    2e-13   
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg           78.2    2e-13   
gb|AAP53973.1|  Cytokinin-O-glucosyltransferase 2, putative, expr...  75.9    2e-13   
ref|XP_008343335.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     75.1    2e-13   
ref|XP_006352056.1|  PREDICTED: UDP-glycosyltransferase 82A1-like     77.8    2e-13   
ref|XP_004299648.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  78.2    2e-13   
ref|XP_003575223.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  78.2    2e-13   
gb|EMT26410.1|  Cytokinin-O-glucosyltransferase 2                     77.4    2e-13   
ref|XP_004251558.1|  PREDICTED: UDP-glycosyltransferase 82A1          77.8    3e-13   
gb|AGD95009.1|  UDP-glucosyltransferase                               77.8    3e-13   
ref|XP_011008560.1|  PREDICTED: UDP-glycosyltransferase 82A1-like...  77.8    3e-13   
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     77.8    3e-13   
gb|KDO38606.1|  hypothetical protein CISIN_1g039753mg                 73.6    3e-13   
ref|XP_011000634.1|  PREDICTED: UDP-glycosyltransferase 82A1-like     77.4    3e-13   
ref|XP_003592231.1|  Cytokinin-O-glucosyltransferase                  77.4    4e-13   
gb|KEH35117.1|  UDP-glucosyltransferase family protein                77.4    4e-13   
gb|AFJ52980.1|  UDP-glycosyltransferase 1                             77.4    4e-13   
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                   77.4    4e-13   
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase  77.0    5e-13   
gb|EMS68467.1|  UDP-glycosyltransferase 85A2                          77.0    5e-13   
ref|XP_009348490.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  77.0    5e-13   
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg           77.0    5e-13   
gb|ACG28831.1|  cytokinin-O-glucosyltransferase 2                     77.0    5e-13   
ref|XP_007217615.1|  hypothetical protein PRUPE_ppa016262mg           77.0    5e-13   
ref|XP_010025430.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  77.0    6e-13   
gb|EMT22184.1|  Cytokinin-O-glucosyltransferase 2                     77.0    6e-13   
ref|XP_009797314.1|  PREDICTED: UDP-glycosyltransferase 82A1-like     76.6    6e-13   
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     76.6    7e-13   
ref|XP_004975278.1|  PREDICTED: UDP-glycosyltransferase 85A3-like     76.6    7e-13   
ref|XP_008450117.1|  PREDICTED: UDP-glycosyltransferase 85A7-like     76.6    7e-13   
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                  76.6    7e-13   
ref|XP_008359346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     75.1    7e-13   
ref|XP_004975276.1|  PREDICTED: UDP-glycosyltransferase 85A2-like     76.6    7e-13   
ref|NP_001147350.1|  LOC100280958                                     76.6    7e-13   
gb|EEC73470.1|  hypothetical protein OsI_07794                        76.6    7e-13   
gb|AFJ52995.1|  UDP-glycosyltransferase 1                             76.3    9e-13   
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     76.3    9e-13   
ref|XP_008229668.1|  PREDICTED: UDP-glycosyltransferase 82A1-like...  77.0    9e-13   
ref|NP_001047225.1|  Os02g0578300                                     76.3    9e-13   
gb|EEE57247.1|  hypothetical protein OsJ_07254                        76.3    9e-13   
gb|EMS64263.1|  UDP-glycosyltransferase 85A2                          76.3    9e-13   
gb|AFJ53003.1|  UDP-glycosyltransferase 1                             76.3    1e-12   
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  76.3    1e-12   
ref|XP_009364608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...  75.9    1e-12   
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  76.3    1e-12   



>ref|XP_004233382.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Solanum lycopersicum]
Length=476

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   HIL+IPYP QGHVIPLM+LAQ LA++G   ITFV T++TH  ILNS +  N +L D
Sbjct  1    MSKLHILIIPYPVQGHVIPLMQLAQSLAKYG-FKITFVNTESTHKSILNSLSGKN-SLHD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHL+SVLD SES E  NVPGKL EAI KIMPGK+EKLI+  N S  E  ITC+IADQSL
Sbjct  59   QIHLISVLDESESGEDKNVPGKLSEAIFKIMPGKIEKLIQVTNVSEDE-RITCIIADQSL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPA-ENKTFQFAPTMP  600
            GWALELA K+G++ AAF+ AAAANL+LGFNIPKLI DG+I+N+G P  ++ TFQF PTMP
Sbjct  118  GWALELADKMGIKRAAFITAAAANLILGFNIPKLIHDGLIDNDGTPRIKDHTFQFEPTMP  177

Query  601  FMNTS  615
             MNTS
Sbjct  178  IMNTS  182



>ref|XP_006363427.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Solanum tuberosum]
Length=476

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG  HIL+IPYP QGHV PLM+LAQ LA++G   ITFV T++TH  IL S +  N +L D
Sbjct  1    MGKLHILMIPYPVQGHVNPLMQLAQSLAKYG-FKITFVNTESTHKSILTSLSGKN-SLHD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHL+SVLD SES E  NVPGKL EAI KIMPGK+EKLI+  N S  E  ITC+IADQSL
Sbjct  59   QIHLISVLDESESGEDKNVPGKLSEAIFKIMPGKIEKLIQETNVSEDE-RITCIIADQSL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPA-ENKTFQFAPTMP  600
            GWALELA K+G++ AAF+ AAAANL+LGFNIPKLIDDG+I+N+G P  +  TFQF PTMP
Sbjct  118  GWALELADKMGIKRAAFITAAAANLILGFNIPKLIDDGLIDNDGTPTIKGHTFQFEPTMP  177

Query  601  FMNTS  615
             MNTS
Sbjct  178  IMNTS  182



>ref|XP_009587653.1| PREDICTED: UDP-glycosyltransferase 83A1 [Nicotiana tomentosiformis]
Length=478

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   HIL+IPYP QGHVIPLMELAQ L ++G   ITF  T++TH +I+NS    N+ L D
Sbjct  1    MSKHHILMIPYPVQGHVIPLMELAQSLVKYG-FKITFANTESTHKRIINSLGGKNI-LHD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHL+S+LD SES E++NVPGKL EAI K+MPGK+EKLIR  NA   +  ITCVIADQSL
Sbjct  59   QIHLISILDESESGENNNVPGKLSEAIFKVMPGKIEKLIRETNAFEDDK-ITCVIADQSL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPA-ENKTFQFAPTMP  600
            GWALELA K+G++ AAFL AAAANLVLGFNIPKLIDDGII+N G P  ++  FQF PTMP
Sbjct  118  GWALELAAKMGIKRAAFLTAAAANLVLGFNIPKLIDDGIIDNNGTPTIKDHIFQFEPTMP  177

Query  601  FMNTS  615
             MNTS
Sbjct  178  IMNTS  182



>ref|XP_009796196.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Nicotiana sylvestris]
Length=476

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 140/185 (76%), Gaps = 8/185 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   HIL+IPYP QGHVIPLMELAQ LA++G     F +T  TH +I+N     N+ L D
Sbjct  1    MSKHHILMIPYPVQGHVIPLMELAQSLAKYG-----FKITFATHKRIINYLGGKNI-LHD  54

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHL+S+LD SES E  NVPGKL EAI K+MPGK+EKLI+  NA   +  ITCVIADQSL
Sbjct  55   QIHLISILDESESGEDKNVPGKLSEAIFKVMPGKIEKLIQETNAYKDDK-ITCVIADQSL  113

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPA-ENKTFQFAPTMP  600
            GWALELA K+G++ AAFL AAAANLVLGFNIPKLIDDGII+  G PA ++ TFQF PTMP
Sbjct  114  GWALELAAKMGIKRAAFLTAAAANLVLGFNIPKLIDDGIIDTNGTPAIKDHTFQFEPTMP  173

Query  601  FMNTS  615
             MNTS
Sbjct  174  IMNTS  178



>emb|CDP02308.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPH+LVIP+P QGHVIPLMELAQCL  HG + ITFV T+ TH ++L++ A   + LDD
Sbjct  1    MANPHVLVIPFPVQGHVIPLMELAQCLVEHGFM-ITFVNTEVTHERVLDALADKGL-LDD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LV++ D  ES E   +PGKL EAI ++MPGK+E+LIR INAS  E  ITCVIADQ L
Sbjct  59   RIRLVAIPDGLESEEERKIPGKLAEAIYRVMPGKLEELIREINASEEEP-ITCVIADQGL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+G++ AAFL AAAA+LVLGF IP LIDDGII+++G P + +T Q APTMP 
Sbjct  118  GWALEVAGKMGIRRAAFLTAAAASLVLGFRIPCLIDDGIIDHDGTPIKKQTLQLAPTMPL  177

Query  604  MNTS  615
            MNTS
Sbjct  178  MNTS  181



>ref|XP_002526116.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36310.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=488

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 143/184 (78%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGNPHILVIPYPAQGH+IPLM L+QCLAR+G   ITFV +++ H  I N+SA N+  LD+
Sbjct  34   MGNPHILVIPYPAQGHIIPLMVLSQCLARNG-FRITFVNSESNHQLIKNASASNDY-LDN  91

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  +S+E  N PGK  EAI ++MPGKVE+LI  IN+S S+  I+CV+ADQS+
Sbjct  92   QIHLVSIPDGLQSSEDRNKPGKSSEAILRVMPGKVEELIEEINSSDSDK-ISCVLADQSI  150

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K G++ AAF PAAAA LVLGF+IPKLI++GI++  G P + +  + +P MP 
Sbjct  151  GWALEIAEKKGIRRAAFCPAAAAQLVLGFSIPKLIEEGIMDEHGTPTKEQIIRLSPAMPA  210

Query  604  MNTS  615
            MNT+
Sbjct  211  MNTA  214



>ref|XP_002306070.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEE86581.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=456

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALN-NVALD  240
            MGNPHILVIPYP QGH+IPL+EL+ CLA +G   ITFV TQ    +I N+S L      +
Sbjct  1    MGNPHILVIPYPEQGHIIPLLELSHCLASYG-FKITFVNTQHNEERIRNASGLKVKGDTE  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D IHLVS  D  ES E    PGK  E    +MPGK+E+LI  INAS S+  I+C++ADQ+
Sbjct  60   DLIHLVSFSDGLESGEDRFKPGKRSETFLTLMPGKIEELIESINASDSDK-ISCILADQT  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALELA+K G++ AAF  AAAA LV GF+IPKLI+DGII+ EG P + +T   +PTMP
Sbjct  119  IGWALELAEKKGIKRAAFCSAAAAMLVQGFSIPKLIEDGIIDKEGTPVKMQTIMLSPTMP  178

Query  601  FMNTS  615
             +NT+
Sbjct  179  AINTA  183



>gb|KJB33429.1| hypothetical protein B456_006G010800 [Gossypium raimondii]
Length=446

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 128/183 (70%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPHILVIPYPAQGHVIPLM+L+ CL +HG   ITFV  +  H   ++  AL    + +
Sbjct  1    MENPHILVIPYPAQGHVIPLMDLSSCLLKHG-FKITFVTLEFNHQNAMDILALRGEEMGN  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVSV D     E  N PGK+ EAI + MP KVE+L+  IN S  E  I CVIADQSL
Sbjct  60   RVHLVSVPDGLGPLEERNQPGKISEAILQTMPRKVEELVEVINGS--ERKINCVIADQSL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+AKK G++ AAF PAAAA LVLGF+IPKLIDDG+I+ +G P + +  + +P MP 
Sbjct  118  GWALEIAKKHGMKRAAFCPAAAALLVLGFSIPKLIDDGVIDQDGTPLKREMIKLSPNMPP  177

Query  604  MNT  612
            MNT
Sbjct  178  MNT  180



>ref|XP_009365867.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=453

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 132/184 (72%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPH+LVIPYPAQGHVIPL EL++CL +HG I +TFV T+  H Q+ N+ A+ +  +  
Sbjct  1    MVNPHVLVIPYPAQGHVIPLFELSRCLVKHG-IEVTFVNTEHVHMQMKNALAMED-EIGS  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IH V + D  ES E   +PGK   AI ++MPGK E+LI  IN ++ +  ITCV+ADQSL
Sbjct  59   KIHHVFISDGLESVEDRKIPGKFSAAIMQVMPGKFEELIEEINGANGD-QITCVLADQSL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A +  ++ AAF PAAAA LVLGF+IPKLID+GI+ N+G P + +  + +P MP 
Sbjct  118  GWALEIADQKAIKRAAFCPAAAALLVLGFSIPKLIDEGIVANDGTPTKKQVIKLSPEMPG  177

Query  604  MNTS  615
            MNTS
Sbjct  178  MNTS  181



>ref|XP_011009404.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Populus euphratica]
Length=456

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALN-NVALD  240
            MGNPHILVIPYP QGH+IPL+EL+ CLA +G   ITFV TQ    +I N+S L      +
Sbjct  1    MGNPHILVIPYPEQGHIIPLLELSHCLASYG-FKITFVNTQHNEERIRNASGLKVKGDTE  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D IHLVS  D  ES E    PGK  E   ++MPGK+E++I  INA  S+  I+C++ADQ+
Sbjct  60   DLIHLVSFSDGLESGEDRFKPGKRSETFLRLMPGKIEEVIERINALDSDK-ISCILADQT  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALELA+K G++ AAF  AAAA LV GF+IPKLI+DGII+ EG P + +T   +PTMP
Sbjct  119  IGWALELAEKKGIKRAAFCSAAAAMLVQGFSIPKLIEDGIIDKEGTPVKMQTILLSPTMP  178

Query  601  FMNTS  615
             +NT+
Sbjct  179  AINTA  183



>ref|XP_009365976.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=453

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 132/184 (72%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPH+LVIPYPAQGHVIPL EL++CL +H  I +TFV T+  H Q+ N+ A+ +  +  
Sbjct  1    MVNPHVLVIPYPAQGHVIPLFELSRCLVKHS-IEVTFVNTEHVHMQMKNALAMED-EIGS  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IH V + D  ES E   +PGK   AI ++MPGK E+LI  IN ++  + ITCV+ADQSL
Sbjct  59   KIHHVFISDGLESVEDRKIPGKFSAAIMQVMPGKFEELIEEINGANG-NQITCVLADQSL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A++  ++ AAF PAAAA LVLGF+IPKLID+GI+ N+G P + +  + +P MP 
Sbjct  118  GWALEIAEQKAIKRAAFCPAAAALLVLGFSIPKLIDEGIVANDGTPTKKQVIKLSPEMPG  177

Query  604  MNTS  615
            MNTS
Sbjct  178  MNTS  181



>ref|XP_008379414.1| PREDICTED: UDP-glycosyltransferase 83A1 [Malus domestica]
Length=453

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 132/184 (72%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPH+LVIPYPAQGHVIPL EL++CL +HG I +TFV T+  H Q+ N+ A+ +  +  
Sbjct  1    MVNPHVLVIPYPAQGHVIPLFELSRCLVKHG-IEVTFVDTEHVHMQMKNALAVED-EIGS  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IH V V D  ES E   +PGK   AI ++MPGK ++LI  IN S+ +  ITCV+ADQSL
Sbjct  59   KIHHVFVSDGLESLEDRKIPGKFSAAIMQVMPGKFKELIEEINGSNGD-QITCVLADQSL  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWAL++ ++  ++ AAF PAAAA LVLGF+IPKLID+GI+ N+G P + +  + +P MP 
Sbjct  118  GWALDIXEQKAIKRAAFCPAAAALLVLGFSIPKLIDEGIVANDGTPTKKQVIKLSPEMPG  177

Query  604  MNTS  615
            MNTS
Sbjct  178  MNTS  181



>emb|CDY37551.1| BnaA05g34160D [Brassica napus]
Length=458

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 134/186 (72%), Gaps = 4/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS--SALNNVAL  237
            MG PH++VIPYPAQGHV+PLM  ++ LA  G I +TFV T+  H++I+NS   +  +  +
Sbjct  1    MGRPHVMVIPYPAQGHVLPLMSFSRYLASQG-IQVTFVNTEFNHNRIINSLSKSFRDDHV  59

Query  238  DDGIHLVSVLDA-SESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
             DGI LVS+ D   +S E  NVPGKL E++   MP KVE+LI  + + +S + I+CV+AD
Sbjct  60   VDGIKLVSIPDGLDDSPEERNVPGKLSESVLHFMPTKVEELIERMISETSGAVISCVVAD  119

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
            QSLGWA+E+A K G++ AAF PAAAA++VLGF+I KL+DDG+I+ +G P  NKT Q +P 
Sbjct  120  QSLGWAMEVAAKFGIRRAAFCPAAAASMVLGFSIQKLVDDGLIDYDGTPKVNKTIQLSPG  179

Query  595  MPFMNT  612
            MP M T
Sbjct  180  MPEMET  185



>ref|XP_002276804.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
Length=454

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 131/184 (71%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGNPHILVIPYPAQGHVIPL+EL+Q L +HG   ITFV T+  H ++ N+    +  + D
Sbjct  1    MGNPHILVIPYPAQGHVIPLLELSQHLVKHG-FKITFVNTEFNHKRVTNALTKKD-DVGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E+ E  N  GKL E   +IMP K+E+LI  IN S  + +ITCVIAD+S+
Sbjct  59   HIHLVSIPDGLEAWEDRNDLGKLTEVGFRIMPKKLEELIEEINGSDDD-NITCVIADESM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+G+Q A F PA+A  L L F++ KLIDDGI++N G P +++  + + TMP 
Sbjct  118  GWALEVAEKMGIQRAVFWPASATLLALFFSVQKLIDDGIVDNNGTPTKHQMIKLSETMPA  177

Query  604  MNTS  615
            MNT+
Sbjct  178  MNTA  181



>ref|XP_002884302.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60561.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=463

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 136/188 (72%), Gaps = 4/188 (2%)
 Frame = +1

Query  61   RMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS--SALNNVA  234
            RMG PH++VIPYPAQGHV+PLM  ++ LA+ G I ITF+ T+  H++I+NS  ++ +   
Sbjct  8    RMGRPHVVVIPYPAQGHVLPLMSFSRYLAKQG-IQITFINTEFNHNRIINSLPNSSHEDY  66

Query  235  LDDGIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIA  411
            + DGI+LVS+ D  E S E  N+PGKL E++ + MP KVE+LI   +  S  + I+CV+A
Sbjct  67   VGDGINLVSIPDGLEDSPEERNIPGKLSESVLRFMPKKVEELIAETSGGSCGTIISCVVA  126

Query  412  DQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAP  591
            DQSLGWA+E+A K G++ AAF PAAAA++VLGF+I KLIDDG+I+ +G    NKT Q +P
Sbjct  127  DQSLGWAIEVAAKFGIRRAAFCPAAAASMVLGFSIQKLIDDGLIDFDGTVRVNKTIQLSP  186

Query  592  TMPFMNTS  615
             MP M T 
Sbjct  187  GMPKMETD  194



>ref|XP_011085854.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Sesamum indicum]
Length=452

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 133/184 (72%), Gaps = 6/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH+L++P+P QGHVIP+ ELA CLA+H  I  T V T+  H ++LNS++    ALDD
Sbjct  1    MGKPHVLMVPFPVQGHVIPMFELAYCLAKHR-IRTTIVNTEIVHHRLLNSTS----ALDD  55

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVSV D  ES E   +PGKL EA+ ++MP K+E+LIR I   S+E  ++C++ DQSL
Sbjct  56   SIRLVSVPDGLESGER-QIPGKLMEAVCRVMPVKIEELIREIGGCSAEDKVSCIVYDQSL  114

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            G   ++A+++G+ + AFLPAAAA LVLGFNIPKLI DGII+++G P  +K  QFA TMP 
Sbjct  115  GRIQQVAERMGIGSVAFLPAAAALLVLGFNIPKLIQDGIIDDQGNPLTDKAVQFAATMPI  174

Query  604  MNTS  615
            M+ S
Sbjct  175  MSPS  178



>emb|CDY43260.1| BnaC05g48530D [Brassica napus]
Length=458

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 133/186 (72%), Gaps = 4/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS--SALNNVAL  237
            MG PH++VIPYPAQGHV+PLM  ++ LA  G I +TFV T+  H++I+NS   +  +  +
Sbjct  1    MGRPHVMVIPYPAQGHVLPLMSFSRYLASQG-IQVTFVNTEFNHNRIINSLSKSFRDDHV  59

Query  238  DDGIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
             DGI L+S+ D  E S E  NVPGKL E++   MP KVE+LI  + + +S + I+CV+AD
Sbjct  60   VDGIKLISIPDGLEDSPEERNVPGKLSESVLHFMPTKVEELIERMISETSGAVISCVVAD  119

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
            QSLGWA+E+A K G++ AAF PAAAA++VLGF+I KL+DDG+I+ +G P  NK  Q +P 
Sbjct  120  QSLGWAMEVAAKFGIRRAAFCPAAAASMVLGFSIQKLVDDGLIDYDGTPKGNKAIQLSPG  179

Query  595  MPFMNT  612
            MP M T
Sbjct  180  MPEMET  185



>ref|XP_010442178.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Camelina sativa]
Length=470

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 139/193 (72%), Gaps = 6/193 (3%)
 Frame = +1

Query  52   KQSRMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS---SAL  222
            K+  M  PH++VIPYPAQGHVIPLM  ++ LA+ G I ITFV T+  H++I+ S   S+ 
Sbjct  6    KKKDMIRPHVVVIPYPAQGHVIPLMSFSRYLAKQG-ILITFVNTEFNHNRIVRSLEKSSH  64

Query  223  NNVALDDGIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLI-RGINASSSESHI  396
            ++  + DGI+LVS+ D  E S E  N+PGKL E++   MP KVE+LI R I  SS  + I
Sbjct  65   DDYYVGDGINLVSIPDGLEDSPEERNIPGKLSESVLHFMPNKVEELIERMIADSSGGTII  124

Query  397  TCVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKT  576
            +CV+AD SLGWA+E+A K G++ AAF PAAAA++VLGF+I KLIDDG+I+++G P+ NKT
Sbjct  125  SCVVADLSLGWAIEVAVKFGIRRAAFCPAAAASMVLGFSIQKLIDDGLIDSDGTPSVNKT  184

Query  577  FQFAPTMPFMNTS  615
             Q +P MP M T 
Sbjct  185  IQLSPGMPMMETD  197



>ref|XP_009147384.1| PREDICTED: UDP-glycosyltransferase 83A1 [Brassica rapa]
Length=458

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 134/188 (71%), Gaps = 8/188 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH++VIPYPAQGHV+PLM  ++ LA  G I +TFV T+  H++I+NS  L+  + DD
Sbjct  1    MGRPHVMVIPYPAQGHVLPLMSFSRYLASQG-IQVTFVNTEFNHNRIINS--LSKSSRDD  57

Query  244  ----GIHLVSVLDA-SESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVI  408
                GI LVS+ D   +S E  NVPG L E++   MP KVE+LI  + + +S + I+CV+
Sbjct  58   HVVDGIKLVSIPDGLDDSPEERNVPGMLSESVLHFMPTKVEELIERMISETSGAVISCVV  117

Query  409  ADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFA  588
            ADQSLGWA+E+A K G++ AAF PAAAA++VLGF+I KL+DDG+I+ +G P  NKT Q +
Sbjct  118  ADQSLGWAMEVAAKFGIRRAAFCPAAAASMVLGFSIQKLVDDGLIDYDGTPNVNKTIQLS  177

Query  589  PTMPFMNT  612
            P MP M T
Sbjct  178  PGMPEMET  185



>ref|XP_002324098.1| hypothetical protein POPTR_0017s12710g [Populus trichocarpa]
 gb|EEF04231.1| hypothetical protein POPTR_0017s12710g [Populus trichocarpa]
Length=454

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 127/184 (69%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGNPHI+VIPYPAQGHVIP MEL+QCLA+ G   ITFV T+  H ++L +   NN  L  
Sbjct  1    MGNPHIVVIPYPAQGHVIPFMELSQCLAKQG-FKITFVNTEYNHKRVLKALGENNY-LGS  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL +AI ++MPGK+++LI  IN S  E  IT +I D S+
Sbjct  59   EISLVSIPDGLEPWEDRNELGKLTKAIFQVMPGKLQQLINRINMSGEE-RITGIITDWSM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+ ++ A F PA+ A L    +I KL++DGII+N+G P +N+T Q AP MP 
Sbjct  118  GWALEVAEKMNIRRAIFWPASTAVLCSMLSISKLLNDGIIDNDGTPLKNQTIQLAPKMPV  177

Query  604  MNTS  615
            M+T+
Sbjct  178  MDTA  181



>ref|XP_008230872.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Prunus mume]
Length=455

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 124/184 (67%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPHIL +P PAQGHVIPLMEL+QCL  HG   +TFV T   H +++N+ A +   L D
Sbjct  1    MSNPHILAVPLPAQGHVIPLMELSQCLVNHG-FTVTFVNTDYNHKRVVNALAADESQLSD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E+ +  GK  EA  ++MPGK+E+LI  IN    +  +TCVIAD+S 
Sbjct  60   RIRLVSLPDGLEPWEARHEVGKFCEATQRVMPGKLEELIEKINQGEGDK-VTCVIADESA  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+A+KL ++  AF PA+AA+L L F+IPKLI  GIIN++G  + ++  Q AP MP 
Sbjct  119  RWALEVAEKLNIRRVAFFPASAASLALQFSIPKLIHQGIINDDGTVSRSQMIQLAPDMPT  178

Query  604  MNTS  615
            M T+
Sbjct  179  MKTT  182



>ref|XP_010089623.1| UDP-glycosyltransferase 83A1 [Morus notabilis]
 gb|EXB38094.1| UDP-glycosyltransferase 83A1 [Morus notabilis]
Length=453

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 129/182 (71%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
            NPH LV+PYPA+GH+IPL+EL+Q L + GG+N+TFV T+  H ++    A  +  + + I
Sbjct  4    NPHALVVPYPAEGHIIPLLELSQRLVK-GGLNVTFVSTEYIHEKVREIMASKDYDMVEQI  62

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
            +L  V D   S E    PGKL E++ KIMPGKV ++I  IN SS +  ITCV+ADQSLGW
Sbjct  63   NLALVKDGL-SLEERKRPGKLSESVLKIMPGKVAEVIEQINGSSGDQMITCVVADQSLGW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            AL++A++ G++ AAF PAAAA LV GF+IPKLID+GI N +G  A+ +  + +P MP M+
Sbjct  122  ALDIAERKGIKRAAFCPAAAAMLVQGFSIPKLIDEGITNKDGTLAKKQVIKLSPEMPAMD  181

Query  610  TS  615
            TS
Sbjct  182  TS  183



>ref|XP_007216885.1| hypothetical protein PRUPE_ppa020867mg [Prunus persica]
 gb|EMJ18084.1| hypothetical protein PRUPE_ppa020867mg [Prunus persica]
Length=456

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPHI+ +P+PAQGHVIPLMEL+QCL  HG   +TFV T   H Q++N+ A +   L D
Sbjct  1    MSNPHIIAVPFPAQGHVIPLMELSQCLVNHG-FRVTFVNTDYNHKQVVNALAADESQLSD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+    E  E+ +  GKL EA  ++MPGK+E+LI  IN    +  +TCVIAD+  
Sbjct  60   RICLVSLPGGLEPWEARHEVGKLCEATERVMPGKLEELIEKINQGEGDK-VTCVIADECS  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+KL ++  AF PA+AA L L F+IPKLI  GIIN++G    ++  Q AP MP 
Sbjct  119  GWALEVAEKLNIRRVAFYPASAAILTLQFSIPKLIHQGIINDDGTVLRSQMIQLAPGMPT  178

Query  604  MNTS  615
            M T+
Sbjct  179  MKTT  182



>ref|XP_006408448.1| hypothetical protein EUTSA_v10020693mg [Eutrema salsugineum]
 gb|ESQ49901.1| hypothetical protein EUTSA_v10020693mg [Eutrema salsugineum]
Length=460

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 135/187 (72%), Gaps = 5/187 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS--SALNNVAL  237
            MG PH++VIPYPAQGH++PLM  ++ LA+ G I ITFV  +  H++I+NS   + +   +
Sbjct  1    MGRPHVMVIPYPAQGHILPLMSFSRYLAKQG-IQITFVNIEFNHNRIINSISKSSHGDYV  59

Query  238  DDGIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLIRG-INASSSESHITCVIA  411
             + I LVS+ D  E S E  N+PGKL E++ + MP KVE+LI+  I+ +S  + I+CV+A
Sbjct  60   PNRIKLVSIHDGLEDSPEERNIPGKLSESVLRFMPTKVEELIKNMISETSGGTIISCVVA  119

Query  412  DQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAP  591
            DQSLGWA+E+A K G++ AAF PAAAA++VLGF+I KL+DDG+I+ +G P  NKT Q +P
Sbjct  120  DQSLGWAIEIAAKFGIRRAAFCPAAAASMVLGFSIQKLVDDGLIDCDGTPRVNKTIQLSP  179

Query  592  TMPFMNT  612
             MP M T
Sbjct  180  GMPDMET  186



>ref|NP_186859.1| UDP-glycosyltransferase 83A1 [Arabidopsis thaliana]
 sp|Q9SGA8.1|U83A1_ARATH RecName: Full=UDP-glycosyltransferase 83A1 [Arabidopsis thaliana]
 gb|AAF14850.1|AC011664_32 putative UDP-glucosyl transferase [Arabidopsis thaliana]
 gb|AEE73763.1| UDP-glycosyltransferase 83A1 [Arabidopsis thaliana]
Length=464

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = +1

Query  61   RMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS--SALNNVA  234
            RMG PH++VIPYPAQGHV+PL+  ++ LA+ G I ITF+ T+  H++I++S  ++ +   
Sbjct  8    RMGRPHVVVIPYPAQGHVLPLISFSRYLAKQG-IQITFINTEFNHNRIISSLPNSPHEDY  66

Query  235  LDDGIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLI-RGINASSSESHITCVI  408
            + D I+LVS+ D  E S E  N+PGKL E++ + MP KVE+LI R +  +S  + I+CV+
Sbjct  67   VGDQINLVSIPDGLEDSPEERNIPGKLSESVLRFMPKKVEELIERMMAETSGGTIISCVV  126

Query  409  ADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFA  588
            ADQSLGWA+E+A K G++  AF PAAAA++VLGF+I KLIDDG+I+++G    NKT Q +
Sbjct  127  ADQSLGWAIEVAAKFGIRRTAFCPAAAASMVLGFSIQKLIDDGLIDSDGTVRVNKTIQLS  186

Query  589  PTMPFMNT  612
            P MP M T
Sbjct  187  PGMPKMET  194



>ref|XP_010485444.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Camelina sativa]
Length=462

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 11/191 (6%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH++VIPYPAQGHV+PLM  ++ LA+ G I ITFV T+  H++I+  S+L   + DD
Sbjct  1    MVRPHVVVIPYPAQGHVLPLMSFSRYLAKQG-IQITFVNTEFNHNRII--SSLPKSSPDD  57

Query  244  ----GIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH---IT  399
                GI+LVS+ D  E S E  N+PGKL E++   MP KVE+LI  + A SS      I+
Sbjct  58   YVGNGINLVSIPDGLEDSPEERNIPGKLSESVLHFMPTKVEELIGRMIADSSGGTGTIIS  117

Query  400  CVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTF  579
            CV+ADQSLGWA+E+A K G++ AAF PAAAA++VLGF+I KLIDDG+I+++G P+ NKT 
Sbjct  118  CVVADQSLGWAIEVAVKFGIRRAAFCPAAAASMVLGFSIKKLIDDGLIDSDGTPSVNKTI  177

Query  580  QFAPTMPFMNT  612
            Q +P MP M T
Sbjct  178  QLSPGMPMMET  188



>ref|XP_002526107.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36301.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=452

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 125/183 (68%), Gaps = 4/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG  H+L IPYPAQGHVIP++EL+QCL +H G  ITFV T   H ++LN  AL N  L D
Sbjct  1    MGKLHVLAIPYPAQGHVIPMLELSQCLVKH-GFEITFVNTDYNHKRVLN--ALGNDFLGD  57

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL EAI  +MPGK+E+LI   NA S +  ITC+IAD + 
Sbjct  58   QISLVSIPDGLELWEDRNDLGKLTEAIFNVMPGKLEELINRSNA-SKDKKITCIIADANN  116

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+ ++ AAF PA+AA L   F + KLIDDGII+N G P +N+  Q  PTMP 
Sbjct  117  GWALEVAEKMNIRCAAFWPASAALLSSLFTVQKLIDDGIIDNNGTPLKNQIIQMDPTMPA  176

Query  604  MNT  612
            ++T
Sbjct  177  IST  179



>emb|CDP20814.1| unnamed protein product, partial [Coffea canephora]
Length=455

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 126/179 (70%), Gaps = 5/179 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            MG+PH+L IPYPAQGHV+PLMELA CL +HG I +TFV T+  H +++ S S   NV   
Sbjct  1    MGSPHVLAIPYPAQGHVLPLMELALCLVKHG-IKVTFVNTEFDHKRVIESLSGEENVP--  57

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D +HLVS+ D  ES E  N   KL +AI ++MP K+E LI  IN S S+  ITC+IAD++
Sbjct  58   DMMHLVSIPDGLESWEDRNDAAKLMKAIFRVMPAKLEALIEKINQSESDK-ITCLIADEN  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            +GWALE+AKK+ V+T AF PAAAA + L  NIPKLIDDGII++ G   + +  Q + T+
Sbjct  117  VGWALEVAKKMKVRTVAFWPAAAAQIALKLNIPKLIDDGIIDSSGSVLKKQMVQLSSTI  175



>ref|XP_002306038.2| hypothetical protein POPTR_0004s12230g [Populus trichocarpa]
 gb|EEE86549.2| hypothetical protein POPTR_0004s12230g [Populus trichocarpa]
Length=454

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PHI+VIPYPAQGHVIP MEL+QCL +  G  ITFV T+  H ++L  +   N+ L  
Sbjct  1    MGKPHIVVIPYPAQGHVIPFMELSQCLVKQ-GFKITFVSTEYNHKRVLK-ALRGNINLGG  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E+    N  GKL +AI ++MPGK+E+LI  IN  + E  ITC+I D S+
Sbjct  59   EISLVSLPDGLEACGDRNELGKLSKAIFQVMPGKLEELIDRINM-TEEEKITCIITDWSM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+ ++ A + PAAAA L    +IPKL+ DGII+ +G P  N+  Q APTMP 
Sbjct  118  GWALEVAEKMKIRRAIYWPAAAAILCSLISIPKLLSDGIIDGDGTPLNNQMIQLAPTMPA  177

Query  604  MNTS  615
            M+T+
Sbjct  178  MDTA  181



>ref|XP_010550007.1| PREDICTED: UDP-glycosyltransferase 83A1 [Tarenaya hassleriana]
Length=451

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 132/188 (70%), Gaps = 5/188 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH++VIPYP QGHV+PLM L+Q LA+HG I ITF+ T+  +++I++S   N  +L D
Sbjct  1    MRRPHVVVIPYPEQGHVLPLMILSQYLAKHG-IQITFINTEHNNARIIDSMNENRYSLGD  59

Query  244  GIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLIRG---INASSSESHITCVIA  411
             I LVS+ D  E S E  N+PGKL E++ ++MP KVE+LI     + +      I+CV+A
Sbjct  60   RIRLVSIPDGLEDSPEDRNIPGKLSESVLRLMPAKVEELIEKMVTVGSKRGSDSISCVLA  119

Query  412  DQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAP  591
            DQS+GWALE+A K G++ AAF PAAAA++VLG +I KL++DG+I+ +G P  +K  + +P
Sbjct  120  DQSIGWALEVAAKFGIKRAAFCPAAAASMVLGLSIQKLVEDGVIDLDGNPKVDKRIRLSP  179

Query  592  TMPFMNTS  615
             MP M TS
Sbjct  180  GMPEMETS  187



>ref|XP_008365421.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=471

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 123/183 (67%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M +PHILVIP PAQGHVIP+MEL+QCL  HG   +TFV T   H+++ NSS  +   +  
Sbjct  1    MXSPHILVIPAPAQGHVIPMMELSQCLVNHG-FKVTFVNTDFNHNRVTNSSGDDQSHIRR  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  +  N  GKL EA  ++MPGK+E+LI  IN       ITCVIADQ+
Sbjct  60   DCIDLVSIXDGLEPGQDRNDLGKLSEAARRVMPGKLEELIEKINNRGEGDKITCVIADQT  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKT-FQFAPTM  597
            +GWALE+A K+  +  AF PA+AA L L F+IPKLID+GII+N+G   +N+   Q AP M
Sbjct  120  IGWALEIAVKMKTKVVAFWPASAAVLALKFSIPKLIDEGIIDNDGTILKNQVIIQLAPNM  179

Query  598  PFM  606
            P M
Sbjct  180  PTM  182



>ref|XP_006432638.1| hypothetical protein CICLE_v10000944mg [Citrus clementina]
 gb|ESR45878.1| hypothetical protein CICLE_v10000944mg [Citrus clementina]
Length=454

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH+LV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L++
Sbjct  1    MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYYHKRVVESLQGKNY-LEE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL E   ++MPGK+EKLI  IN+   E  I C IAD ++
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEK-IDCFIADGNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW+LE+AKK+ V+ A F  ++AA + L F IPKLIDDGII++ G P   + F+ AP MP 
Sbjct  118  GWSLEVAKKMNVRGAVFWSSSAALVALVFCIPKLIDDGIIDSHGTPMSMQMFRIAPKMPE  177

Query  604  MNT  612
            MN+
Sbjct  178  MNS  180



>ref|XP_006471446.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471447.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Citrus 
sinensis]
Length=454

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH+LV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L++
Sbjct  1    MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYYHKRVVESLQGKNY-LEE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL E   ++MPGK+EKLI  IN+   E  I C IAD ++
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEK-IDCFIADGNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW+LE+AKK+ V+ A F  ++AA + L F IPKLIDDGII++ G P   + F+ AP MP 
Sbjct  118  GWSLEVAKKMNVRGAVFWSSSAALVALVFCIPKLIDDGIIDSHGTPMSMQMFRIAPKMPE  177

Query  604  MNT  612
            MN+
Sbjct  178  MNS  180



>ref|XP_010463598.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Camelina sativa]
Length=463

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 138/190 (73%), Gaps = 8/190 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS---SALNNVA  234
            M  PH++VIPYP Q HV+PLM  ++ LA+ G I ITFV T+  H++I++S   S+ ++  
Sbjct  1    MVRPHVVVIPYPTQSHVLPLMSFSRYLAKQG-IQITFVNTEFNHNRIISSLPKSSHDDYF  59

Query  235  LDDGIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLI-RGINASS--SESHITC  402
            + +GI+LVS+ D  E S E  N+PGKL E++   MP KVE+LI R I  SS  + + I+C
Sbjct  60   VGNGINLVSIPDGLEDSPEERNIPGKLSESVLHFMPTKVEELIERMITGSSGGTGTIISC  119

Query  403  VIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQ  582
            V+ADQSLGWA+E+A K G++ AAF PAAAA++VLGF+I KLIDDG+I+++G P+ +KT Q
Sbjct  120  VVADQSLGWAIEVAVKFGIRRAAFCPAAAASMVLGFSIKKLIDDGLIDSDGTPSVDKTIQ  179

Query  583  FAPTMPFMNT  612
             +P MP M T
Sbjct  180  LSPGMPMMET  189



>gb|KDO37511.1| hypothetical protein CISIN_1g044384mg [Citrus sinensis]
Length=322

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 120/183 (66%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH+LV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L++
Sbjct  1    MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYYHKRVVESLQGKNY-LEE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL E   ++MP K+E+LI  IN+   E  I C IAD ++
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLIEKFLQVMPRKLEELIEEINSREDEK-IDCFIADGNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW+LE+AKK+ V+   F  ++AA++ L F IPKLIDDGII++ G P   + F  AP MP 
Sbjct  118  GWSLEVAKKMNVRGGVFWSSSAASVALVFRIPKLIDDGIIDSHGTPMSMQMFLIAPNMPE  177

Query  604  MNT  612
            MN+
Sbjct  178  MNS  180



>ref|XP_003554912.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=454

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 126/183 (69%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH++V+PYPAQGHVIPLMEL+  L + G I ITFV T+  H +I+++    N  L  
Sbjct  1    MARPHVMVVPYPAQGHVIPLMELSLLLIKQG-IKITFVNTKDNHERIMSALPSGN-DLSS  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LV + D  ES+E    PGK  E +  +MP KVE+LI  IN S S+  ITCV+ADQS+
Sbjct  59   QISLVWISDGLESSEERKKPGKSSETVLNVMPQKVEELIECINGSESKK-ITCVLADQSI  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW L++A+K G++ AAF PA+AA LVLG +IPKLID GII+ +G P + +  Q +PTMP 
Sbjct  118  GWLLDIAEKKGIRRAAFCPASAAQLVLGLSIPKLIDRGIIDKDGTPTKKQVIQLSPTMPS  177

Query  604  MNT  612
            ++T
Sbjct  178  VST  180



>ref|XP_008230871.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Prunus mume]
Length=454

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M N HI+ +P+PAQGHVIPLMEL+QCL  HG   +TFV T   H +++N+ A +     D
Sbjct  1    MSNTHIIAVPFPAQGHVIPLMELSQCLVNHG-FTVTFVNTDYNHKRVVNALA-DESHFTD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  G+L EAI ++MPGK+E+LI  IN    +  +TCVIAD+S 
Sbjct  59   RIHLVSLPDGLEPWEDRNELGQLCEAIQRVMPGKLEELIEKINEGKGDK-VTCVIADESS  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+KL ++  AF PAAAA L L F+IPKLI +GIIN++G    ++  Q AP MP 
Sbjct  118  GWALEVAEKLNIRRVAFWPAAAALLALQFSIPKLIHEGIINDDGTVPRSQIMQLAPNMPT  177

Query  604  MNTS  615
            M T+
Sbjct  178  MKTA  181



>ref|XP_007151308.1| hypothetical protein PHAVU_004G035300g [Phaseolus vulgaris]
 gb|ESW23302.1| hypothetical protein PHAVU_004G035300g [Phaseolus vulgaris]
Length=451

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 126/183 (69%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH++V+PYP QGHVIPLMEL+  L + G I ITFV T+  H +I ++    +  L  
Sbjct  1    MARPHVMVVPYPEQGHVIPLMELSLLLVKQG-IKITFVNTKENHDRIKSALPCGDGLLSQ  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LV + D  ES+E    PGK   A+ K+MP KVE+LI  IN S SE  ITCV+ADQS+
Sbjct  60   -MSLVWISDGLESSEERKKPGKSSGAVLKVMPEKVEELIECINGSESE-RITCVLADQSI  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWAL++A+K G++ AAF PA+AA LVLG +IPKLID+GII+ +G P E +  Q +P MP 
Sbjct  118  GWALDIAEKKGIRRAAFCPASAAQLVLGLSIPKLIDNGIIDKDGTPLEKQVIQLSPAMPS  177

Query  604  MNT  612
            ++T
Sbjct  178  VST  180



>ref|XP_008365515.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=165

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M +PHILVIP PAQGHVIP+MEL+QCL  HG   +TFV T   H+++ NSS  +   +  
Sbjct  1    MXSPHILVIPAPAQGHVIPMMELSQCLVNHG-FKVTFVNTDFNHNRVTNSSGDDQSHIRR  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  +  N  GKL EA  ++MPGK+E+LI  IN       ITCVIADQ+
Sbjct  60   DCIDLVSIXDGLEPGQDRNDLGKLSEAARRVMPGKLEELIEKINNRGEGDKITCVIADQT  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            +GWALE+A K+  +  AF PA+AA L L F+IPKLID+GII+N+G
Sbjct  120  IGWALEIAVKMKTKVVAFWPASAAVLALKFSIPKLIDEGIIDNDG  164



>gb|KDO58821.1| hypothetical protein CISIN_1g009851mg [Citrus sinensis]
Length=466

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L +
Sbjct  1    MSRPRVLVMPAPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYNHKRVVESLQGKNY-LGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  GKL E   ++MPGK+E+LI  IN+   E  I C IAD ++
Sbjct  59   QIHLVSIPDGMEPWEDRNDLGKLIEKCLQVMPGKLEELIEEINSREDEK-IDCFIADGNI  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW++E+AKK+ V+ A F P++AA++ L F IPKLIDDGII++ G P   + F+ AP MP 
Sbjct  118  GWSMEIAKKMNVRGAVFWPSSAASVALVFRIPKLIDDGIIDSHGTPMSMQMFRIAPKMPE  177

Query  604  MNT  612
            MN+
Sbjct  178  MNS  180



>ref|XP_006432636.1| hypothetical protein CICLE_v10001071mg [Citrus clementina]
 ref|XP_006471444.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471445.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Citrus 
sinensis]
 gb|ESR45876.1| hypothetical protein CICLE_v10001071mg [Citrus clementina]
Length=466

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 121/183 (66%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH+LV+P PAQGHVIPL+E +QCLA+HG   +TFV T+  H +++ S    N  L +
Sbjct  1    MSRPHVLVMPAPAQGHVIPLLEFSQCLAKHG-FRVTFVNTEYDHKRVVESLEGKNY-LAE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL E   ++MPGK+EKLI  IN+   E  I C IAD + 
Sbjct  59   QIRLVSIPDGMEPWEDRNDLGKLIEKCLQVMPGKLEKLIEEINSREDEK-IDCFIADGNT  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW++E+AKK+ V+ A F P++AA++   F IPKLIDDGII++ G P   + F+ AP MP 
Sbjct  118  GWSMEVAKKMNVRGAVFWPSSAASVAFVFRIPKLIDDGIIDSHGTPMSMQMFRIAPKMPE  177

Query  604  MNT  612
            MN+
Sbjct  178  MNS  180



>ref|XP_007216366.1| hypothetical protein PRUPE_ppa019116mg [Prunus persica]
 gb|EMJ17565.1| hypothetical protein PRUPE_ppa019116mg [Prunus persica]
Length=454

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M N HI+ +P+PAQGHVIPLMEL+QCL  HG   +TFV T+  H +++N+ A +     D
Sbjct  1    MSNTHIIAVPFPAQGHVIPLMELSQCLVNHG-FTVTFVNTEYNHKRVVNALA-DESQFTD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  G+L EAI ++MPGK+E+LI  IN    +  +TCVIAD+S 
Sbjct  59   RIHLVSLPDGLEPWEDRNELGQLCEAIQRVMPGKLEELIEKINEGKGDK-VTCVIADESS  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K  ++  AF PAAAA L L F+IPKLI +GIIN++G    ++  Q AP MP 
Sbjct  118  GWALEVAEKQNIRRVAFWPAAAALLALQFSIPKLIHEGIINDDGTVPRSQIMQLAPNMPT  177

Query  604  MNTS  615
            M T+
Sbjct  178  MKTA  181



>ref|XP_006432642.1| hypothetical protein CICLE_v10000928mg [Citrus clementina]
 ref|XP_006471449.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Citrus 
sinensis]
 gb|ESR45882.1| hypothetical protein CICLE_v10000928mg [Citrus clementina]
Length=462

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH+LV+P PAQGHVIPL+E +QCLA+ G   +TFV T   H +I+ S    N  L +
Sbjct  1    MNRPHVLVLPIPAQGHVIPLLEFSQCLAKQG-FRVTFVNTDYDHKRIMESLEGKN-DLGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKLFE + ++MPGK+E+LI  IN+   E  + C IAD  +
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLFEKVLQVMPGKLEELIEDINSREDEK-LDCFIADGYM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             W++E+AKK+ V+ A F P++AA++ L F+IPKLIDDGII++ G P   + F+ AP MP 
Sbjct  118  AWSMEVAKKMNVRGALFWPSSAASVALLFHIPKLIDDGIIDSNGTPMSKQMFRIAPNMPE  177

Query  604  MNT  612
            MN+
Sbjct  178  MNS  180



>ref|XP_006432640.1| hypothetical protein CICLE_v10000928mg [Citrus clementina]
 ref|XP_006471448.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Citrus 
sinensis]
 gb|ESR45880.1| hypothetical protein CICLE_v10000928mg [Citrus clementina]
Length=466

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH+LV+P PAQGHVIPL+E +QCLA+ G   +TFV T   H +I+ S    N  L +
Sbjct  1    MNRPHVLVLPIPAQGHVIPLLEFSQCLAKQG-FRVTFVNTDYDHKRIMESLEGKN-DLGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKLFE + ++MPGK+E+LI  IN+   E  + C IAD  +
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLFEKVLQVMPGKLEELIEDINSREDEK-LDCFIADGYM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             W++E+AKK+ V+ A F P++AA++ L F+IPKLIDDGII++ G P   + F+ AP MP 
Sbjct  118  AWSMEVAKKMNVRGALFWPSSAASVALLFHIPKLIDDGIIDSNGTPMSKQMFRIAPNMPE  177

Query  604  MNT  612
            MN+
Sbjct  178  MNS  180



>ref|XP_009365945.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=477

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 120/184 (65%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M +PHILVIP PAQGHVIP+MEL+QCL  HG   +TFV T   H+++ N    +   +  
Sbjct  1    MSSPHILVIPAPAQGHVIPMMELSQCLVNHG-FKVTFVNTDFNHNRVTNYLGDDQSHIRR  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  +  N  GKL EA  ++MPGK+E+LI  IN       ITCVIADQ+
Sbjct  60   DCIDLVSIPDGLEPGQDRNDLGKLSEAARRVMPGKLEELIEKINNRGEGDKITCVIADQT  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+A K+  +  AF PA+AA L   F+IPKLID+GII+N+G   +N+    AP MP
Sbjct  120  VGWALEIAVKMKTKVLAFWPASAAVLASKFSIPKLIDEGIIDNDGTILKNQVIHLAPNMP  179

Query  601  FMNT  612
             M T
Sbjct  180  TMKT  183



>ref|XP_006297658.1| hypothetical protein CARUB_v10013680mg [Capsella rubella]
 gb|EOA30556.1| hypothetical protein CARUB_v10013680mg [Capsella rubella]
Length=454

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 130/184 (71%), Gaps = 5/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG  H++VIPYPAQGHV+PL+  +  LA+ G I  TFV T+  H+ I+NS + N+  + D
Sbjct  1    MGRAHVVVIPYPAQGHVLPLLSFSGYLAKQG-ILTTFVNTEFNHNCIINSLS-NSSHVAD  58

Query  244  GIHLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            GI+LVSV D  E S E  N+PGKL E++ + MP KVE+LI  + A  +   I+CV+ADQS
Sbjct  59   GINLVSVSDGLEDSPEERNIPGKLSESVLRFMPTKVEELIERMIAGGT--IISCVVADQS  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            LGWA+ +A K G++ A F PAAAA++VLGF+I KLIDDG+I+ +G  + NKT Q +P MP
Sbjct  117  LGWAIGVAVKFGIRRATFCPAAAASMVLGFSIQKLIDDGLIDTDGTSSVNKTIQLSPGMP  176

Query  601  FMNT  612
             M T
Sbjct  177  MMET  180



>ref|XP_009365863.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=455

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 125/185 (68%), Gaps = 2/185 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M  PHILV+P PAQGHVIP+MEL+Q L  HG   +TFV T   H++++++   +   +  
Sbjct  1    MSGPHILVLPAPAQGHVIPMMELSQSLVDHG-FKVTFVNTDFNHNRVMSALPDDQSHIRG  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  +  N  GKL EA+ ++MPGK+E+LI  IN       ITCVIADQ+
Sbjct  60   DCIDLVSIPDGLEQGQDRNDLGKLSEAMQRVMPGKLEELIEKINNRGEGDKITCVIADQA  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GW LE+A K+ ++ AAF PA+AA L L F++PKLID+GII+N+G   +N+  Q AP MP
Sbjct  120  IGWVLEIAVKMKIKAAAFWPASAAVLALTFSVPKLIDEGIIDNDGTILKNRVIQLAPNMP  179

Query  601  FMNTS  615
             M T+
Sbjct  180  TMKTA  184



>ref|XP_009365862.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=470

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M +PHILVIP PAQGHVIP+MEL+QCL  HG   +TFV T   ++++ N    +   +  
Sbjct  1    MSSPHILVIPAPAQGHVIPMMELSQCLVNHG-FKVTFVNTDFNNNRVTNYLGDDQSHIRR  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  +  N  GKL EA  ++MPGK+E+LI  IN       ITCVIADQ+
Sbjct  60   DCIDLVSIPDGLEPGQDRNDLGKLSEAARRVMPGKLEELIEKINNRGEGDKITCVIADQT  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+A K+  +  AF PA+AA L   F+IPKLID+GII+N+G   +N+  Q AP MP
Sbjct  120  VGWALEIAVKMKTKVLAFWPASAAVLASKFSIPKLIDEGIIDNDGTILKNQVIQLAPNMP  179

Query  601  FMNT  612
             M T
Sbjct  180  TMKT  183



>gb|EYU44186.1| hypothetical protein MIMGU_mgv1a024777mg [Erythranthe guttata]
Length=455

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 124/184 (67%), Gaps = 5/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            M  PH+L IPYPAQGHVIPLMELAQCLA + GI +TFV T   H +IL + S   N+  +
Sbjct  1    MARPHVLAIPYPAQGHVIPLMELAQCLA-NNGIKVTFVNTDFNHERILKALSHTENI--N  57

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            + I+L S+ D    NE  N  GKL +A+ ++MP K+E LI  INA+ S+  I CVI D  
Sbjct  58   ELINLASIPDGLAPNEDRNDLGKLTDAMMRVMPEKLEALIESINATESDK-IICVITDYG  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            LGWAL+LA KLG++ AAF+PA+   L L  N+ KL+D+GII++ G P + +  Q +P MP
Sbjct  117  LGWALDLANKLGIKRAAFVPASVGLLALAINVLKLVDEGIIDSNGTPVKQQVIQLSPDMP  176

Query  601  FMNT  612
             M+T
Sbjct  177  AMST  180



>ref|XP_002276825.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
Length=453

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGNPH++VIP+PAQGHVIPLME + CL  HG   +TF+ T+  H++++N+    +  + D
Sbjct  1    MGNPHVVVIPWPAQGHVIPLMEFSLCLVEHG-CRVTFINTEFNHNRVMNAFTERHT-IGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LVSV    E +E    P KL E I + MP KVE+L+  IN+   +  ITCV++DQS+
Sbjct  59   QLRLVSV-PGLEFHEDKERPAKLTEGIWQFMPQKVEELMEEINSVDGDG-ITCVVSDQSI  116

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW LE+A K+G+  AAF PA+A  L LG ++PKLI+DG+IN +GIP E++  Q +PT P 
Sbjct  117  GWGLEIAAKMGIPQAAFFPASALVLALGQSVPKLIEDGVINCDGIPIEHQMIQLSPTAPA  176

Query  604  MNT  612
            +NT
Sbjct  177  INT  179



>ref|XP_006432643.1| hypothetical protein CICLE_v10001095mg [Citrus clementina]
 ref|XP_006471450.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471451.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Citrus 
sinensis]
 gb|ESR45883.1| hypothetical protein CICLE_v10001095mg [Citrus clementina]
Length=458

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 120/183 (66%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHILV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L +
Sbjct  1    MSRPHILVMPAPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYDHKRVVESLEGKN-DLGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  GKL E   ++MPGK+ +LI  IN+   E  + C IAD  +
Sbjct  59   QIHLVSIPDGMEPWEDRNDLGKLTEKFLQVMPGKLAELIEEINSREDEK-LDCFIADGYM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             W++E+AKK+ V+ A F P++AA++ L F+IPKLIDDGII++ G P   + F+ AP MP 
Sbjct  118  AWSMEVAKKMNVRGALFWPSSAASVALLFHIPKLIDDGIIDSHGTPMSKQMFRIAPNMPE  177

Query  604  MNT  612
            MN 
Sbjct  178  MNA  180



>ref|XP_004306079.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Fragaria vesca 
subsp. vesca]
Length=453

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 124/185 (67%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHI+ IP PAQGHV+PLME +QCLA HG   +TFV T+T H +I+N+ A  N    D
Sbjct  1    MSKPHIIAIPLPAQGHVMPLMEFSQCLAHHG-FRVTFVNTETIHKKIVNAMANENHIRHD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVS+ D  E+ E  N PG L EAI  ++   +E++I  IN    E  ITC+IAD+S 
Sbjct  60   HVHLVSIPDGLETEEDRNGPGVLSEAIQAVLHQNLEEIIEKINKEEDEK-ITCLIADESC  118

Query  424  GWALELAKKLG-VQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            GWALE+A+K+  V+ AAF PAAAA LVL F IP L+ +GII++EG   +++  Q AP MP
Sbjct  119  GWALEVAQKMKIVKVAAFWPAAAATLVLNFCIPNLVHEGIIDDEGTVLKSQMVQLAPKMP  178

Query  601  FMNTS  615
             + ++
Sbjct  179  MIKSA  183



>ref|XP_007032721.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY03647.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=454

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 125/182 (69%), Gaps = 5/182 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGNPHILVIPYPAQGHVIPLMEL+Q LA+H G  ++FV T+  H +++++ A   V  D+
Sbjct  1    MGNPHILVIPYPAQGHVIPLMELSQNLAKH-GFKVSFVNTEFNHKRVMDAFA-KKVDADE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LVS+ D  E  ES N  GKL E+I ++MP ++++LI   N    E  ITCV+AD ++
Sbjct  59   LVQLVSIPDGMEDGESRNQLGKLTESICQVMPKELKQLIEKTN--RLEDKITCVVADVNM  116

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAE-NKTFQFAPTMP  600
            GWALE+A +LG+  AAF P +A  L L F++ KL+DDG+I+  G P + +K  Q +PT P
Sbjct  117  GWALEVAAELGIHGAAFWPGSALLLALTFSLQKLMDDGVIDANGTPIDKDKVIQLSPTTP  176

Query  601  FM  606
             M
Sbjct  177  GM  178



>ref|XP_008365422.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=456

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVAL-D  240
            M +PHIL IP PAQGHVIP+M L+QCL  HG   +TFV T   H+++ N+       +  
Sbjct  1    MSSPHILAIPVPAQGHVIPMMALSQCLVNHG-FKVTFVNTDFNHNRVANALPDGQSHMTK  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  E     G L EA+ ++MPGK+E+LI  IN    E  ITCVIADQ 
Sbjct  60   DRIDLVSIPDGLEPGEDRRDLGLLTEAMRRVMPGKLEELIEKINGGDXEK-ITCVIADQG  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+A K+ ++  AF  A+AA L L  NIPKLID+GII+N+G   +++  Q AP MP
Sbjct  119  IGWALEVAAKMKIKAVAFWTASAAVLALKLNIPKLIDEGIIDNDGTVLKSQAIQLAPNMP  178

Query  601  FMNTS  615
             + T+
Sbjct  179  AIKTA  183



>ref|XP_009360530.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=454

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 125/183 (68%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M N HI+ +P+PAQGHV+PLMEL+QCLA HG   +TFV T+  H +I+N+ A +   + D
Sbjct  1    MSNLHIIAVPFPAQGHVLPLMELSQCLANHG-FKVTFVNTEFNHKRIVNALA-DETHVGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  G L E + ++MPGK+E+LI  IN   S+  + CV+AD+S 
Sbjct  59   RIHLVSLPDGLEPGEDRNDLGLLCEGMQRVMPGKLEELIEKINEEESDK-VACVLADESS  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+ ++  AF PA+AA L L FNIPKLI +GII+++G P +++  + A  +P 
Sbjct  118  GWALEVAAKMKIRRVAFWPASAAALALSFNIPKLIHEGIIDDDGTPLKSQEIELAKNLPK  177

Query  604  MNT  612
            M T
Sbjct  178  MKT  180



>ref|XP_009365943.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=456

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNV-ALD  240
            M +PHIL +P PAQGHVIP+M L+QCL  HG   +TFV T   H+++ N+   +    + 
Sbjct  1    MSSPHILAVPVPAQGHVIPMMALSQCLVNHG-FKVTFVNTDFNHNRVANALPDDQSHMMK  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  E     G L EA+ ++MPGK+E+LI  IN    E  ITCVIADQ 
Sbjct  60   DRIDLVSIPDGLEPGEDRKDLGLLTEAMRRVMPGKLEELIEKINGGDGEK-ITCVIADQG  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+A K+ ++  AF PA+AA L L F IPKLID+GII+N+G   +    Q AP MP
Sbjct  119  IGWALEVAAKMKIKAVAFWPASAAVLALKFAIPKLIDEGIIDNDGTVLKTPAIQLAPNMP  178

Query  601  FMNTS  615
             + T+
Sbjct  179  AIKTA  183



>ref|XP_009365864.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=456

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNV-ALD  240
            M +PHIL +P PAQGHVIP+M L+QCL  HG   +TFV T   H+++ N+   +    + 
Sbjct  1    MSSPHILAVPVPAQGHVIPMMALSQCLVNHG-FKVTFVNTDFNHNRVANALPDDQSHMMK  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  E     G L EA+ ++MPGK+E+LI  IN    E  ITCVIADQ 
Sbjct  60   DRIDLVSIPDGLEPGEDRKDLGLLTEAMRRVMPGKLEELIEKINGGDGEK-ITCVIADQG  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+A K+ ++  AF PA+AA L L F IPKLID+GII+N+G   +    Q AP MP
Sbjct  119  IGWALEVAAKMKIKAVAFWPASAAVLALKFAIPKLIDEGIIDNDGTVLKTPAIQLAPNMP  178

Query  601  FMNTS  615
             + T+
Sbjct  179  AIKTA  183



>ref|XP_009365944.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=456

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 124/187 (66%), Gaps = 6/187 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA---  234
            M  PHILV+P PAQGHVIP+MEL+Q L  HG   +TFV T   H+++  +SAL +     
Sbjct  1    MSGPHILVLPAPAQGHVIPMMELSQSLVNHG-FKVTFVNTDFNHNRV--TSALPDDQGHI  57

Query  235  LDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
              D I LVS+ D  E  +  N  GKL EA+ ++MPGK+E+LI  IN       I CVIAD
Sbjct  58   RGDCIDLVSIPDGLEPGQDRNDLGKLSEAMQRVMPGKLEELIEKINNRGEGDKIICVIAD  117

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
            Q++GW LE+A K+ ++ AAF PA+AA L L F++PKLID+GI++N+G   +N+  Q AP 
Sbjct  118  QAIGWVLEIAVKMKIKAAAFWPASAAVLALTFSVPKLIDEGIVDNDGTILKNQVIQLAPN  177

Query  595  MPFMNTS  615
            MP M T+
Sbjct  178  MPTMKTA  184



>gb|KDP27230.1| hypothetical protein JCGZ_19929 [Jatropha curcas]
Length=457

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   HIL IPYPAQGHVIPLMEL+Q LA++G   +TFV T+  H ++LN+   N   + +
Sbjct  1    MSRVHILAIPYPAQGHVIPLMELSQRLAKYG-FKVTFVNTEYNHKRVLNALE-NKDYVRN  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL EA  K+MP K+E+L+  INAS +E  ITC+IAD S+
Sbjct  59   HISLVSIPDGLEPWEDRNDLGKLTEAFLKVMPRKLEELVDRINASETEK-ITCIIADGSM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWAL++AKK+ ++ AAF PA+AA L L   IP LIDDG+I+N G   +N+  + APTMP 
Sbjct  118  GWALQVAKKMKIRRAAFWPASAALLSLSLAIPTLIDDGVIDNNGSLLKNQMIRLAPTMPA  177

Query  604  MNTS  615
            + T+
Sbjct  178  IKTA  181



>ref|XP_008230870.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Prunus mume]
Length=455

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 120/183 (66%), Gaps = 2/183 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHI+ IPYPAQGHVIPLME +QCL  HG   +TFV T+  H +++N+ A  +    +
Sbjct  1    MSKPHIVAIPYPAQGHVIPLMEFSQCLVNHG-FKVTFVNTEHNHKRVMNALADESHISRN  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HL S+ D  E  E  +  G+L EA+  IMPGK+E+LI  IN    +  +TCVIAD++ 
Sbjct  60   QLHLASLPDGLEPWEDRSELGQLTEALKWIMPGKLEELIENINQGEGDK-VTCVIADENC  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+ ++  AF PA+AA L L F IPKLI + II+N+G   +++     P MP 
Sbjct  119  GWALEVAEKMKLKRVAFWPASAAALTLIFGIPKLIREEIIDNDGTVLKSQNVDLGPNMPT  178

Query  604  MNT  612
            MNT
Sbjct  179  MNT  181



>ref|XP_002279299.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
Length=454

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 130/182 (71%), Gaps = 6/182 (3%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALDDGI  249
            PH+L +PYPAQGHVIPL+EL+Q L + G   +TFV +   H +++N+ SA +++     I
Sbjct  5    PHVLALPYPAQGHVIPLIELSQWLVKLG-FKVTFVNSDFNHKRVVNALSAKDDIG--GQI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             LVS+ D  E+ E  N  GKL +AI ++MPGK+E+LI  IN S  E  ITCVIAD +LGW
Sbjct  62   RLVSIPDGLEAWEDRNDLGKLTKAILRVMPGKLEELIEEINGSDDE--ITCVIADGNLGW  119

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            A+ +A+K+G++ AAF PAAAA L L F++ KL+DDGI+ NEGIP +N+  + + TMP MN
Sbjct  120  AMGVAEKMGIKRAAFWPAAAALLALIFSVRKLVDDGILTNEGIPVKNQMIKLSETMPAMN  179

Query  610  TS  615
            T+
Sbjct  180  TA  181



>gb|KHN48818.1| UDP-glycosyltransferase 83A1 [Glycine soja]
Length=448

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = +1

Query  82   LVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIHLVS  261
            +V+PYPAQGHVIPLMEL+  L + G I ITFV T+  H +I+++    N  L   I LV 
Sbjct  1    MVVPYPAQGHVIPLMELSLLLIKQG-IKITFVNTKDNHERIMSALPSGN-DLSSQISLVW  58

Query  262  VLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWALEL  441
            + D  ES+E    PGK  E +  +MP KVE+LI  IN S S+  ITCV+ADQS+GW L++
Sbjct  59   ISDGLESSEERKKPGKSSETVLNVMPQKVEELIECINGSESKK-ITCVLADQSIGWLLDI  117

Query  442  AKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            A+K G++ AAF PA+AA LVLG +IPKLID GII+ +G P + +  Q +PTMP ++T
Sbjct  118  AEKKGIRRAAFCPASAAQLVLGLSIPKLIDRGIIDKDGTPTKKQVIQLSPTMPSVST  174



>gb|AFO67245.1| putative UDP-glucosyltransferase 83A, partial [Aralia elata]
Length=162

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH L +P+PAQGHVIPLMEL Q   + G   +TFV T   H +++N+    +  + D IH
Sbjct  4    PHALAVPFPAQGHVIPLMELVQHFVKKG-FKVTFVNTDFNHKRVMNALLEKDRNVGDMIH  62

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            +VS+ D  +  E  N  GKL +AIS++MP K+EKLI+ INA+ + + ITC++AD+++GWA
Sbjct  63   MVSLPDGFDPGEDRNDMGKLSKAISRVMPQKLEKLIKNINATDN-NKITCLVADENMGWA  121

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            L++A+K+G++  AF PA+AA L   F+IPKLI+DGIINN+G
Sbjct  122  LKVAEKMGIRRVAFWPASAAQLGSIFSIPKLIEDGIINNDG  162



>dbj|BAD18098.1| putative UDP-glucosyl transferase [Ipomoea batatas]
Length=165

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 116/171 (68%), Gaps = 6/171 (4%)
 Frame = +1

Query  88   IPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIHLVSVL  267
            IPYPAQGHVIPLMEL  CL +HG   +TFV ++  H++I+ S +      D+ I+LVSV 
Sbjct  1    IPYPAQGHVIPLMELCHCLVKHG-CKVTFVNSEFNHNRIIQSMS----EADNVINLVSVP  55

Query  268  DASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWALELAK  447
            D     E  N   KL EA+ +++PGK+E LI  IN  S E+ ++C+IAD++LGWAL+LA 
Sbjct  56   DGLAVEEDRNDLKKLTEALFEVVPGKLEALIHNIN-ESDENRVSCLIADENLGWALDLAN  114

Query  448  KLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            KLG+QT AF PAA A++ + FN+PKL+DDGI+ N G     ++ +  P MP
Sbjct  115  KLGLQTVAFWPAAVASITMVFNVPKLVDDGIVGNNGEILRKQSIKLLPLMP  165



>ref|XP_004306080.2| PREDICTED: UDP-glycosyltransferase 83A1-like [Fragaria vesca 
subsp. vesca]
Length=464

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 120/186 (65%), Gaps = 3/186 (2%)
 Frame = +1

Query  61   RMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD  240
            +M  PHI+ IPYPAQGHVIPLMEL+QCL  H G  +TFV T+  H +++N+    +   +
Sbjct  2    KMSKPHIVAIPYPAQGHVIPLMELSQCLVNH-GFKVTFVNTEFNHKRVMNARDDESHIRN  60

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I+ V + D  E  E  N  GKL EAI ++MP K+E+LI  IN    +  +TCVIAD+S
Sbjct  61   DQINQVPISDGLELWEDRNDLGKLSEAIQRVMPMKLEELIEKINQEEGDK-VTCVIADES  119

Query  421  LGWALELAKKLGVQTaaflp-aaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
             GWALE+A+K+ ++       A+AA L + F+IPK I +GII+ +G   +++  + AP M
Sbjct  120  CGWALEVARKMQIRRVVAFWPASAAALEVIFSIPKFIQEGIIHKDGAVLKSQMVELAPNM  179

Query  598  PFMNTS  615
            P M T+
Sbjct  180  PTMKTT  185



>ref|XP_007216285.1| hypothetical protein PRUPE_ppa020470mg [Prunus persica]
 gb|EMJ17484.1| hypothetical protein PRUPE_ppa020470mg [Prunus persica]
Length=455

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHI+ IPYPAQGHVIPLME +QCL  HG   +TFV T+  H +++N+ A  +    +
Sbjct  1    MSKPHIVAIPYPAQGHVIPLMEFSQCLVNHG-FKVTFVNTEHNHKRVVNALADESHISRN  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HL S+ D  E  E  +  G+L EA+  IMPGK+E+LI  IN    +  +TCVIAD++ 
Sbjct  60   QLHLASLPDGLEPWEDRSELGQLTEALKWIMPGKLEELIENINQGEGDK-VTCVIADENC  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+A+K+ ++  AF PA+AA L L F IPKLI + II+N+G   ++K     P MP 
Sbjct  119  AWALEVAEKMKLKRVAFWPASAAALTLIFGIPKLIHEEIIDNDGTVLKSKNVDLGPNMPT  178

Query  604  MNT  612
            MNT
Sbjct  179  MNT  181



>ref|XP_006422469.1| hypothetical protein CICLE_v100283952mg [Citrus clementina]
 ref|XP_006422470.1| hypothetical protein CICLE_v100283952mg [Citrus clementina]
 gb|ESR35709.1| hypothetical protein CICLE_v100283952mg [Citrus clementina]
 gb|ESR35710.1| hypothetical protein CICLE_v100283952mg [Citrus clementina]
Length=459

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 115/183 (63%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PHILV   PAQGHVIPL+E +QCLA+HG   +TFV ++  H +++ S    N  L +
Sbjct  1    MSSPHILVFSTPAQGHVIPLLEFSQCLAKHG-FRVTFVNSEYNHKRVMKSLEGKNY-LGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E    PGKL E + ++MPGK+E+LI  IN    E  I C IAD  +
Sbjct  59   QIRLVSIPDGMEPWEERTDPGKLIEKVLQVMPGKLEELIEEINGRDDEK-IDCFIADGFM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW++E+A+K+ ++ A    + AA++   F IPKLIDDGII++ G P   +  Q AP M  
Sbjct  118  GWSMEVAEKMKLKRAVIWTSCAASVASIFCIPKLIDDGIIDSNGTPIRKQMIQLAPNMLE  177

Query  604  MNT  612
            MNT
Sbjct  178  MNT  180



>ref|XP_006431284.1| hypothetical protein CICLE_v10012795mg [Citrus clementina]
 gb|ESR44524.1| hypothetical protein CICLE_v10012795mg [Citrus clementina]
Length=205

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 121/183 (66%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH++VIP P QGHVIPL+EL+Q LA+HG + ITFV ++  H+++L S    N  + +
Sbjct  1    MSSPHVVVIPNPEQGHVIPLLELSQNLAKHG-LRITFVNSEYNHNRVLESLEGKNY-IGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  +  +   KL E   ++MPGK+E LI  I+    E  I C+IAD + 
Sbjct  59   QIHLVSIPDGIEPWDDRSDMRKLLEKRLQVMPGKLEGLIEEIHGREGEK-IACLIADGAA  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWA+E+A+K+ ++ A  +  +AA + L F+IPKLI+DG+IN+ G P + +  Q AP MP 
Sbjct  118  GWAIEVAEKMKLRRAVVVITSAATVALTFSIPKLIEDGVINSNGTPIKEQMIQLAPNMPA  177

Query  604  MNT  612
            ++T
Sbjct  178  IST  180



>ref|XP_009360531.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=455

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 124/184 (67%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M N HI+ +P+PAQGHV+PLMEL+QCL  HG   +TFV T+  H +I+N+ A     + D
Sbjct  1    MSNLHIIAVPFPAQGHVLPLMELSQCLVNHG-FKVTFVNTEFNHKRIVNALA-GKTHVGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  G L E + ++MPGK+E+LI  IN   S+  +TCV+AD+S 
Sbjct  59   CIHLVSLPDGLEPGEDRNDLGLLCEGMQRVMPGKLEELIEKINEEESDK-LTCVLADESC  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WAL++A K+ ++  AF PA+AA L L FNIPKLI +GII+++G P +++  + A  +P 
Sbjct  118  WWALDVAAKMKIRQVAFWPASAAALALSFNIPKLIHEGIIDDDGTPLKSQEIELAKNLPK  177

Query  604  MNTS  615
            M T+
Sbjct  178  MKTA  181



>emb|CDP08528.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 124/183 (68%), Gaps = 5/183 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            MG+ H+L IPYPAQGHV+PLMELA CL R G I +TFV ++  H ++  S S  +NV   
Sbjct  1    MGHSHVLAIPYPAQGHVLPLMELALCLVRQG-IRVTFVNSEFDHKRVTKSLSQEDNVPA-  58

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
              + LVS+ D  ES E  N   KL  ++ ++MP  +E LI+ IN S S+  ITC+IAD++
Sbjct  59   -MMQLVSIPDGLESWEDRNDLRKLTLSVYQVMPANLECLIKSINQSDSD-KITCIIADET  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+AKK+ ++  AF PA+A+ L   F+IPKLIDDGII++ G   +N+  + +PTMP
Sbjct  117  MGWALEIAKKMRIKAVAFWPASASLLAQTFSIPKLIDDGIISSTGTVLKNQKVKLSPTMP  176

Query  601  FMN  609
             M 
Sbjct  177  EMK  179



>gb|KDO68269.1| hypothetical protein CISIN_1g012652mg [Citrus sinensis]
Length=459

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 115/183 (63%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PHILV   PAQGHVIPL+E +QCLA+HG   +TFV ++  H +++ S    N  L +
Sbjct  1    MSSPHILVFSTPAQGHVIPLLEFSQCLAKHG-FRVTFVNSEYNHKRVMKSLEGKNY-LGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E    PGKL E + ++MPGK+E+LI  IN    E  I C I+D  +
Sbjct  59   QIRLVSIPDGMEPWEERTDPGKLIEKVLQVMPGKLEELIEEINGRDDEK-IDCFISDGFM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW++E+A+K+ ++ A    + AA++   F IPKLIDDGII++ G P   +  Q AP M  
Sbjct  118  GWSMEVAEKMKLRRAVIWTSCAASVASIFCIPKLIDDGIIDSNGTPIRKQMIQLAPNMLE  177

Query  604  MNT  612
            MNT
Sbjct  178  MNT  180



>ref|XP_006478223.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Citrus sinensis]
 ref|XP_006486635.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Citrus sinensis]
Length=459

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 115/183 (63%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PHILV   PAQGHVIPL+E +QCLA+HG   +TFV ++  H +++ S    N  L +
Sbjct  1    MSSPHILVFSTPAQGHVIPLLEFSQCLAKHG-FRVTFVNSEYNHKRVMKSLEGKNY-LGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E    PGKL E + ++MPGK+E+LI  IN    E  I C I+D  +
Sbjct  59   QIRLVSIPDGMEPWEERTDPGKLIEKVLQVMPGKLEELIEEINGRDDEK-IDCFISDGFM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW++E+A+K+ ++ A    + AA++   F IPKLIDDGII++ G P   +  Q AP M  
Sbjct  118  GWSMEVAEKMKLRRAVIWTSCAASVASIFCIPKLIDDGIIDSNGTPIRKQMIQLAPNMLE  177

Query  604  MNT  612
            MNT
Sbjct  178  MNT  180



>emb|CDP05459.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 123/179 (69%), Gaps = 5/179 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            MG PH+L IPYPAQGHV+PLMELA  L ++G I +TFV T+  H +++ S S   NV   
Sbjct  1    MGIPHVLAIPYPAQGHVLPLMELALRLVKNG-IKVTFVNTEFDHKRVVESLSGEENVP--  57

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D +HLVSV D  ES E  N  GKL + I ++MP K+E L+  +N S ++  ITC+I D+S
Sbjct  58   DMMHLVSVPDGLESWEDRNDLGKLTKTIFRVMPAKLEALMEKMNESETDK-ITCLITDES  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            +GWALE+AKK+GV+  AF PAAAA L L  NIPKLIDDGII++ G   + +  Q + TM
Sbjct  117  MGWALEIAKKMGVRAVAFWPAAAALLALLLNIPKLIDDGIIDSSGTIMKKQMVQLSSTM  175



>ref|XP_010923651.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Elaeis guineensis]
Length=185

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ H ++IP P QGHVIP++  +  L  HG   ITF+ ++  H  ++ S + N      
Sbjct  1    MGSRHAIIIPCPTQGHVIPILAPSHSLVAHG-FKITFINSEFNHEHVVASLSQNGGDGVK  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI +VS LD     E  N   KL E   ++MPG++E+ I+ +N S   + +TCVIAD ++
Sbjct  60   GIQMVSFLDGLAPGEDRNDIQKLTEGYLRVMPGRLEEPIKQMNTSGG-NQVTCVIADWNM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+G+++AA  PA+AA L L  +IPK+I DGII+ +G+PA ++TFQ +P MP 
Sbjct  119  GWALEVAQKMGIRSAALWPASAAVLGLSLSIPKMIQDGIIDADGMPARSETFQLSPGMPS  178

Query  604  MNTS  615
            +NTS
Sbjct  179  VNTS  182



>ref|XP_010923595.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Elaeis guineensis]
Length=454

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 121/184 (66%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+PH ++IPYPAQGHVIPL+ L+  L  HG   ITF+ ++  H +++ S +     ++ 
Sbjct  1    MGSPHAIIIPYPAQGHVIPLLALSHSLVAHG-FKITFINSEFNHDRVVASLSKGGDGVE-  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GIH+VS  D     E  N   KL E   ++MP  +E+LI  +N S  +  +TCVIAD ++
Sbjct  59   GIHMVSFPDGLAPGEDRNDLRKLTEGFVRVMPRCLEELIERMNTSGGD-RVTCVIADGNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+G+++AAF PA+ A L L  NIP LI DGII+  G+P  ++TFQ +P MP 
Sbjct  118  GWALEVAQKMGIRSAAFWPASTAVLALFLNIPNLIQDGIIDANGMPERSETFQLSPGMPP  177

Query  604  MNTS  615
             NTS
Sbjct  178  WNTS  181



>ref|XP_008341646.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=455

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 123/185 (66%), Gaps = 4/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M N HI+ +P+PAQGHV+PLMEL+QCL  H G  +TFV T+  H +I+N+ A     + D
Sbjct  1    MSNLHIIAVPFPAQGHVLPLMELSQCLVNH-GFKVTFVNTEFNHKRIVNALA-GETHVGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  G L E I ++MPGK+E+LI  IN   SE  + CV+AD++ 
Sbjct  59   RIHLVSLPDGLEPKEDRNDLGLLCEGIQRVMPGKLEELIEKINEEESEK-VACVLADENS  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGII-NNEGIPAENKTFQFAPTMP  600
            GWAL++A K+ ++  AF PA+AA L L FNIPKLI +GII N++G P +++  + A   P
Sbjct  118  GWALDVAAKMKIRRVAFWPASAAALALSFNIPKLIHEGIIDNDDGTPLKSQEIELAKNQP  177

Query  601  FMNTS  615
             M T+
Sbjct  178  KMKTA  182



>gb|KDO35902.1| hypothetical protein CISIN_1g040291mg, partial [Citrus sinensis]
Length=160

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 110/162 (68%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH+LV+P PAQGHVIPL+E +QCLA+  G  +TFV T   H +I+ S    N  L +
Sbjct  1    MNRPHVLVLPIPAQGHVIPLLEFSQCLAKQ-GFRVTFVNTDYDHKRIMESLEGKN-DLGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKLFE + ++MPGK+E+LI  IN+   E  + C IAD  +
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLFEKVLQVMPGKLEELIEDINSREDEK-LDCFIADGYM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINN  549
             W++E+AKK+ V+ A F P++AA++ L F+IPKLIDDGII++
Sbjct  118  AWSMEVAKKMNVRGALFWPSSAASVALLFHIPKLIDDGIIDS  159



>ref|XP_004981711.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Setaria 
italica]
Length=459

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 118/186 (63%), Gaps = 4/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M  PH+L +P+PAQGH+IPLM+L+  L  HG I +TFV T+  H+ +L++ A N      
Sbjct  1    MAAPHVLALPFPAQGHIIPLMQLSHRLVEHG-IEVTFVNTEANHTLVLDAMAANGAGCPS  59

Query  241  -DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
             DGI LV V D     +     GKL +A+S+ MP  +E+L+  I AS   + I+ ++AD+
Sbjct  60   LDGIRLVGVPDGLADGDDRKDLGKLVDALSQHMPCYLEELVGRIEASGG-TKISWLVADE  118

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
             +GWA E+AKKLG++ A F   +AA L     IP+LI DG+I+ +G P   +TFQFAP M
Sbjct  119  GMGWAFEVAKKLGIRAACFWTGSAAFLASMLRIPQLIQDGVIDEKGWPKRQETFQFAPGM  178

Query  598  PFMNTS  615
            P ++TS
Sbjct  179  PPLHTS  184



>gb|KDO72750.1| hypothetical protein CISIN_1g044266mg [Citrus sinensis]
Length=462

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            +  PH+L  PYPAQGHVIPL+E++QCL +HG + +TF+ T   H +++N+   NN  + D
Sbjct  2    LRRPHVLAFPYPAQGHVIPLLEISQCLVKHG-VKVTFLNTDYNHKRVVNALGQNNY-IGD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E     N  G L + + ++MP K+E+LI  IN   +E  ITCV+AD S+
Sbjct  60   QIKLVSIPDGMEPEGDRNDLGMLTKTMVRVMPEKLEELIENINRLENEK-ITCVVADGSM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW +E+A+K+ ++ AAF PAAA  L L F++ + +DDGI+++ G P + +  Q APTM  
Sbjct  119  GWVMEVAEKMKLRRAAFWPAAAGLLALSFSVQRFLDDGIVDDNGTPVKQQMIQLAPTMAA  178

Query  604  MNTS  615
            +++S
Sbjct  179  IHSS  182



>ref|XP_004981712.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Setaria 
italica]
Length=458

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 118/186 (63%), Gaps = 4/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M  PH+L +P+PAQGH+IPLM+L+  L  HG I +TFV T+  H+ +L++ A N      
Sbjct  1    MAAPHVLALPFPAQGHIIPLMQLSHRLVEHG-IEVTFVNTEANHTLVLDAMAANGAGCPS  59

Query  241  -DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
             DGI LV V D     +     GKL +A+S+ MP  +E+L+  I AS   + I+ ++AD+
Sbjct  60   LDGIRLVGVPDGLADGDDRKDLGKLVDALSQHMPCYLEELVGRIEASGG-TKISWLVADE  118

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
             +GWA E+AKKLG++ A F   +AA L     IP+LI DG+I+ +G P   +TFQFAP M
Sbjct  119  GMGWAFEVAKKLGIRAACFWTGSAAFLASMLRIPQLIQDGVIDEKGWPKRQETFQFAPGM  178

Query  598  PFMNTS  615
            P ++TS
Sbjct  179  PPLHTS  184



>emb|CDP08526.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 122/181 (67%), Gaps = 5/181 (3%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALDDG  246
            NPH+L IPYPAQGHV+PLMELA CL R G I +TFV ++  H ++  S S  +NV     
Sbjct  5    NPHVLAIPYPAQGHVLPLMELALCLVRQG-IRVTFVNSEFDHKRVTKSLSQEDNVPA--M  61

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
            + LVS+ D  ES E  N   KL  ++ ++MP  +E LI+ IN S S+  ITC+IAD+++G
Sbjct  62   MQLVSIPDGLESWEDRNDLIKLTLSVYQVMPANLECLIKSINQSDSD-KITCIIADETMG  120

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            WALE+AKK+ ++   F PA+A+ L   F+IPKL+DDGII++ G   +N+  + +PTMP M
Sbjct  121  WALEIAKKMRIKAVDFWPASASVLAQIFSIPKLMDDGIISSTGTVLKNQMVKLSPTMPEM  180

Query  607  N  609
             
Sbjct  181  K  181



>ref|XP_006431283.1| hypothetical protein CICLE_v10013686mg [Citrus clementina]
 gb|ESR44523.1| hypothetical protein CICLE_v10013686mg [Citrus clementina]
Length=462

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            +  PH+L  PYPAQGHVIPL+E++QCL +HG + +TF+ T   H +++N+   NN  + D
Sbjct  2    LRRPHVLAFPYPAQGHVIPLLEISQCLVKHG-VKVTFLNTDYNHKRVVNALGQNNY-IGD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E     N  G L + + ++MP K+E+LI  IN   +E  ITCV+AD S+
Sbjct  60   QIKLVSIPDGMEPEGDRNDLGMLTKTMVRVMPEKLEELIENINRLENEK-ITCVVADGSM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW +E+A+K+ ++ AAF PAAA  L L F++ + +DDGI+++ G P + +  Q APTM  
Sbjct  119  GWVMEVAEKMKLRRAAFWPAAAGLLALSFSVQRFLDDGIVDDNGTPVKQQMIQLAPTMAA  178

Query  604  MNTS  615
            +++S
Sbjct  179  IHSS  182



>ref|XP_006482788.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Citrus sinensis]
Length=462

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            +  PH+L  PYPAQGHVIPL+E++QCL +HG + +TF+ T   H +++N+   NN  + D
Sbjct  2    LRRPHVLAFPYPAQGHVIPLLEISQCLVKHG-VKVTFLNTDYNHKRVVNALGQNNY-IGD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E     N  G L + + ++MP K+E+LI  IN   +E  ITCV+AD S+
Sbjct  60   QIKLVSIPDGMEPEGDRNDLGMLTKTMVRVMPEKLEELIENINRLENEK-ITCVVADGSM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW +E+A+K+ ++ AAF PAAA  L L F++ + +DDGI+++ G P + +  Q APTM  
Sbjct  119  GWVMEVAEKMKLRRAAFWPAAAGLLALSFSVQRFLDDGIVDDNGTPVKQQMIQLAPTMAA  178

Query  604  MNTS  615
            +++S
Sbjct  179  IHSS  182



>ref|XP_006432637.1| hypothetical protein CICLE_v10000944mg [Citrus clementina]
 gb|ESR45877.1| hypothetical protein CICLE_v10000944mg [Citrus clementina]
Length=494

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 115/177 (65%), Gaps = 3/177 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH+LV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L++
Sbjct  1    MSSPHVLVMPGPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYYHKRVVESLQGKNY-LEE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL E   ++MPGK+EKLI  IN+   E  I C IAD ++
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEK-IDCFIADGNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
            GW+LE+AKK+ V+ A F  ++AA + L F IPKLIDDGII++ GI   +    F P 
Sbjct  118  GWSLEVAKKMNVRGAVFWSSSAALVALVFCIPKLIDDGIIDSHGIIPCHLILYFPPA  174



>ref|XP_008348089.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=456

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 118/185 (64%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVAL-D  240
            M +PHIL IP PAQGHVIP+M L+QCL  HG   +TFV T   H+++ N+       +  
Sbjct  1    MSSPHILAIPVPAQGHVIPMMALSQCLVNHG-FKVTFVNTDFNHNRVANALPDGQSHMTK  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  E     G L EA+ ++MPGK+E+LI  IN    E  ITCVIADQ 
Sbjct  60   DRIDLVSIPDGLEPGEDRRDLGLLTEAMRRVMPGKLEELIEKINGGDXEK-ITCVIADQG  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+A K  ++  AF  A+AA L L  NIPKLID+GII+N+G   +++  Q AP MP
Sbjct  119  IGWALEVAAKXKIKAVAFWTASAAVLALKLNIPKLIDEGIIDNDGTVLKSQAIQLAPNMP  178

Query  601  FMNTS  615
             + T+
Sbjct  179  AIKTA  183



>tpg|DAA51462.1| TPA: hypothetical protein ZEAMMB73_540156 [Zea mays]
Length=459

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 117/185 (63%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+PYPAQGHVIP+MEL+ CL  HG + +TFV T+  H  IL + A  +  L  
Sbjct  3    MAAPRVLVLPYPAQGHVIPMMELSHCLIEHG-VKVTFVNTEVNHRLILGALATGDKELG-  60

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH-ITCVIADQS  420
            G+ +VS+ D   + E     G+L ++ SK+MPG++EKLI  INA   E   ++ +IAD +
Sbjct  61   GVDMVSIPDGLGTGEDRKDLGRLTDSFSKVMPGELEKLITSINADGREREKVSWLIADVN  120

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + WA  +AKK G++TA F P++AA   +   IP++I DG+++  G P     FQ AP MP
Sbjct  121  MAWAFPVAKKHGLRTAGFCPSSAAMFAMRIRIPEMISDGVLDERGWPKRRGAFQLAPAMP  180

Query  601  FMNTS  615
             ++TS
Sbjct  181  AIDTS  185



>ref|XP_007032718.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY03644.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=461

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG-  246
            NPHILVIPYPAQGHV PLMEL+  LA+HG   I+FV T   H +I+N  A    A ++G 
Sbjct  9    NPHILVIPYPAQGHVFPLMELSHNLAKHG-FKISFVNTDFNHQRIIN--AFGKEADENGL  65

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
            + LVS+ D  E  E  N  GKL EA+ ++MP ++++ I   N +  +  ITCV+AD ++G
Sbjct  66   VRLVSIPDGLEDGEDRNQIGKLTEALCQVMPRELKEFIVKFNRTEDDK-ITCVLADLNMG  124

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPA-ENKTFQFAPTMP  600
            W L++A +LG++ AAF P +   LVL  +IPKLIDDG+I+  G P  ++K FQ + TMP
Sbjct  125  WTLDVAAELGIRGAAFWPCSVVQLVLFLSIPKLIDDGLIDENGFPINKHKMFQLSATMP  183



>ref|NP_001169791.1| uncharacterized protein LOC100383681 [Zea mays]
 gb|ACN34925.1| unknown [Zea mays]
Length=459

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 117/185 (63%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+PYPAQGHVIP+MEL+ CL  HG + +TFV T+  H  IL + A  +  L  
Sbjct  3    MAAPRVLVLPYPAQGHVIPMMELSHCLIEHG-VKVTFVNTEVNHRLILGALATGDKELG-  60

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH-ITCVIADQS  420
            G+ +VS+ D   + E     G+L ++ SK+MPG++EKLI  INA   E   ++ +IAD +
Sbjct  61   GVDMVSIPDGLGTGEDRKDLGRLTDSFSKVMPGELEKLITSINADGREREKVSWLIADVN  120

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + WA  +AKK G++TA F P++AA   +   IP++I DG+++  G P     FQ AP MP
Sbjct  121  MAWAFPVAKKHGLRTAGFCPSSAAMFAMRTRIPEMISDGVLDERGWPKRRGAFQLAPAMP  180

Query  601  FMNTS  615
             ++TS
Sbjct  181  AIDTS  185



>gb|KDO58819.1| hypothetical protein CISIN_1g009851mg [Citrus sinensis]
Length=524

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L +
Sbjct  1    MSRPRVLVMPAPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYNHKRVVESLQGKNY-LGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  GKL E   ++MPGK+E+LI  IN+   E  I C IAD ++
Sbjct  59   QIHLVSIPDGMEPWEDRNDLGKLIEKCLQVMPGKLEELIEEINSREDEK-IDCFIADGNI  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGI  558
            GW++E+AKK+ V+ A F P++AA++ L F IPKLIDDGII++ G+
Sbjct  118  GWSMEIAKKMNVRGAVFWPSSAASVALVFRIPKLIDDGIIDSHGM  162



>gb|AIS39477.1| flavonoid UDP-glucosyltransferase 11 [Citrus x paradisi]
Length=457

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 121/183 (66%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH++VIP P QGHVIPL+EL+Q LA+HG + ITFV ++  H+++L S    N  + +
Sbjct  1    MSSPHVVVIPNPEQGHVIPLLELSQNLAKHG-LRITFVNSEYNHNRVLESLEGKNY-IGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  +  +   KL E   ++MPGK+E LI  I+    E  I C+IAD + 
Sbjct  59   QIHLVSIPDGIEPWDDRSDMRKLLEKRLQVMPGKLEGLIEEIHGRGGEK-IACLIADGAA  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWA+E+A+K+ ++ A  +  +AA + L F+IPKLI+DG+IN+ G P + +  Q AP MP 
Sbjct  118  GWAIEVAEKMKLRRAVVVITSAATVALTFSIPKLIEDGVINSNGTPIKEQMIQLAPNMPA  177

Query  604  MNT  612
            ++T
Sbjct  178  IST  180



>gb|KDO58820.1| hypothetical protein CISIN_1g009851mg [Citrus sinensis]
Length=506

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+P PAQGHVIPL+E +QCLA+HG   +TFV T   H +++ S    N  L +
Sbjct  1    MSRPRVLVMPAPAQGHVIPLLEFSQCLAKHG-FRVTFVNTDYNHKRVVESLQGKNY-LGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  GKL E   ++MPGK+E+LI  IN+   E  I C IAD ++
Sbjct  59   QIHLVSIPDGMEPWEDRNDLGKLIEKCLQVMPGKLEELIEEINSREDEK-IDCFIADGNI  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGI  558
            GW++E+AKK+ V+ A F P++AA++ L F IPKLIDDGII++ G+
Sbjct  118  GWSMEIAKKMNVRGAVFWPSSAASVALVFRIPKLIDDGIIDSHGM  162



>gb|AAM47590.1| putative glucosyl transferase [Sorghum bicolor]
Length=459

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M  PH+L +P+PAQGHVIPLM+L+  L  +G I +TFV T+  H+ +L++   +      
Sbjct  1    MAAPHVLALPFPAQGHVIPLMQLSHRLVENG-IEVTFVNTELNHALVLDAMPADGTGRSL  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            DGIHLV V D     +     GKL +  S+ MPG +E+L+ G   +S  + I+ +IAD++
Sbjct  60   DGIHLVGVPDGLADGDDRKDLGKLVDGFSRHMPGYLEELV-GRTEASGGTKISWLIADEA  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWA E+A KLG++ AAF P +AA L     IP++I DGII+ +G P   +TFQFAP MP
Sbjct  119  MGWAFEVAMKLGIRAAAFWPGSAAFLATILRIPQMIQDGIIDEKGWPNRQETFQFAPGMP  178

Query  601  FMNTS  615
             ++TS
Sbjct  179  PLHTS  183



>ref|XP_010923596.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Elaeis guineensis]
Length=472

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 126/193 (65%), Gaps = 2/193 (1%)
 Frame = +1

Query  37   GSKTFKQSRMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSS  216
            G++T   + MG+PH ++IPYP QGHVIPL+ L+  L  HG   ITF+ ++  H +++ S 
Sbjct  9    GNRTQLPAAMGSPHAIIIPYPVQGHVIPLIALSHSLVAHG-FKITFINSEFNHERVVASL  67

Query  217  ALNNVALDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHI  396
            + N     +GIH+VS  D     E  N   ++ E   ++MP  +E+LI  +N S  +  +
Sbjct  68   SQNGGDGLEGIHMVSFPDGLAPGEDRNDIRRVTEGFLRVMPRCLEELIERMNTSGGD-QV  126

Query  397  TCVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKT  576
            T VIAD ++GWALE+A+K+G+++AAF PA+ A L +  +IPK+I DGII+ +G+P  ++T
Sbjct  127  TWVIADGNMGWALEVAQKMGIRSAAFWPASTALLAIFLSIPKMIQDGIIDAKGMPERSET  186

Query  577  FQFAPTMPFMNTS  615
            FQ  P MP +NTS
Sbjct  187  FQLRPGMPSVNTS  199



>ref|XP_006482740.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Citrus sinensis]
Length=457

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 119/183 (65%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH++VIP P QGHVIPL+EL+Q LA+HG + ITFV ++  H ++L S    N  + +
Sbjct  1    MSSPHVVVIPNPEQGHVIPLLELSQNLAKHG-LRITFVNSEYNHKRVLESLEGKNY-IGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  +  +   KL E   ++MPGK+E LI  I+    E    C+IAD + 
Sbjct  59   QIHLVSIPDGMEPWDDRSDMRKLLEKRLQVMPGKLEGLIEEIHGREGEK-TACLIADGAA  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWA+E+A+K+ ++ A  +  +AA + L F+IPKLI+DG+IN+ G P + +  Q AP MP 
Sbjct  118  GWAIEVAEKMKLRRAVVVITSAATVALTFSIPKLIEDGVINSNGTPIKEQMIQLAPNMPA  177

Query  604  MNT  612
            ++T
Sbjct  178  IST  180



>gb|KDO72751.1| hypothetical protein CISIN_1g012744mg [Citrus sinensis]
Length=457

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 119/183 (65%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH++VIP P QGHVIPL+EL+Q LA+HG + ITFV ++  H ++L S    N  + +
Sbjct  1    MSSPHVVVIPNPEQGHVIPLLELSQNLAKHG-LRITFVNSEYNHKRVLESLEGKNY-IGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  +  +   KL E   ++MPGK+E LI  I+    E    C+IAD + 
Sbjct  59   QIHLVSIPDGMEPWDDRSDMRKLLEKRLQVMPGKLEGLIEEIHGREGEK-TACLIADGAA  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWA+E+A+K+ ++ A  +  +AA + L F+IPKLI+DG+IN+ G P + +  Q AP MP 
Sbjct  118  GWAIEVAEKMKLRRAVVVITSAATVALTFSIPKLIEDGVINSNGTPIKEQMIQLAPNMPA  177

Query  604  MNT  612
            ++T
Sbjct  178  IST  180



>ref|XP_008379418.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=164

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVAL-D  240
            M +PHIL IP PAQGHVIP+M L+QCL  HG   +TFV T   H+++ N+       +  
Sbjct  1    MSSPHILAIPVPAQGHVIPMMALSQCLVNHG-FKVTFVNTDFNHNRVANALPDGQSHMTK  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  E     G L EA+ ++MPGK+E+LI  IN    E   TCVIADQ 
Sbjct  60   DRIDLVSIPDGLEPGEDRRDLGLLTEAMRRVMPGKLEELIEKINGGDGEK-XTCVIADQG  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            +G ALE+A KL ++  AF  A+AA L L  NIPKLID+GII+N+G
Sbjct  119  IGXALEVAAKLKIKAVAFWTASAAVLALKLNIPKLIDEGIIDNDG  163



>ref|XP_006432641.1| hypothetical protein CICLE_v10000928mg [Citrus clementina]
 gb|ESR45881.1| hypothetical protein CICLE_v10000928mg [Citrus clementina]
Length=502

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH+LV+P PAQGHVIPL+E +QCLA+  G  +TFV T   H +I+ S    N  L +
Sbjct  1    MNRPHVLVLPIPAQGHVIPLLEFSQCLAKQ-GFRVTFVNTDYDHKRIMESLEGKN-DLGE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKLFE + ++MPGK+E+LI  IN+   E  + C IAD  +
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLFEKVLQVMPGKLEELIEDINSREDEK-LDCFIADGYM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGI  558
             W++E+AKK+ V+ A F P++AA++ L F+IPKLIDDGII++ G+
Sbjct  118  AWSMEVAKKMNVRGALFWPSSAASVALLFHIPKLIDDGIIDSNGM  162



>ref|XP_004306078.1| PREDICTED: UDP-glycosyltransferase 83A1 [Fragaria vesca subsp. 
vesca]
Length=453

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 120/183 (66%), Gaps = 2/183 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHI+ IPYPAQGHVIPLMEL+QCL   G   +TFV T   H ++++S A      DD
Sbjct  1    MSKPHIIAIPYPAQGHVIPLMELSQCLVNEG-FKVTFVNTDFNHKRVMSSLADETHKRDD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IH+VS+ D  E  E  N  GKL EAI ++MPGK+E+LI  I     +  ++C+IAD+S 
Sbjct  60   KIHMVSIPDGLEPWEDRNDLGKLCEAILRVMPGKLEELIEKIKEEEGDK-VSCIIADESN  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+ ++  AF PA+AA L L F IPKLI +GII++EG   +++    A  MP 
Sbjct  119  GWALEVAEKMKIKKVAFWPASAALLALEFCIPKLIHEGIIDDEGTALKSQMINLAQGMPT  178

Query  604  MNT  612
            + T
Sbjct  179  LKT  181



>gb|EYU44188.1| hypothetical protein MIMGU_mgv1a026943mg [Erythranthe guttata]
Length=167

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 5/165 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            M  PHI+ +PYPAQGHVIP++E+ Q L + G I +TFV T   H ++++S S  +N+   
Sbjct  1    MATPHIIAVPYPAQGHVIPMLEITQWLVKQG-IKVTFVNTNFNHQRVIDSLSDSDNIR--  57

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
              +++VS+ D  E  E  N  GKL +AISK MPG++E LI  IN    E  ITCV+AD S
Sbjct  58   QLLNMVSMSDGVEPWEDRNDLGKLTQAISKTMPGQLEALIDEINGKGGEK-ITCVVADWS  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            + WALE+A+KLG++ AAF   +AA L L  NIPKL+ DGII++ G
Sbjct  117  MKWALEVAEKLGLKRAAFSALSAAILALSVNIPKLVSDGIIDSNG  161



>ref|XP_006338769.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Solanum tuberosum]
Length=462

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 125/181 (69%), Gaps = 3/181 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PHI+ IPYPAQGHV+PLMEL+  L +  G  ITFV ++  H +++ S + N+  + D I 
Sbjct  6    PHIVAIPYPAQGHVLPLMELSLWLIKELGCKITFVNSEFNHKRVIKSLSEND-DVQDKIS  64

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            L+S+ D  E +E      KL E+I+++MPGK+ ++I  IN  S++S I+CVIAD+++GWA
Sbjct  65   LISIPDGLEPHEDRTDLKKLTESINEVMPGKLMEVINMIN--SNDSQISCVIADENMGWA  122

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            LE+A KL +++AAF PAAAA L   F++ KLIDDGII+ +G   + +  + +P MP MN 
Sbjct  123  LEVAAKLNIRSAAFWPAAAATLASLFSVSKLIDDGIIDKDGAILKAQGIKLSPNMPIMNP  182

Query  613  S  615
            S
Sbjct  183  S  183



>ref|XP_004233666.1| PREDICTED: UDP-glycosyltransferase 83A1 [Solanum lycopersicum]
Length=462

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 124/181 (69%), Gaps = 3/181 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PHI+ IPYPAQGHV+PLMEL+  L +  G  ITFV ++  H +++ S + N+  ++D I 
Sbjct  6    PHIVAIPYPAQGHVLPLMELSLWLIKELGCKITFVNSEFNHKRVIKSLSEND-DVEDKIS  64

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            L+S+ D  E +E      KL E+I++ MPGK+ ++I  IN  S+ES ++CV+AD+++GWA
Sbjct  65   LISIPDGLEPHEDRTDLKKLTESINEAMPGKLMEVIHMIN--SNESQVSCVVADENMGWA  122

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            LE+A KL +++ AF PAAAA L   F++ KLIDDGII+ +G   + +  + +P MP MN 
Sbjct  123  LEVADKLNIRSVAFWPAAAATLASLFSVSKLIDDGIIDKDGSILKAEGIKLSPNMPIMNP  182

Query  613  S  615
            S
Sbjct  183  S  183



>emb|CAN82798.1| hypothetical protein VITISV_007532 [Vitis vinifera]
Length=358

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPH+LV+P+P QG+V+PL EL+ CLA+HG   ITFV  +  H  I+N     +  + D
Sbjct  1    MSNPHVLVVPFPGQGYVLPLTELSLCLAKHG-FRITFVNIEINHKMIMNEWKQED-NIGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LV + D  E +E    P K  EAI  IM  K+E+LI   N +  E  ITCV+ADQ +
Sbjct  59   RLRLVWIPDGLEFDEDRKNPDKFSEAIWGIMARKLEELIEESNGADDEK-ITCVVADQGM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            G ALE+A K+G+  A+F P AA  + L  +IPKLI+DGII+N+G  A+N+  + +PT+P
Sbjct  118  GSALEIAAKMGIHRASFCPMAATKMALLLSIPKLINDGIISNDGTLAKNQMIRVSPTIP  176



>emb|CAN79737.1| hypothetical protein VITISV_003350 [Vitis vinifera]
Length=443

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 115/179 (64%), Gaps = 3/179 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPH+LV+P+P QG+V+PL EL+ CLA+HG   ITFV  +  H  I+N     +  + D
Sbjct  1    MSNPHVLVVPFPGQGYVLPLXELSLCLAKHG-FRITFVNIEINHXMIMNEWKZED-NIGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LV + D  E +E    P K  EAI  IM  K+E+LI   N +  E  ITCV+ADQ +
Sbjct  59   RLRLVWIPDGLEFDEDRKNPDKFSEAIWGIMARKLEELIXEXNGADDEK-ITCVVADQGM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            G ALE+A K+G+  A+F P AA  + L  +IPKLI+DGII+N+G  A+N+  + +PT+P
Sbjct  118  GSALEIAAKMGIHRASFCPMAATKMALLLSIPKLINDGIISNDGTLAKNQMIRVSPTIP  176



>ref|XP_004168844.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 83A1-like, 
partial [Cucumis sativus]
Length=259

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ HIL IPYPAQGHVIPL+EL+ CLA++G   ITFV T+  H +++++ A  N   D 
Sbjct  1    MGSGHILAIPYPAQGHVIPLLELSLCLAKYG-FKITFVNTEYNHKRVVSALAETNHIGDG  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVS+ D  E  E  N  GKL E + ++MP K+E+LI  IN     + IT VIAD++L
Sbjct  60   RVHLVSLPDGLEPGEDRNNLGKLTETMLQVMPVKLEELINTINGLGG-NEITGVIADENL  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+ +   AF PAAAA L + F+IP LI+  II+++G   +++  + A ++P 
Sbjct  119  GWALEVAAKMKIPRVAFWPAAAALLAMQFSIPNLIEQXIIDSDGTLLKSEDIKLAESVPI  178

Query  604  MNTS  615
              T 
Sbjct  179  TRTE  182



>ref|XP_010089622.1| UDP-glycosyltransferase 83A1 [Morus notabilis]
 gb|EXB38093.1| UDP-glycosyltransferase 83A1 [Morus notabilis]
Length=455

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 123/184 (67%), Gaps = 5/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVAL-D  240
            M  PHIL +P+PAQGHVIPLMEL++ L  HG   +TFV T   H +++N  A++  +L D
Sbjct  1    MVKPHILALPFPAQGHVIPLMELSKRLVNHG-FKVTFVNTDYNHKRVMN--AMSETSLED  57

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  E  N  GK+ EA   +M  K+E+LI  IN    +  ITCVIAD+S
Sbjct  58   DQIRLVSIPDGLEPWEDRNDLGKVMEASQSVMCEKLEELITRINELEGDK-ITCVIADES  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
             GWALE+A+++ ++  AF PAAAA L L F+ P+LI++G+I+N G+P +++  + AP +P
Sbjct  117  FGWALEVAERMKIRRVAFWPAAAALLALAFSAPELINNGVIDNNGVPQKSQMIELAPEIP  176

Query  601  FMNT  612
             + T
Sbjct  177  AIKT  180



>ref|XP_010923603.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Elaeis guineensis]
Length=452

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 117/184 (64%), Gaps = 5/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH ++IP P  GH+IPL+ L+  L  HG   ITF+ ++  H +++ S + N     +
Sbjct  1    MASPHAIIIPCPEHGHIIPLIALSHSLVAHG-FRITFINSEFNHERVVASLSQNGGDGVE  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            G+H+VS  D     E  N   K  E I ++MPG +E+LI+ I +      +TC+IAD ++
Sbjct  60   GMHMVSFPDGLAPGEDRNTFKKKIEGIVRVMPGCLEELIKQIRSD----RVTCIIADGTM  115

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+G+++ AF P +A  L L  +IPK+I DGII  +G+P  ++TFQ +P +P 
Sbjct  116  GWALEVAQKMGIRSVAFWPMSATLLALFLSIPKMIQDGIIGADGMPERSETFQLSPDIPS  175

Query  604  MNTS  615
            MNTS
Sbjct  176  MNTS  179



>ref|XP_008365423.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 83A1-like 
[Malus domestica]
Length=441

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 2/165 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M +PHILV+P PAQGHVIP+MEL+Q L  HG   +TFV T   H+ + N+   +   +  
Sbjct  1    MSSPHILVLPLPAQGHVIPMMELSQSLVNHG-FKVTFVNTDFNHNCVTNALPDDQSHIRR  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D I LVS+ D  E  + +N PGKL E + ++MPG +E+L+  IN       ITCVIADQ+
Sbjct  60   DCIDLVSIPDGLEPGQDTNDPGKLSETMQQVMPGNLEELMEKINNRGEGDKITCVIADQA  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            +GWALE+  K+ ++TA F PA+AA L L  +IPKLI +GII+N+G
Sbjct  120  IGWALEIVVKMKIKTATFWPASAAVLALKLSIPKLIYEGIIDNDG  164



>emb|CBI33785.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 124/185 (67%), Gaps = 6/185 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PHILV+P PAQGHV+PLMEL+ CLA+  G+ +TFV T+  H +++N + +    L D
Sbjct  1    MGKPHILVVPLPAQGHVLPLMELSLCLAKQ-GLRVTFVNTEFIHERLVN-ALMERDNLGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
               LVS+ D   ++    +PGKL EAI  IM  K+E+LI  I  +  +  ++CV+AD+ +
Sbjct  59   QFRLVSIPDGL-TDADRIIPGKLSEAIWGIMGEKLEELIGMIKRAGDD--VSCVVADRGV  115

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT-MP  600
            G ALE+A K+G++ AAF P AA    L F+IPKLI+DGII+NEG P + +  Q+ PT +P
Sbjct  116  GSALEVAAKMGIRRAAFCPIAAIFTPLVFSIPKLINDGIIDNEGTPIKGQEIQYLPTNIP  175

Query  601  FMNTS  615
             +NT 
Sbjct  176  AINTK  180



>gb|KJB40914.1| hypothetical protein B456_007G082200 [Gossypium raimondii]
Length=454

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH++VIPYPAQGHVIPLMEL+Q LA+  GI I+FV T   H ++L++  ++   L  
Sbjct  1    MGKPHVVVIPYPAQGHVIPLMELSQNLAKQ-GIKISFVNTVFNHKRVLDAFGVDENGL--  57

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HL+SV D  E  E  N  GKL E++ +++P ++++LI  +N S+ +  I+CV+AD S+
Sbjct  58   -LHLLSVPDGLEDGEDRNQLGKLTESLCQVIPTQLKELIHKVNGSNDDK-ISCVLADISM  115

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIP-AENKTFQFAPTMP  600
            G AL++A +LG+ T    PAA   L +   +PKLIDDG+I+  G P  ++K  Q +P  P
Sbjct  116  GLALDVAAELGIPTVGLWPAAVLQLAVLLRVPKLIDDGLIDENGTPLMKHKMIQLSPMTP  175



>ref|XP_008792721.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Phoenix dactylifera]
Length=453

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH LV+PYPAQGHVIPL+EL+ CL       ITFV T+  H  +L + +     +  
Sbjct  1    MGLPHALVLPYPAQGHVIPLLELSYCLI-DDDFKITFVNTEYNHKCVLANLSKKESEMK-  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI+LV+V D  +  E     G+L +A  K MP  +E+LIR  N  S +  ITC+I D S+
Sbjct  59   GINLVAVPDGLDPEEDRKDLGRLNDACQKTMPTCLEELIRRTN-ESGDDKITCMIIDVSM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+AKK+G++ AAF PA+A  L    +IPKLI+DG+I+ EGIP + + FQ  P MP 
Sbjct  118  AWALEIAKKMGLRAAAFWPASAGILAPTLSIPKLIEDGVIDPEGIPKQ-QMFQLDPDMPP  176

Query  604  MNTS  615
            MN++
Sbjct  177  MNSN  180



>ref|XP_002272457.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
Length=453

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 124/185 (67%), Gaps = 6/185 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PHILV+P PAQGHV+PLMEL+ CLA+  G+ +TFV T+  H +++N + +    L D
Sbjct  1    MGKPHILVVPLPAQGHVLPLMELSLCLAKQ-GLRVTFVNTEFIHERLVN-ALMERDNLGD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
               LVS+ D   ++    +PGKL EAI  IM  K+E+LI  I  +  +  ++CV+AD+ +
Sbjct  59   QFRLVSIPDGL-TDADRIIPGKLSEAIWGIMGEKLEELIGMIKRAGDD--VSCVVADRGV  115

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT-MP  600
            G ALE+A K+G++ AAF P AA    L F+IPKLI+DGII+NEG P + +  Q+ PT +P
Sbjct  116  GSALEVAAKMGIRRAAFCPIAAIFTPLVFSIPKLINDGIIDNEGTPIKGQEIQYLPTNIP  175

Query  601  FMNTS  615
             +NT 
Sbjct  176  AINTK  180



>ref|XP_009365961.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Pyrus x bretschneideri]
Length=450

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 117/183 (64%), Gaps = 7/183 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHI+ IPYPAQGHVIPLMEL+Q LA HG I ++FV T+  H +I+ + A  ++    
Sbjct  1    MSRPHIVAIPYPAQGHVIPLMELSQSLANHG-IKVSFVNTEYNHKRIVKALAGESL----  55

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  +   +L EA+  IMP K+E+LI  IN    E ++TCV+AD  +
Sbjct  56   -IDLVSLPDGLEPWEDKSELEQLSEAMKWIMPEKLEELIEKINGGEGE-NVTCVMADHHI  113

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+A+K+ ++  AF PAA A+L L  ++PK IDDGI++N+G   +++       MP 
Sbjct  114  FWALEVAEKMNIKAVAFWPAATASLALVLSVPKYIDDGIVDNDGTVLKSQNVDMGKNMPT  173

Query  604  MNT  612
            M T
Sbjct  174  MKT  176



>ref|XP_009794377.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Nicotiana sylvestris]
Length=460

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 121/182 (66%), Gaps = 3/182 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PHI+ IPYPAQGHV+PLMEL+  L + G   ITFV ++  H +++ + ++N+  +   I 
Sbjct  5    PHIVAIPYPAQGHVLPLMELSLWLVKEG-CKITFVNSEFNHKRVIKALSVND-DVQKKIS  62

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGIN-ASSSESHITCVIADQSLGW  429
            LVS+ D     E      KL EAI+++MPGK+E++I  IN  S  E+ ++CVI D+++GW
Sbjct  63   LVSIPDGLGPEEDRTDLKKLAEAIAEVMPGKLEEVINMINNESDDENGVSCVIVDENMGW  122

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            AL +A+KL ++  AF PAAAA L   FN+ KLIDDGII+++G   + +  + +P MP MN
Sbjct  123  ALGVAEKLNIRRVAFWPAAAATLASSFNVSKLIDDGIIDSDGAILKKQGIKLSPNMPIMN  182

Query  610  TS  615
             S
Sbjct  183  PS  184



>ref|XP_008779307.1| PREDICTED: UDP-glycosyltransferase 83A1-like, partial [Phoenix 
dactylifera]
Length=341

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 120/184 (65%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+P  ++IPYP QGHVIPL+ L+  +  HG   ITF+ +++ H +++   +  +    +
Sbjct  1    MGSPQAIMIPYPMQGHVIPLLALSHSMVAHG-FKITFINSESNHDRVVAGLSQKDGDGAE  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI +VS  D     E+ N   K+ E   ++MP  +E+LI  +N S  +  + CVIAD ++
Sbjct  60   GIQMVSFPDGLAPGEARNDLRKVTEGFLRVMPRCLEELINQMNTSGGD-RVACVIADPNM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+G+++AAF PA+AA L +  +IPK+I DGII+  G+P   +TFQ +P MP 
Sbjct  119  GWALEVAQKMGIRSAAFWPASAAVLAMFLSIPKMIQDGIIDANGMPERIETFQLSPGMPS  178

Query  604  MNTS  615
            +NTS
Sbjct  179  VNTS  182



>ref|XP_004141583.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Cucumis sativus]
Length=456

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ HIL IPYPAQGHVIPL+EL+ CLARH G  ITFV T+  H +++++ A  N   D 
Sbjct  1    MGSGHILAIPYPAQGHVIPLLELSLCLARH-GFKITFVNTEYNHKRVVSALAETNQIGDG  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVS+ D  +  E  +  GKL E + ++MP K+E+LI  IN     + IT VIAD++L
Sbjct  60   RVHLVSLPDGLKPGEDRSNLGKLTETMLQVMPVKLEELINTINGLGG-NEITGVIADENL  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+ +   AF PAAAA L + F+IP LI+  II+++G   +++  + A ++P 
Sbjct  119  GWALEVAAKMKIPRVAFWPAAAALLAMQFSIPNLIEQKIIDSDGTLLKSEDIKLAESVPI  178

Query  604  MNTS  615
              T 
Sbjct  179  TRTE  182



>ref|XP_007151310.1| hypothetical protein PHAVU_004G035500g [Phaseolus vulgaris]
 gb|ESW23304.1| hypothetical protein PHAVU_004G035500g [Phaseolus vulgaris]
Length=452

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 119/185 (64%), Gaps = 5/185 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P++LV+P+P QGHV PLM  +Q +  HG   ITFV ++  H ++++S A    +L++
Sbjct  1    MNIPNLLVVPFPVQGHVNPLMNFSQKMVEHG-CKITFVNSEFIHKRVMSSVA-KQESLEE  58

Query  244  G--IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
               I LVS+ D  E ++  +  GKL +++   MP  +EKLI  I  +S +  ITC++AD 
Sbjct  59   SPTIKLVSIPDGLEPDDDRSDLGKLCDSVLSTMPSMLEKLIEDIYVNSGDK-ITCIVADV  117

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
             +GWALE+ +KLG++   F  A+AA   L +NIPKLI DGII++ G P   +TFQ +P+M
Sbjct  118  IMGWALEVGRKLGIKGTLFWTASAAMFALEYNIPKLIQDGIIDSHGFPITKETFQISPSM  177

Query  598  PFMNT  612
            P M+T
Sbjct  178  PSMDT  182



>ref|XP_004141584.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Cucumis sativus]
Length=456

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ HIL IPYPAQGHVIPL+EL+ CLA++G   ITFV T+  H +++++ A  N   D 
Sbjct  1    MGSGHILAIPYPAQGHVIPLLELSLCLAKYG-FKITFVNTEYNHKRVVSALAETNHIGDG  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVS+ D  E  E  N  GKL E + ++MP K+E+LI  IN     + IT VIAD++L
Sbjct  60   RVHLVSLPDGLEPGEDRNNLGKLTETMLQVMPVKLEELINTINGLGG-NEITGVIADENL  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+ +   AF PAAAA L + F+IP LI+  II+++G   +++  + A ++P 
Sbjct  119  GWALEVAAKMKIPRVAFWPAAAALLAMQFSIPNLIEQKIIDSDGTLLKSEDIKLAESVPI  178

Query  604  MNTS  615
              T 
Sbjct  179  TRTE  182



>gb|AGZ84548.1| glycosyltransferase KGT22 [Pueraria montana var. lobata]
Length=445

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 114/184 (62%), Gaps = 1/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH LVIPYP  GHV PLM+LA+ L +HG   ITF+ T+ +H +  N+ A  +   + 
Sbjct  1    MGIPHFLVIPYPILGHVNPLMQLAEALVKHG-CKITFLNTEFSHKRANNAGAGLDSLRES  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI  V++ D  E  +  +   K+  +I   MP  + KLI  INA  ++++ITC++   ++
Sbjct  60   GIKFVTLPDGLEPEDDRSDHEKVLLSIKTNMPAMLPKLIEDINALDADNNITCIVVTMNM  119

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+  KLG++ A    A+A +L   + IP+LIDDGII++EG+  + +  Q +P MP 
Sbjct  120  GWALEVGHKLGIEGAFLWTASATSLAACYCIPRLIDDGIIDSEGVATKKQEIQLSPNMPM  179

Query  604  MNTS  615
            M+ +
Sbjct  180  MDAA  183



>ref|XP_002466427.1| hypothetical protein SORBIDRAFT_01g007620 [Sorghum bicolor]
 gb|AAM47591.1| putative glucosyl transferase [Sorghum bicolor]
 gb|EER93425.1| hypothetical protein SORBIDRAFT_01g007620 [Sorghum bicolor]
Length=465

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+PYPAQGHV P+MEL+ CL  HG + +TFV T+  H  IL + A  +     
Sbjct  3    MAAPRVLVLPYPAQGHVTPMMELSHCLVEHG-VKVTFVNTEANHGLILGALATGDSEFG-  60

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH-ITCVIADQS  420
            G+ +VS+ D     E      +L ++ SK MP ++EKLI  INA   E    + +IAD +
Sbjct  61   GVDMVSIPDGLGCGEDRKDLARLTDSFSKFMPAELEKLIASINADEQEREKASWLIADVN  120

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + WA  +AKK G++TA F P++AA   +   IP++I DG+++  G P    TF+ AP MP
Sbjct  121  MAWAFPVAKKHGLRTAGFCPSSAAMFAMRIKIPEMISDGVLDERGWPKRRGTFRLAPAMP  180

Query  601  FMNTS  615
             ++TS
Sbjct  181  AIDTS  185



>ref|XP_011098740.1| PREDICTED: UDP-glycosyltransferase 83A1 [Sesamum indicum]
Length=454

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 118/177 (67%), Gaps = 5/177 (3%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIHL  255
            H+L IPYPAQGHVIPLME+AQCLA + GI +TFV T   H ++L +   N   + + I L
Sbjct  6    HVLAIPYPAQGHVIPLMEVAQCLANN-GIRVTFVNTDFNHGRVLRALTGN---VHELISL  61

Query  256  VSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWAL  435
            VSV D  ES+E  N  GKL EAI+K MPGK+E L+  +N +  +  ITCV+ D  L  A+
Sbjct  62   VSVSDGLESDEDRNDHGKLAEAITKDMPGKLEALVEKMNGTEGDG-ITCVLTDCYLAGAM  120

Query  436  ELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            ++A+K  ++ AAFLP++ A L    +  KL+DDGII+ +G P +N+  + +P+MP M
Sbjct  121  QVAEKFCIKKAAFLPSSVALLASVISAEKLVDDGIIDADGTPLKNELIRLSPSMPAM  177



>ref|XP_007032716.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY03642.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=457

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 122/183 (67%), Gaps = 4/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGN HIL IPYPAQGHVIPLMEL+  LA+H G  ITFV +   H +++++ A N V  + 
Sbjct  1    MGNLHILAIPYPAQGHVIPLMELSHSLAKH-GFQITFVNSDFNHQRVMDAFA-NKVDPEG  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E+ N+ GKL + +S++MPG++++LI+ I+    +  IT VIAD ++
Sbjct  59   PIRLVSIPDGMEVGENRNLLGKLTDGLSQVMPGELKELIQKID-RLEDDKITHVIADVNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPA-ENKTFQFAPTMP  600
            GWALE+A ++G+  AAF PA+A  L L F+  KL+DD +I+  G P  + K  Q +P  P
Sbjct  118  GWALEVAAEMGIPGAAFWPASALVLNLLFSTKKLLDDEVIDEHGTPINKEKMIQLSPNTP  177

Query  601  FMN  609
             M+
Sbjct  178  AMH  180



>gb|KGN52509.1| hypothetical protein Csa_5G638465 [Cucumis sativus]
Length=456

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 120/184 (65%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ HIL IPYPAQGHVIPL+EL+ CLARH G  ITFV T+  H +++++ A  N   D 
Sbjct  1    MGSGHILAIPYPAQGHVIPLLELSLCLARH-GFKITFVNTEYNHKRVVSALAETNHIGDG  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVS+ D  E  E  N  GKL E + ++MP ++ +LI  IN     + IT VIAD++L
Sbjct  60   RVHLVSLPDGLEPGEDRNNLGKLTETMLQVMPVQLTELINTINGLGG-NEITGVIADENL  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+ +   AF PAAAA L + F+IP LI+  +I+++G   +++  + A ++P 
Sbjct  119  GWALEVAAKMKIPRVAFWPAAAALLAMQFSIPNLIEQKLIDSDGTLLKSEDIKLAESVPI  178

Query  604  MNTS  615
              T 
Sbjct  179  TRTE  182



>ref|XP_008778171.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Phoenix dactylifera]
Length=436

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 117/184 (64%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG P  ++IPYP QGHVIPL+ L+  +  HG   ITF+ ++  H +++ + +  +    +
Sbjct  1    MGTPQAIMIPYPEQGHVIPLLALSHSMVAHG-FKITFINSEFNHDRVVAALSQKDGDGAE  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI +VS  D     E  N   K  E   ++MP  +E+LI  +N S  +  + CVIAD ++
Sbjct  60   GIQMVSFPDGLAPGEDRNDLRKKTEGFLRVMPRCLEELINQMNTSGGD-RVACVIADPNM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+K+G+++AA  PA+AA L +  +IPK+I DGII+  G+P  ++TFQ +P MP 
Sbjct  119  GWALEVAQKMGIRSAALWPASAAVLAMFLSIPKMIQDGIIDANGMPQRSETFQLSPGMPS  178

Query  604  MNTS  615
            +NTS
Sbjct  179  VNTS  182



>ref|XP_003552563.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=444

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 117/185 (63%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSA-LNNVALD  240
            MG PH LVIPYP  GHV PLM+L++ L +HG   ITF+ T+ +H +  N+ A L+N+  +
Sbjct  1    MGIPHFLVIPYPVLGHVNPLMQLSEALTKHG-CKITFLNTEFSHKRANNAGAGLDNLK-E  58

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
             GI  V++ D  E  +  +   K+  +I   MP  + KLI  INA  +E+ ITC++A  +
Sbjct  59   SGIKFVTLPDGLEPEDDRSDHEKVILSIQSNMPSLLPKLIEDINALDAENSITCIVATMN  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+  KLG++ A    A+A +L   + IP+LIDDGII++EG+  + + FQ +  MP
Sbjct  119  MGWALEIGHKLGIEGALLWTASATSLAACYCIPRLIDDGIIDSEGVATKKQEFQLSLNMP  178

Query  601  FMNTS  615
             M+ +
Sbjct  179  MMDPA  183



>ref|XP_010923602.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Elaeis guineensis]
Length=455

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 120/184 (65%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ H +++P PAQGHVIPLM L+  L  HG   ITF+ ++  H  ++ S + N     +
Sbjct  1    MGSRHAIIVPVPAQGHVIPLMALSHSLVAHG-FRITFINSEFNHEHVVASLSQNGGDGVE  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I +VS  D    +E      KL E I  +MPG +E+LI+    +S    +TCVIAD+S+
Sbjct  60   RIQMVSFPDGLAPHEDRKDIQKLTEGIGGVMPGHLEELIK--QNTSKGDRVTCVIADRSM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWAL++A+K+G+++AAF PA+AA L L  +IPK+I DGII+ +G+P +++ FQ +P MP 
Sbjct  118  GWALQVAQKMGIRSAAFWPASAAVLALFLSIPKMIQDGIIDADGMPEKSERFQLSPGMPS  177

Query  604  MNTS  615
            ++ S
Sbjct  178  VHAS  181



>ref|XP_006603906.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=452

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 2/183 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P++L++PYP QGHV PLM  +Q L  HG   ITFV T  TH +++NS A      + 
Sbjct  1    MNIPNVLIVPYPVQGHVNPLMNFSQKLVEHG-CKITFVNTDFTHKRVMNSMAKQESHDES  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LVS+ D    ++  +  G+L  +I   MP  +E+LI  I+ +   + ITC++AD  +
Sbjct  60   PMKLVSIPDGLGPDDDRSDVGELSVSILSTMPAMLERLIEDIHLNGG-NKITCIVADVIM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+  KLG++   F  A+A    L +NIP LI DGII+++G P   +TFQ +P+MP 
Sbjct  119  GWALEVGSKLGIKGVLFWTASATMFALQYNIPTLIQDGIIDSDGFPITQRTFQISPSMPT  178

Query  604  MNT  612
            M+T
Sbjct  179  MDT  181



>gb|KHG18069.1| hypothetical protein F383_21636 [Gossypium arboreum]
Length=456

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 116/180 (64%), Gaps = 4/180 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH+LVIPYP QGHVIPL+EL+Q LA+  GI I+FV T   H ++L++     V  + 
Sbjct  1    MGKPHVLVIPYPTQGHVIPLVELSQNLAKQ-GIKISFVNTVFNHKRVLDAFG-EKVNENG  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HL+SV D  E  E  N  GKL E + ++MP ++++LI  +N  S +  I+CV+AD ++
Sbjct  59   LLHLLSVPDGLEDGEDRNQLGKLTERLCQVMPTQIKELIHKVN-ESDDDKISCVLADITM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIP-AENKTFQFAPTMP  600
            G AL++A +LG+ T    PAA   L +  +IPK IDDG+I+  G P  ++K FQ +P  P
Sbjct  118  GLALDVAAELGIPTVGLWPAAVFQLAMLLSIPKFIDDGLIDEIGTPLMKHKMFQLSPMNP  177



>ref|XP_004981716.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Setaria italica]
Length=459

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQI---LNSSALNNVA  234
            M   HILV+P+PAQGHV PLMEL+  L  HG   +TFV T+  H+ +   L +S      
Sbjct  1    MAKAHILVLPFPAQGHVTPLMELSHLLVDHG-FEVTFVNTEVDHALVVAALRASGGEAAL  59

Query  235  LDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
            L  GIHL S+ D    +E      KL +A ++ MPG +E+LI  + A+        ++ D
Sbjct  60   LGGGIHLASIPDGLADDEDRKDLSKLIDAFTRHMPGHLERLIVNMEAAG-RPRAKWIVGD  118

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
             S+GW+ E+AKK G++  AF PAA A L +   IPKLI+DG+I+++G P   +TFQ AP 
Sbjct  119  VSMGWSFEVAKKFGIRVVAFWPAATAGLAIVHKIPKLIEDGLIDDKGWPRRQETFQLAPG  178

Query  595  MPFMNTS  615
            MP ++TS
Sbjct  179  MPPLHTS  185



>gb|KHN13563.1| UDP-glycosyltransferase 83A1 [Glycine soja]
Length=444

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 114/184 (62%), Gaps = 1/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH LVIPYP  GHV PLM+L++ L +HG   ITF+ T+ +H +  N+ A  +   + 
Sbjct  1    MGIPHFLVIPYPVLGHVNPLMQLSEALTKHG-CKITFLNTEFSHKRANNAGAELDNLKES  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI  V++ D  E  +  +   K+F +I   MP  + KLI  INA  +E+ ITC++A  ++
Sbjct  60   GIKFVTLPDGLEPEDDRSDHEKVFLSIQSNMPSLLPKLIEDINALDAENSITCIVATMNM  119

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+  KLG++ A    A+A +L   + IP+LIDDGII++EG+  + + FQ +  MP 
Sbjct  120  CWALEVGHKLGIEGAFLWTASATSLAACYCIPRLIDDGIIDSEGVATKKQEFQLSLNMPM  179

Query  604  MNTS  615
            M+ +
Sbjct  180  MDPA  183



>ref|XP_010923598.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Elaeis guineensis]
Length=471

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ H +++P PAQGHVIPL+ L+  L  HG   ITF+ ++  H  ++ S + N     +
Sbjct  17   MGSRHAIIVPLPAQGHVIPLIALSHSLVAHG-FRITFINSEFNHEHVVASLSQNGGDGVE  75

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI +VS  D     E  N   KL E I ++MPG +E+LI+ +N S  +  ++CVIAD ++
Sbjct  76   GIQMVSFPDGLAPREDRNDIQKLTEGIRRVMPGHLEELIKQMNTSKGD-RVSCVIADGAM  134

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWAL++A+K+G+++AAF PA+AA   +  +IP++I DGII+  G+   ++TFQ +P MP 
Sbjct  135  GWALQVAQKMGIRSAAFWPASAALHAIFLHIPEMIQDGIIDANGMSERSETFQLSPGMPS  194

Query  604  MNTS  615
            ++TS
Sbjct  195  VHTS  198



>ref|XP_008459382.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Cucumis melo]
Length=456

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 120/184 (65%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ HIL IPYPAQGHVIPL+E + CLA+H G  ITFV T+  H +++++ A  N   D 
Sbjct  1    MGSGHILAIPYPAQGHVIPLLEFSLCLAKH-GFKITFVNTEYIHKRVVSALAETNHIGDG  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVS+ D  +  E  N  GKL E + ++MP K+E+LI  IN     + IT VIAD++L
Sbjct  60   RVHLVSLPDGLKPWEDRNNLGKLTETMLQVMPVKLEELINTINGLGG-NKITGVIADENL  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+ +   AF PAAAA L + F+IP LI+  +I+++G   +++  + A ++P 
Sbjct  119  GWALEVAAKMKIPRVAFWPAAAALLAMQFSIPNLIEQKLIDSDGTLLKSEDIKLAESVPI  178

Query  604  MNTS  615
              T 
Sbjct  179  TRTE  182



>gb|KGN52506.1| hypothetical protein Csa_5G638455 [Cucumis sativus]
Length=456

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ HIL IPYPAQGHVIPL+EL+ CLARH G  ITFV T+  H +++++ A  N   D 
Sbjct  1    MGSGHILAIPYPAQGHVIPLLELSLCLARH-GFKITFVNTEYNHKRVVSALAETNQIGDG  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             +HLVS+ D  +  E  +  GKL E + ++MP K+E+LI  IN     + IT VIAD++L
Sbjct  60   RVHLVSLPDGLKPGEDRSNLGKLTETMLQVMPVKLEELINTINGLGG-NEITGVIADENL  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A K+ +   AF PAAAA L + F+IP LI+  +I+++G   +++  + A ++P 
Sbjct  119  GWALEVAAKMKIPRVAFWPAAAALLAMLFSIPNLIEQKLIDSDGTLLKSEDIKLAESVPI  178

Query  604  MNTS  615
              T 
Sbjct  179  TRTE  182



>gb|KJB75628.1| hypothetical protein B456_012G048900 [Gossypium raimondii]
Length=457

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 114/183 (62%), Gaps = 4/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGNPHIL IPYPAQGHVIPLMEL+  L  H G  ITFV T   H ++ ++   N V  + 
Sbjct  1    MGNPHILAIPYPAQGHVIPLMELSHNLVSH-GFKITFVNTDFNHKRVKDAFG-NKVDGEG  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E +E     GKL + ISK+MP +++KL++ IN  S ++ I+CVIAD ++
Sbjct  59   SIRLVSIPDGMEPDEDRKQLGKLTDGISKVMPLELKKLVKKING-SEDNKISCVIADVNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTF-QFAPTMP  600
            GWAL++A +  +   AF PA+A  L L F+  KL+DD +I+  G P   +   Q  P  P
Sbjct  118  GWALDIAAEFEIPGVAFWPASAMLLALLFSTDKLLDDQVIDKHGTPINGENMIQLYPNTP  177

Query  601  FMN  609
             M+
Sbjct  178  AMH  180



>ref|XP_007217239.1| hypothetical protein PRUPE_ppa006338mg [Prunus persica]
 gb|EMJ18438.1| hypothetical protein PRUPE_ppa006338mg [Prunus persica]
Length=416

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   HIL IPYPAQGHVIPLMEL+QCLA HG   +TFV T+  H +++N+ A  +    D
Sbjct  1    MSKQHILAIPYPAQGHVIPLMELSQCLATHG-FKVTFVNTEHNHKRVMNALADESHISRD  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHLVS+ D  E  E  N  G+L EA+ ++MPGK+E+LI  IN    +  ITCVIADQ+ 
Sbjct  60   HIHLVSIPDGLEPLEDRNELGRLSEAMQRVMPGKLEELIEKINQGEGQK-ITCVIADQTA  118

Query  424  GWALELAKKLGVQ  462
            GW LE+A+K+ ++
Sbjct  119  GWILEVAEKMKIR  131



>ref|XP_002514679.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF47785.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=459

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 118/182 (65%), Gaps = 3/182 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH++VIPYPAQGHV PLM+LA  LA HG I +TFV +++ H +I+ ++   N+     I 
Sbjct  5    PHVIVIPYPAQGHVAPLMKLAYKLADHG-IKVTFVNSESIHGRIM-AAMPENLEEKIPIS  62

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSS-ESHITCVIADQSLGW  429
            L+S+ D  ESN       K  ++IS  MPG ++KLI  +N S++ +  ++CVIAD +L  
Sbjct  63   LISISDGVESNRDRKDRIKKLKSISSSMPGNLQKLIESLNQSANHDDQVSCVIADLTLKG  122

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            ALE+AKK+G++ A  LP    NL L  + PKLI+DGII+ +G+P +++    A T P  N
Sbjct  123  ALEVAKKMGIKRAGVLPYGVGNLALQLHAPKLIEDGIIDADGMPLKDEVICLAKTFPPCN  182

Query  610  TS  615
            ++
Sbjct  183  SN  184



>ref|XP_002466428.1| hypothetical protein SORBIDRAFT_01g007630 [Sorghum bicolor]
 gb|EER93426.1| hypothetical protein SORBIDRAFT_01g007630 [Sorghum bicolor]
Length=477

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 119/203 (59%), Gaps = 21/203 (10%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD-  240
            M  PH+L +P+PAQGHVIPLM+L+  L  +G I +TFV T+  H+ +L++   +      
Sbjct  1    MAAPHVLALPFPAQGHVIPLMQLSHRLVENG-IEVTFVNTELNHALVLDAMPADGTGRSL  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            DGIHLV V D     +     GKL +  S+ MPG +E+L+ G   +S  + I+ +IAD++
Sbjct  60   DGIHLVGVPDGLADGDDRKDLGKLVDGFSRHMPGYLEELV-GRTEASGGTKISWLIADEA  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNE----------------  552
            +GWA E+A KLG++ AAF P +AA L     IP++I DGII+ +                
Sbjct  119  MGWAFEVAMKLGIRAAAFWPGSAAFLATILRIPQMIQDGIIDEKELSAQDEYILIGESRT  178

Query  553  --GIPAENKTFQFAPTMPFMNTS  615
              G P   +TFQFAP MP ++TS
Sbjct  179  SAGWPNRQETFQFAPGMPPLHTS  201



>gb|KDP31327.1| hypothetical protein JCGZ_11703 [Jatropha curcas]
Length=465

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 110/181 (61%), Gaps = 2/181 (1%)
 Frame = +1

Query  67   GNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG  246
            G PH+LVIPYPAQGHV+PLM+LA  +A +G   +TFV T    ++I+ S+   N      
Sbjct  3    GKPHVLVIPYPAQGHVMPLMKLAYKIAENG-YKVTFVNTDVIQAKIM-SAMHENFKEQTH  60

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
            I+ VS+ D  ESN     P K  + + ++MP  ++ LI  IN S  E  ITCVIA+ +  
Sbjct  61   INFVSIPDGLESNNDKKDPFKDLKILCQVMPSHLQNLIEKINQSEDEEQITCVIAETTAW  120

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            WALE+A+KLG++ AAF P    N+ L  +IPKLI+ G+I+  G+P  N+    +  +P  
Sbjct  121  WALEVAQKLGIRRAAFSPPGLGNMALVLHIPKLIEAGVIDANGMPITNELISLSRDIPAW  180

Query  607  N  609
            N
Sbjct  181  N  181



>ref|XP_004981717.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Setaria italica]
Length=459

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 113/183 (62%), Gaps = 5/183 (3%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQI---LNSSALNNVALDDG  246
            H+LV+P+P+QGHV PLMEL+  L  HG   +TFV T+  H+ +   L       +    G
Sbjct  6    HVLVLPFPSQGHVTPLMELSHRLVDHG-FEVTFVNTEVDHALVVAALRGGEATLLGGGGG  64

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
            IHL S+ D    +E      KL +A ++ MPG +E+LI G+ A+     +  ++ D ++G
Sbjct  65   IHLASIPDGLADDEDRKDLNKLIDAYTRHMPGHLERLIAGLEAAG-RPRVKWLVGDVNMG  123

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            W+ E+AKK G++  +F PAA A L L   IPKLI+DG+I+++G+P   +TFQ AP MP +
Sbjct  124  WSFEVAKKFGIRVVSFWPAATACLALMLKIPKLIEDGLIDDKGLPRRQETFQLAPGMPPL  183

Query  607  NTS  615
            +TS
Sbjct  184  HTS  186



>emb|CBI15140.3| unnamed protein product [Vitis vinifera]
Length=633

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = +1

Query  40   SKTFKQSRMGN-PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSS  216
            S+  +++ MG  PH+LV+P+PAQGHV PLM+LA  ++ HG I +TFV T+  H++I+ +S
Sbjct  201  SEGVQETTMGRRPHVLVVPFPAQGHVAPLMKLAHKVSDHG-IKVTFVNTEFIHAKIM-AS  258

Query  217  ALNNVALDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHI  396
              +       I LVSV D      + N    L E+I  +MPG V+ LI  IN ++ +  I
Sbjct  259  MPDKDGKQSRIELVSVPDGLNPEANRNDAVMLTESILTVMPGHVKDLIEKINRTNDDEKI  318

Query  397  TCVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKT  576
            TCVIAD ++GWALE+A+K+G++ AA  P    +L L  +IPKLI+  II+ +G P +N+ 
Sbjct  319  TCVIADTTVGWALEVAEKMGIKRAAVWPGGPGDLALALHIPKLIEARIIDTDGAPMKNEL  378

Query  577  FQFAPTMP  600
               A  +P
Sbjct  379  IHLAEDIP  386



>ref|XP_002281128.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
Length=456

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 111/177 (63%), Gaps = 2/177 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+LV+P+PAQGHV PLM+LA  ++ HG I +TFV T+  H++I+ +S  +       I
Sbjct  4    RPHVLVVPFPAQGHVAPLMKLAHKVSDHG-IKVTFVNTEFIHAKIM-ASMPDKDGKQSRI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             LVSV D      + N    L E+I  +MPG V+ LI  IN ++ +  ITCVIAD ++GW
Sbjct  62   ELVSVPDGLNPEANRNDAVMLTESILTVMPGHVKDLIEKINRTNDDEKITCVIADTTVGW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            ALE+A+K+G++ AA  P    +L L  +IPKLI+  II+ +G P +N+    A  +P
Sbjct  122  ALEVAEKMGIKRAAVWPGGPGDLALALHIPKLIEARIIDTDGAPMKNELIHLAEDIP  178



>ref|XP_006650614.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Oryza brachyantha]
Length=461

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 111/182 (61%), Gaps = 3/182 (2%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA--LDDGI  249
            H+LV+P P QGHV PLMEL+  LA  G   +TFV T+  H+ +L +      A   + GI
Sbjct  6    HVLVLPMPCQGHVTPLMELSHRLADEG-FEVTFVNTEVDHALVLGALPAGGAAELRERGI  64

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
            HL  + D     E      KL +A S+ MPG +E+LIR + A+     +  ++ D ++GW
Sbjct  65   HLAFIPDGLADGEDRKDINKLVDAYSRHMPGHLERLIRDMEAAGGRPKVRWLVGDVNMGW  124

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            +  +A+KLG++ A+F PAAAA L +   IPKL++DG++NN+G P   +T Q AP MP ++
Sbjct  125  SFVVARKLGIRVASFWPAAAACLAIMLKIPKLVEDGVLNNKGWPERQETLQLAPGMPPLH  184

Query  610  TS  615
            TS
Sbjct  185  TS  186



>gb|EYU44185.1| hypothetical protein MIMGU_mgv1a020666mg [Erythranthe guttata]
Length=460

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA-LDDGI  249
            PH++ IPYPAQGHVIP+M++AQ LA +G + +TFV T+  H ++  + AL+    + + +
Sbjct  5    PHVVAIPYPAQGHVIPMMKVAQYLAENG-LKVTFVNTEFNHQRV--TKALSQTGNIHELV  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
            +LVS+ D  ES E  N  GKL EA  KIMP ++E LI+ +N + S+  ITCV+ D  +  
Sbjct  62   NLVSIPDGLESWEDRNEHGKLAEASVKIMPKELENLIQEMNRTESDDIITCVLVDFYMAG  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
             L + +K G++ AAFLPA  A L L  N+ KL+DDGI++ +G P  N+  Q AP MP M+
Sbjct  122  ILPVVEKFGIKRAAFLPAPVALLALTLNVQKLVDDGIVDADGTPLTNQPIQLAPLMPKMS  181



>ref|XP_009599633.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Nicotiana tomentosiformis]
Length=459

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 119/181 (66%), Gaps = 3/181 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PHI+ IPYPAQGHV+PLMEL+  L + G   ITFV ++  H +++ + + N+  +   I 
Sbjct  5    PHIVAIPYPAQGHVLPLMELSLWLVKEG-CKITFVNSEFNHKRVIKALSEND-DVQKKIS  62

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            LVS+ D     E      KL EAI+++MPGK+E++I  IN    ++ ++CVI D+++GWA
Sbjct  63   LVSIPDGLGPEEDRTDLKKLTEAIAEVMPGKLEEVINMIN-ECDKNGVSCVIVDENMGWA  121

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            L +A+KL ++  AF PAAAA L   F++ KLIDDGII++EG   + +  + +P MP MN 
Sbjct  122  LGVAEKLNIRRVAFWPAAAATLASLFSVSKLIDDGIIDSEGAILKKQGIKLSPNMPIMNP  181

Query  613  S  615
            S
Sbjct  182  S  182



>ref|XP_009790320.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Nicotiana sylvestris]
Length=458

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 119/181 (66%), Gaps = 3/181 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PHI+ IPYPAQGHV+PLMEL+  L + G   ITFV ++  H +++ + + N+  +   I 
Sbjct  5    PHIVAIPYPAQGHVLPLMELSLWLVKEG-CKITFVNSEFNHKRVIKALSEND-DVQKKIS  62

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            LVS+ D     E      KL EAI+++MPGK+E++I  IN    E+ ++CVI D+++GWA
Sbjct  63   LVSIPDGLGPEEDRTDLKKLTEAIAEVMPGKLEEVINMIN-ECDENGVSCVIVDENMGWA  121

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            L +A+KL ++  AF PAAAA L   F++ KLIDDGII+++G   + +  + +P MP MN 
Sbjct  122  LGVAEKLNIRRVAFWPAAAAMLASLFSVSKLIDDGIIDSDGAILKKQGIKLSPNMPIMNP  181

Query  613  S  615
            S
Sbjct  182  S  182



>emb|CDP20467.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 125/185 (68%), Gaps = 5/185 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            MG PH+L IPY AQGHV+ LMELA CL +  GI +TFV T+  H +++ S S   NV   
Sbjct  1    MGIPHVLAIPYTAQGHVLLLMELALCLVK-SGIKVTFVNTEFDHKRVIESLSGEGNVP--  57

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D +HLVS+ D  ES +  N  GKL + I ++MP K+E L+  IN S ++  ITC+I D+S
Sbjct  58   DMMHLVSIPDGLESWDDRNDLGKLTKTIFRVMPAKLEALMEKINESETDK-ITCLITDES  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+AKK+GV+  AF PAAAA   L  NIPKLI DGII++ G   +N+  Q +PT+ 
Sbjct  117  MGWALEIAKKMGVRAVAFWPAAAAVSALELNIPKLIHDGIIDSSGSVLKNQMVQLSPTIL  176

Query  601  FMNTS  615
             M+++
Sbjct  177  AMDSA  181



>ref|XP_002526117.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36311.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=458

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 116/182 (64%), Gaps = 4/182 (2%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSA-LNNVALDDGIH  252
            H++VIPYPAQG+V PLM L+Q +A  G   +TF+ T   H +++++ A +N   L   ++
Sbjct  6    HVIVIPYPAQGNVNPLMHLSQRIASLG-FKVTFIHTDFNHKRVVSAMAEINGDPLGSTVN  64

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS--SESHITCVIADQSLG  426
            LVS+ D        N  GKL EAI   MP K+E+LI+ IN ++   +  I C+IAD  +G
Sbjct  65   LVSIPDGMGPEGDRNDLGKLCEAILSTMPKKLEELIQNINKTNEGDDDAINCIIADGHVG  124

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            WA E+A+K+G++ A   PA+AA+  LG NIPKLIDDG IN +G  A+ +  Q +P +P  
Sbjct  125  WAREVAEKMGIKLAVVWPASAASFSLGANIPKLIDDGCINADGFSAKKQMIQLSPGIPTF  184

Query  607  NT  612
            +T
Sbjct  185  DT  186



>emb|CBI21226.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ H+L IPY AQGHVIPLMEL+Q L  HG   +TFV T  +  +I+ S A  +  + D
Sbjct  1    MGSLHVLAIPYAAQGHVIPLMELSQNLVMHG-FKVTFVNTDFSQERIVKSFAGKD-DVRD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E+ E  N  GK  E I ++MP K+E+LI+ IN  + +  I CVIAD  +
Sbjct  59   QIRLVSIPDGLEAWEDRNDLGKACEGILRVMPKKLEELIQEIN-RTDDHEIACVIADGHM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+KLG++ AAF P+AAA +VL F +  LIDDGI++++G P +++ F  +P MP 
Sbjct  118  GWALEVAEKLGIKRAAFWPSAAAMMVLTFRMQNLIDDGIVDDDGTPVKSQKFHLSPNMPT  177

Query  604  MNTS  615
            +NT+
Sbjct  178  INTA  181



>ref|XP_002279246.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
Length=454

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ H+L IPY AQGHVIPLMEL+Q L  HG   +TFV T  +  +I+ S A  +  + D
Sbjct  1    MGSLHVLAIPYAAQGHVIPLMELSQNLVMHG-FKVTFVNTDFSQERIVKSFAGKD-DVRD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E+ E  N  GK  E I ++MP K+E+LI+ IN  + +  I CVIAD  +
Sbjct  59   QIRLVSIPDGLEAWEDRNDLGKACEGILRVMPKKLEELIQEIN-RTDDHEIACVIADGHM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+KLG++ AAF P+AAA +VL F +  LIDDGI++++G P +++ F  +P MP 
Sbjct  118  GWALEVAEKLGIKRAAFWPSAAAMMVLTFRMQNLIDDGIVDDDGTPVKSQKFHLSPNMPT  177

Query  604  MNTS  615
            +NT+
Sbjct  178  INTA  181



>dbj|BAJ90186.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92934.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 113/184 (61%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   H+LV+P P QGHV+PLMEL+  L  HG   +TF+ T   H+ +L +      AL  
Sbjct  1    MAKGHVLVLPMPCQGHVVPLMELSHRLVDHG-FEVTFINTDVDHALVLAALPEGVEALR-  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GIHL S+ D    +E      KL +A  + MP  +E LI  + A+     +  +IAD ++
Sbjct  59   GIHLASIPDGLADDEDRKDLNKLVDAYPRHMPAYLEALIGDMEAAGRR-RVKWLIADFNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW+LE+AKKLG++ A+F PA+AA L +  NIPKLI DG++N++G P   +T Q AP MP 
Sbjct  118  GWSLEVAKKLGIRCASFWPASAACLAIMLNIPKLIQDGVLNDKGWPDREETLQLAPGMPP  177

Query  604  MNTS  615
            ++TS
Sbjct  178  LHTS  181



>gb|KDO42893.1| hypothetical protein CISIN_1g043556mg, partial [Citrus sinensis]
Length=166

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 3/164 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M NPH+LVIP PAQGHVIPL+E +QCLA H G+ +TFV ++  H ++L S    N  L++
Sbjct  1    MSNPHVLVIPAPAQGHVIPLLEFSQCLANH-GVRVTFVNSEYNHQRVLKSLEGKN-NLEE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  G   + I ++MPG +E+LI  IN    E  I C IAD  +
Sbjct  59   KIRLVSIPDGMEPWEDRNELGNKLKKILQVMPGNLEELIEEINEKEDEK-IDCFIADAYM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            GW + +A+K+ ++     P++AA++ L F IPKLIDDGII+++G
Sbjct  118  GWTMRIAEKMKLRRGVVWPSSAASVALCFRIPKLIDDGIISSDG  161



>ref|XP_002526109.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36303.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=409

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 103/184 (56%), Gaps = 47/184 (26%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PHIL IPYPAQGHVIPLMEL+  L +                               
Sbjct  1    MGKPHILAIPYPAQGHVIPLMELSLSLLKQ------------------------------  30

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
                                G+L E I ++MPGK+E LI  INAS  E  +TCVIAD+S+
Sbjct  31   ----------------RKDLGRLVEGIYQVMPGKLEVLINTINASEDEK-VTCVIADESM  73

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+AKK+ ++ A F PA+AA L L F+  KLIDDGII+N+G P +N+  Q +PTMP 
Sbjct  74   GWALEVAKKMKIRRAVFWPASAAALCLLFSTQKLIDDGIIDNDGTPLKNQIIQLSPTMPA  133

Query  604  MNTS  615
            MNT+
Sbjct  134  MNTA  137



>emb|CAN60198.1| hypothetical protein VITISV_004920 [Vitis vinifera]
Length=568

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+ H+L IPY AQGHVIPLMEL+Q L  HG   +TFV T  +  +I+ S A  +  + D
Sbjct  1    MGSLHVLAIPYAAQGHVIPLMELSQNLVMHG-FKVTFVNTDFSQERIVKSFAGKD-DVRD  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E+ E  N  GK  E I ++MP K+E+LI+ IN  + +  I CVIAD  +
Sbjct  59   QIRLVSIPDGLEAWEDRNDLGKACEGILRVMPKKLEELIQEIN-RTDDHEIACVIADGHM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+A+KLG++ AAF P+AAA +VL F +  LIDDGI++++G P +++ F  +P MP 
Sbjct  118  GWALEVAEKLGIKRAAFWPSAAAMMVLTFRMQNLIDDGIVDDDGTPVKSQKFHLSPNMPT  177

Query  604  MNTS  615
            +NT+
Sbjct  178  INTA  181



>gb|KDO58817.1| hypothetical protein CISIN_1g040997mg, partial [Citrus sinensis]
Length=128

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M +PH+LV+P PAQGHVIPL+E +QCLA+H G  +TFV T   H +++ S    N  L++
Sbjct  1    MSSPHVLVMPGPAQGHVIPLLEFSQCLAKH-GFRVTFVNTDYYHKRVVESLQGKNY-LEE  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  N  GKL E   ++MPGK+EKLI  IN+   E  I C IAD ++
Sbjct  59   QIRLVSIPDGMEPWEDRNDFGKLIENFLQVMPGKLEKLIEEINSREDEK-IDCFIADGNM  117

Query  424  GWALELAKKL  453
            GW+LE+AKK+
Sbjct  118  GWSLEVAKKM  127



>ref|XP_003531850.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=451

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 117/186 (63%), Gaps = 7/186 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG  H+LV+P+PAQGHV PLM L++ LA HG   +TFV T   H ++L+++     A   
Sbjct  1    MGIQHVLVLPFPAQGHVNPLMLLSKKLAEHG-FKVTFVNTDFNHKRVLSATNEEGSA---  56

Query  244  GIHLVSVLDA-SESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH-ITCVIADQ  417
             + L+S+ D     ++ +NV     E++S  M   +EK+I+ I+A  S S  IT ++AD 
Sbjct  57   -VRLISIPDGLGPEDDRNNVVNLCSESLSSTMTSALEKVIKDIDALDSASEKITGIVADV  115

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            ++ WALEL  KLG++ A F PA+AA LVLG NIP LI DGIIN EG P     FQ +P M
Sbjct  116  NMAWALELTDKLGIKGAVFCPASAAVLVLGENIPNLIQDGIINTEGFPIIKGKFQLSPEM  175

Query  598  PFMNTS  615
            P M+T+
Sbjct  176  PIMDTA  181



>emb|CDM81053.1| unnamed protein product [Triticum aestivum]
Length=469

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 108/188 (57%), Gaps = 7/188 (4%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD--  243
             PH+L +P P QGHVIPLMEL+ CL  HG I +TFV TQ  H  IL S  L+        
Sbjct  5    TPHVLALPLPTQGHVIPLMELSHCLVEHG-IKVTFVNTQHNHDLILASLHLSKSEHGSSL  63

Query  244  -GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSES---HITCVIA  411
             G+ +VS+ D     +       L ++ S  MPG++EKLI  ++ S SES    +T +IA
Sbjct  64   GGVDMVSLPDGLADGDDRKDLALLTQSFSDAMPGELEKLIGRVHESESESGAYKLTWIIA  123

Query  412  DQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAP  591
            D S+ WA  +AK+LG++ AAF P + A       IP+LI DG+++ +G P    TF+ AP
Sbjct  124  DASMAWAFPVAKRLGLRAAAFNPLSVAMFATRIRIPELIRDGVVDEKGRPKRRGTFRLAP  183

Query  592  TMPFMNTS  615
             MP M  +
Sbjct  184  GMPPMRAT  191



>ref|XP_010936390.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Elaeis guineensis]
Length=452

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PH L++PYPAQGHVIPL+EL+ CL  +G   ITFV T+  H ++L + +     +  
Sbjct  1    MSLPHALILPYPAQGHVIPLLELSYCLIDNG-FKITFVNTENNHKRVLANLSKKEGEMK-  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI+LV+V D  ES E     G++ +   K MP  +E+LIR  N  S +  ITC+I D S+
Sbjct  59   GINLVAVPDGLESEEDRKDLGRVNDGFLKNMPICLEELIRRSN-ESEDDRITCMIIDVSM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+AKK+G++ AAF PA+A  L    +IPKLI++G+I+ EG   + + FQ    MP 
Sbjct  118  GWALEIAKKMGLRAAAFWPASAGILATTLSIPKLIENGVIDPEGT-LKQQMFQLDADMPP  176

Query  604  MNTS  615
            MN++
Sbjct  177  MNSN  180



>ref|XP_004981710.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Setaria italica]
Length=457

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M    +LV+PYPAQGHVIP+MEL+  L  HG +  TFV T+  H  IL + A  +  L  
Sbjct  1    MAATRVLVLPYPAQGHVIPMMELSHSLVEHG-VKGTFVNTELNHGLILGALASRDSVLG-  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSS-ESHITCVIADQS  420
            G+ +VSV D     E      +L ++ SK+MP ++ KL+  INA +     IT ++AD +
Sbjct  59   GVDMVSVPDGLGCGEDRKDLARLTDSFSKVMPVELGKLVARINADARGRGRITWLVADVN  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + WA  +AK+LG++ A F P++AA       IP++I DGI+++ G P    TFQ AP MP
Sbjct  119  MAWAFPVAKRLGLRAAGFCPSSAAMFATRIRIPEMISDGILDDRGWPRRRGTFQLAPAMP  178

Query  601  FMNTS  615
             ++TS
Sbjct  179  PIDTS  183



>ref|XP_008379417.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=450

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 117/183 (64%), Gaps = 7/183 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHI+ IPYPAQGHVIPLME +Q LA HG I ++FV  +  H +I+ + A  ++    
Sbjct  1    MSRPHIVAIPYPAQGHVIPLMEFSQSLANHG-IKVSFVNXEYNHKRIVKALAGESL----  55

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  +   ++ EA+  IMPGK+E+LI  IN    E ++TCV+AD  +
Sbjct  56   -IDLVSLPDGLEPWEDKSELEQISEALKWIMPGKLEELIEKINGGDGE-NVTCVMADHHI  113

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+A+K+ ++  AF PAAAA+L L  ++PK ID+GI++N+G   +++       MP 
Sbjct  114  FWALEVAEKMNIKAVAFWPAAAASLALLLSVPKYIDEGIVDNDGTVLKSQNVDMGTNMPT  173

Query  604  MNT  612
            M T
Sbjct  174  MKT  176



>ref|XP_004981715.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Setaria 
italica]
Length=456

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 114/185 (62%), Gaps = 3/185 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            M   HILV+P+PAQGHV PLMEL+  L  HG   +TFV T+  H+ ++ +  A    +  
Sbjct  1    MAKAHILVLPFPAQGHVTPLMELSHRLVDHG-FEVTFVNTEAHHALVVGALQAAGGTSAL  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
             GIHL S+ D  E +E      KL +  ++ MPG +E+L+  + A+     +  +++D  
Sbjct  60   AGIHLASISDGVEDDEDRKDISKLVDTYARHMPGHLERLVAEMEAAG-RPKVKWLVSDVY  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
              W+L +AK+LG++ A+F P +AA L +   IPKL ++G++NN+G P  ++TFQ AP +P
Sbjct  119  AWWSLNVAKRLGIRVASFWPGSAACLAINLKIPKLTEEGLLNNKGWPERDETFQLAPGIP  178

Query  601  FMNTS  615
             ++TS
Sbjct  179  PLHTS  183



>gb|KJB51019.1| hypothetical protein B456_008G197800 [Gossypium raimondii]
Length=458

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 110/182 (60%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH LVIPYPAQGHV PLM+LA  +A HG + +TF  T++TH++I  +S   NV     I
Sbjct  4    QPHALVIPYPAQGHVAPLMKLALQIASHG-VKVTFANTESTHAKI-KASLPENVEEAHLI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
              VS+ D  E ++      KL ++I + MPG +E  I  +N S++    TCV+AD S+GW
Sbjct  62   SFVSLPDGMEPDDDRTDWVKLNDSIHRTMPGYLEDFILKVNGSNANQKFTCVVADTSVGW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            ALELAKK G+Q  A  PA    L L  +IP+L++ GII+ +G   +++    +  +P   
Sbjct  122  ALELAKKAGLQAVAVWPAGGPCLALALHIPQLLEAGIIDTDGTVLKDEAISVSKDVPAWT  181

Query  610  TS  615
            ++
Sbjct  182  ST  183



>ref|XP_003621425.1| UDP-glucosyltransferase HRA25 [Medicago truncatula]
 gb|AES77643.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=440

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 108/184 (59%), Gaps = 5/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH LVIPYP  GH+ PLM+L   LA+HG   ITF+ T+ +H +  N    NN    +
Sbjct  1    MGIPHFLVIPYPIPGHINPLMQLCHVLAKHG-CKITFLNTEFSHKRTNN----NNEQSQE  55

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I+ V++ D  E  +  +   K+  +I + MP  + KLI  +NA   E+ I C+I   ++
Sbjct  56   TINFVTLPDGLEPEDDRSDQKKVLFSIKRNMPPLLPKLIEEVNALDDENKICCIIVTFNM  115

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+   LG++       +A +L   ++IPKLIDDG+I++ GI  +++  Q +P MP 
Sbjct  116  GWALEVGHNLGIKGVLLWTGSATSLAFCYSIPKLIDDGVIDSAGIYTKDQEIQLSPNMPK  175

Query  604  MNTS  615
            M+T 
Sbjct  176  MDTK  179



>gb|AFK45986.1| unknown [Medicago truncatula]
Length=440

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 108/184 (59%), Gaps = 5/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH LVIPYP  GH+ PLM+L   LA+HG   ITF+ T+ +H +  N    NN    +
Sbjct  1    MGIPHFLVIPYPIPGHINPLMQLCHVLAKHG-CKITFLNTEFSHKRTNN----NNEQSQE  55

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I+ V++ D  E  +  +   K+  +I + MP  + KLI  +NA   E+ I C+I   ++
Sbjct  56   TINFVTLPDGLEPEDDRSDQKKVLFSIKRNMPPLLPKLIEEVNALDDENKICCIIVTFNM  115

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+   LG++       +A +L   ++IPKLIDDG+I++ GI  +++  Q +P MP 
Sbjct  116  GWALEVGHNLGIKGVLLWTGSATSLAFCYSIPKLIDDGVIDSAGIYTKDQEIQLSPNMPK  175

Query  604  MNTS  615
            M+T 
Sbjct  176  MDTK  179



>gb|KCW83702.1| hypothetical protein EUGRSUZ_B00577, partial [Eucalyptus grandis]
Length=468

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 117/182 (64%), Gaps = 3/182 (2%)
 Frame = +1

Query  55   QSRMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA  234
            +S    PHI+ IP+PAQGHV PL++L++ +A HG I +TFV T++ H+++L +S  ++  
Sbjct  7    ESMERRPHIVAIPFPAQGHVGPLLKLSRQVAHHG-IRVTFVNTESVHARMLKASGDDDRR  65

Query  235  LDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
             D GI +V++ D  E  +      K+ E  +K+M    E+L+R +N+S  E  + C++AD
Sbjct  66   WD-GIEMVTIPDGMEEVKDPRDIEKVAEMRAKVMSCHFEELLRKMNSSRDE-RVACIVAD  123

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
             +LGWA E+A+K+G++ A F PAA   LVL  ++P L++ G+I++ G    +   QF+P 
Sbjct  124  ATLGWAFEVAEKMGIKRALFWPAAVPGLVLSLSLPHLVEAGVIDDCGSAPSDTAIQFSPK  183

Query  595  MP  600
            +P
Sbjct  184  LP  185



>ref|XP_010030531.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
Length=460

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 115/177 (65%), Gaps = 3/177 (2%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PHI+ IP+PAQGHV PL++L++ +A HG I +TFV T++ H+++L +S  ++   D GI
Sbjct  4    RPHIVAIPFPAQGHVGPLLKLSRQVAHHG-IRVTFVNTESVHARMLKASGDDDRRWD-GI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             +V++ D  E  +      K+ E  +K+M    E+L+R +N+S  E  + C++AD +LGW
Sbjct  62   EMVTIPDGMEEVKDPRDIEKVAEMRAKVMSCHFEELLRKMNSSRDE-RVACIVADATLGW  120

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            A E+A+K+G++ A F PAA   LVL  ++P L++ G+I++ G    +   QF+P +P
Sbjct  121  AFEVAEKMGIKRALFWPAAVPGLVLSLSLPHLVEAGVIDDCGSAPSDTAIQFSPKLP  177



>ref|XP_010026704.1| PREDICTED: UDP-glycosyltransferase 83A1-like, partial [Eucalyptus 
grandis]
Length=259

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 12/181 (7%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG---  246
            H+L IP+PAQGHV PL++L+ C+A HG I +T V T++ H+Q++ ++ L     DDG   
Sbjct  6    HVLCIPFPAQGHVTPLLKLSHCIADHG-IKVTVVNTESVHTQVMAANQL-----DDGSNP  59

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHITCVIADQ  417
            I  V+  D  E++E      KL E+IS++MPG +++ I  +   S    +  I  VIAD 
Sbjct  60   IDFVAFPDGLETDEERKDWVKLLESISRVMPGYLQEFIEKVKQQSKGNEDEQINFVIADL  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GWALE+A+++G++ A F PA+ ++L L  +I KLI+ G+I+NEGI  +N     +  +
Sbjct  120  TAGWALEVAERMGIKRAGFWPASVSSLALTLHIRKLIEGGVIDNEGIALKNDAISISKDL  179

Query  598  P  600
            P
Sbjct  180  P  180



>ref|XP_004981713.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Setaria italica]
Length=456

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 113/184 (61%), Gaps = 2/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   HILV+ +PAQGHV PLMEL+  L   G   +TFV T+  H+++L++      A+  
Sbjct  1    MAKAHILVLSFPAQGHVTPLMELSHRLVDQG-FEVTFVNTEMQHARVLSALPAGGAAVLG  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GIHL S+ D   ++E      KL ++  + MPG +E+L+  + A+        ++ D +L
Sbjct  60   GIHLASIPDGLANDEDRKDLSKLVDSCYQHMPGHLERLVAEMEAAG-RPKFKWLVGDMTL  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            G   E AKKLGV+ A+F  A+AA L +  NIPKL+++G+IN +G P  ++TFQ AP MP 
Sbjct  119  GACSEAAKKLGVRLASFWTASAACLAIMLNIPKLVEEGLINEQGWPERDETFQVAPEMPP  178

Query  604  MNTS  615
            ++T+
Sbjct  179  LHTT  182



>ref|XP_004489460.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Cicer arietinum]
Length=458

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 108/187 (58%), Gaps = 8/187 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+P+PAQGH+IPLM  ++ L  HG   + FV T   H  ++NS  +    LDD
Sbjct  1    MSIPCVLVLPFPAQGHIIPLMNFSKKLVEHG-CKVIFVNTDFNHKLVMNS--MGEQQLDD  57

Query  244  ----GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIA  411
                 + LVS+ D    +E      KL   +   MP  +EKLI+ I   +    I+C++A
Sbjct  58   SFNGALKLVSISDGLRHDEDRTNFAKLCVTMLSTMPNMLEKLIKEI-CLNDNCRISCMVA  116

Query  412  DQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAP  591
            D  +GWAL++  K G+    F  ++AA   L +NIPKL+DDGII++ G+ A  KTFQ +P
Sbjct  117  DVIMGWALDVGSKFGINGTLFWSSSAAMFALLYNIPKLMDDGIIDSNGLSATKKTFQLSP  176

Query  592  TMPFMNT  612
             MP M+T
Sbjct  177  NMPMMDT  183



>gb|EAZ28639.1| hypothetical protein OsJ_12648 [Oryza sativa Japonica Group]
Length=470

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 117/196 (60%), Gaps = 21/196 (11%)
 Frame = +1

Query  67   GNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD-  243
            G  H+L +P+PAQGHVIPLMELA CL  HG + +TFV T+  H +IL        ALDD 
Sbjct  4    GESHVLALPFPAQGHVIPLMELAHCLVEHG-VKVTFVNTEVNHGRILG-------ALDDA  55

Query  244  -------GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSE-----  387
                   G+ +VS+ D     +  +  G+L E++   MP ++EKL+  INAS+S      
Sbjct  56   SHGGELGGVDMVSISDGLGHGDDRSDLGRLTESLLLAMPSELEKLVGRINASASAAGGGG  115

Query  388  SHITCVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAE  567
              +T ++AD ++ WA  +AKKLG++ A F P++AA  V    IP+L+ DG+++  G+P  
Sbjct  116  REVTWMVADVNMAWAFPVAKKLGLRVAGFCPSSAAMFVTRIRIPELVRDGVLDESGMPRW  175

Query  568  NKTFQFAPTMPFMNTS  615
               F+ AP MP ++T+
Sbjct  176  RGAFRLAPAMPPVDTA  191



>ref|NP_001051321.2| Os03g0757100 [Oryza sativa Japonica Group]
 gb|AAK16180.1|AC079887_12 putative glucosyltransferase [Oryza sativa Japonica Group]
 gb|ABF98965.1| Glucosyl transferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13235.2| Os03g0757100 [Oryza sativa Japonica Group]
Length=470

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 117/196 (60%), Gaps = 21/196 (11%)
 Frame = +1

Query  67   GNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD-  243
            G  H+L +P+PAQGHVIPLMELA CL  HG + +TFV T+  H +IL        ALDD 
Sbjct  4    GESHVLALPFPAQGHVIPLMELAHCLVEHG-VKVTFVNTEVNHGRILG-------ALDDA  55

Query  244  -------GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSE-----  387
                   G+ +VS+ D     +  +  G+L E++   MP ++EKL+  INAS+S      
Sbjct  56   SHGGELGGVDMVSISDGLGHGDDRSDLGRLTESLLLAMPSELEKLVGRINASASAAGGGG  115

Query  388  SHITCVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAE  567
              +T ++AD ++ WA  +AKKLG++ A F P++AA  V    IP+L+ DG+++  G+P  
Sbjct  116  REVTWMVADVNMAWAFPVAKKLGLRVAGFCPSSAAMFVTRIRIPELVRDGVLDESGMPRW  175

Query  568  NKTFQFAPTMPFMNTS  615
               F+ AP MP ++T+
Sbjct  176  RGAFRLAPAMPPVDTA  191



>ref|XP_010039073.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
 gb|KCW48894.1| hypothetical protein EUGRSUZ_K02516 [Eucalyptus grandis]
Length=459

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 120/186 (65%), Gaps = 11/186 (6%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH-  252
            H+LVIP+PAQGHVIPL++L+ C+A +G + +TFV T++ H+Q++ +    N  LDD  H 
Sbjct  6    HVLVIPFPAQGHVIPLLKLSHCIADYG-VKLTFVNTESIHAQVMTA----NPGLDDESHR  60

Query  253  --LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSS---ESHITCVIADQ  417
               V++ D  E++E    P K  +++ ++MPG +++LI  +   S+   +  I+ +IAD 
Sbjct  61   IKFVAIPDGLETDEERKDPIKRLDSMLRVMPGHLQELIEKVKKQSNGIEDEQISFLIADV  120

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
             +GWALE+A+++G+Q A F P + ++LVL  +IPKLI+ G+I+N G   +N   + +  +
Sbjct  121  MVGWALEVAERMGIQRATFCPPSVSSLVLALHIPKLIEGGVIDNNGFVLKNDLIRISKDL  180

Query  598  PFMNTS  615
                +S
Sbjct  181  RSYKSS  186



>gb|EMT00593.1| Putative UDP-glucosyltransferase [Aegilops tauschii]
Length=364

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 109/176 (62%), Gaps = 3/176 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH++V+P+PAQGHV PLMEL+  L  HG + +TFV T+     +L++ A +  ALD GI 
Sbjct  6    PHVMVLPFPAQGHVTPLMELSHRLVDHG-LRVTFVCTEPIRKLLLDALADDKKALD-GIR  63

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            LVSV D     +S    GK+   +   +PG VE+LIR   AS  E+ +  ++AD ++   
Sbjct  64   LVSVPDGLADGDSHRDLGKVLAGVLGRVPGYVEELIRETEASG-ENKVQWLVADATMACC  122

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
             ++A+ LGV+ A+  P++AA LV    IP+LI DG  +++G P  + TF+ AP MP
Sbjct  123  FQVARNLGVRVASVCPSSAACLVTSLRIPQLIHDGFFDDKGFPKRHGTFELAPGMP  178



>gb|AFK49004.1| unknown [Lotus japonicus]
Length=420

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH LVIPYP  GH+ PLM+ +Q +A+HG  NITF+ T+ +H +  +S +  +   + 
Sbjct  1    MGIPHFLVIPYPVMGHINPLMQFSQLVAKHG-CNITFLNTEFSHKRATSSGSGQDNLKES  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I  V++ D  +  +  N   K+  +I   M     KLI  INA   ++ ITC++   ++
Sbjct  60   RIKFVTLPDGLDPEDDRNDQVKVLFSIKSTMTPMFPKLIEDINALDKDNKITCIVVTMNM  119

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+  KLG++ A   P +A +L     IP L+DDG+I+++G+P + +  Q +P MP 
Sbjct  120  GWALEVGHKLGIKGALLWPPSATSLAFCDKIPNLLDDGVIDSDGLPLKKQEIQLSPNMPP  179

Query  604  MNTS  615
            M++ 
Sbjct  180  MDSD  183



>gb|EMT00420.1| Putative UDP-glucosyltransferase [Aegilops tauschii]
Length=394

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 108/185 (58%), Gaps = 14/185 (8%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD----  240
            PH++V+P+PAQGHV PLMEL+  L  HG + +TFV T+  H  +L+  AL   A D    
Sbjct  6    PHVMVLPFPAQGHVTPLMELSHRLVDHG-LRVTFVCTEPIHKLVLD--ALRRNADDGEAL  62

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            DGI LVSV D     +      K  + +S+ +PG VE+LIR       E+ +  ++ D +
Sbjct  63   DGIRLVSVPDGLADGDDRRDLCKFLDGLSRCIPGYVEQLIR-------ETKVRWLVGDAN  115

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +G   E+AKKLGV+ A   PA+AA L     +P+LI+DG  +++G P     F+ AP MP
Sbjct  116  MGLCFEVAKKLGVRVACVFPASAAGLGTLLRLPQLIEDGFFDDKGFPKRRGAFEIAPNMP  175

Query  601  FMNTS  615
             M TS
Sbjct  176  PMYTS  180



>gb|EAZ28640.1| hypothetical protein OsJ_12649 [Oryza sativa Japonica Group]
Length=430

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 105/186 (56%), Gaps = 3/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA--L  237
            M   H+LV+P P QGHVIP MEL+  LA  G   +TFV T+  H+ ++ +      A   
Sbjct  1    MAKGHVLVLPMPCQGHVIPFMELSHRLADEG-FEVTFVNTEVDHALVVAALPPGGAAELR  59

Query  238  DDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
              GIHL ++ D    +E      KL +A S+ MPG  E+LI  I A      +  ++ D 
Sbjct  60   QRGIHLTAIPDGLAEDEDRKDLNKLIDAYSRHMPGHFERLIGEIEAGGGRPKVRWLVGDV  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            ++GW+  +A++LG++   F PA+ A +     IPKLI+DG++N +G P   +T Q AP M
Sbjct  120  NMGWSFAVARRLGIRVVYFSPASTACIAFMRKIPKLIEDGVLNEKGWPERQETLQLAPGM  179

Query  598  PFMNTS  615
            P ++TS
Sbjct  180  PPLHTS  185



>ref|XP_006837097.1| hypothetical protein AMTR_s00110p00115790 [Amborella trichopoda]
 gb|ERM99950.1| hypothetical protein AMTR_s00110p00115790 [Amborella trichopoda]
Length=462

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSS--ALNNVAL  237
            MG  H L++PYPAQGH+IP+MEL++ +  HG I +TFV T  T  ++L++S  A      
Sbjct  1    MGVQHALMLPYPAQGHIIPMMELSRRMEEHGFI-VTFVNTDFTQKRVLDASMKAHTESHP  59

Query  238  DDG---IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVI  408
            + G   I LVS+ D  E +   N  G L EA+   MP  +E LI+ IN    +S +TC++
Sbjct  60   NKGTGCIRLVSIPDGLEPDADRNKLGALCEAMLSSMPNALETLIKDINGLEGDS-VTCIV  118

Query  409  ADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFA  588
            AD S+GWAL++AKKLG+  AAF PAAA  L +   + +LI  G+I  EG   +    QF+
Sbjct  119  ADVSMGWALDVAKKLGIPRAAFWPAAAGCLTVFLKLQELIQKGVITKEGELLDTHMIQFS  178

Query  589  PTMPFMN  609
            P MP MN
Sbjct  179  PKMPLMN  185



>gb|EAY91915.1| hypothetical protein OsI_13600 [Oryza sativa Indica Group]
Length=469

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 105/186 (56%), Gaps = 3/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA--L  237
            M   H+LV+P P QGHVIP MEL+  LA  G   +TFV T+  H+ ++ +      A   
Sbjct  1    MAKGHVLVLPMPCQGHVIPFMELSHRLADEG-FEVTFVNTEVDHALVVAALPPGGAAELR  59

Query  238  DDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
              GIHL ++ D    +E      KL +A S+ MPG  E+LI  I A      +  ++ D 
Sbjct  60   QRGIHLTAIPDGLAEDEDRKDLNKLIDAYSRHMPGHFERLIGEIEAGGGRPKVRWLVGDV  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            ++GW+  +A++LG++   F PA+ A +     IPKLI+DG++N +G P   +T Q AP M
Sbjct  120  NMGWSFAVARRLGIRVVYFSPASTACIAFMRKIPKLIEDGVLNEKGWPERQETLQLAPGM  179

Query  598  PFMNTS  615
            P ++TS
Sbjct  180  PPLHTS  185



>ref|NP_001051322.1| Os03g0757200 [Oryza sativa Japonica Group]
 gb|AAK16178.1|AC079887_10 putative glucosyltransferase [Oryza sativa Japonica Group]
 gb|ABF98966.1| Glucosyl transferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13236.1| Os03g0757200 [Oryza sativa Japonica Group]
 dbj|BAG92335.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 105/186 (56%), Gaps = 3/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA--L  237
            M   H+LV+P P QGHVIP MEL+  LA  G   +TFV T+  H+ ++ +      A   
Sbjct  1    MAKGHVLVLPMPCQGHVIPFMELSHRLADEG-FEVTFVNTEVDHALVVAALPPGGAAELR  59

Query  238  DDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
              GIHL ++ D    +E      KL +A S+ MPG  E+LI  I A      +  ++ D 
Sbjct  60   QRGIHLTAIPDGLAEDEDRKDLNKLIDAYSRHMPGHFERLIGEIEAGGGRPKVRWLVGDV  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            ++GW+  +A++LG++   F PA+ A +     IPKLI+DG++N +G P   +T Q AP M
Sbjct  120  NMGWSFAVARRLGIRVVYFSPASTACIAFMRKIPKLIEDGVLNEKGWPERQETLQLAPGM  179

Query  598  PFMNTS  615
            P ++TS
Sbjct  180  PPLHTS  185



>ref|XP_006602936.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=445

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 109/183 (60%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH L IP+P QGHV PLM+ +Q LA+H G  +TFV T+  H +   S A N      
Sbjct  3    MGIPHFLCIPFPVQGHVNPLMQFSQLLAKH-GCKVTFVHTEFNHKRAKTSGADN--LEHS  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LV++ D  ++ +  +   K+  +I   MP  + KLI  +NA   +  ITC+I   ++
Sbjct  60   QVGLVTLPDGLDAEDDRSDVTKVLLSIKSNMPALLPKLIEDVNALDVDKKITCIIVTFTM  119

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+  +LG++ A   PA+A +L     IPKLIDDGII+++G+P + +  Q +P MP 
Sbjct  120  SWALEVGHRLGIKGALLCPASATSLASVACIPKLIDDGIIDSQGLPTKKQEIQLSPNMPT  179

Query  604  MNT  612
            MNT
Sbjct  180  MNT  182



>emb|CDY37552.1| BnaA05g34170D [Brassica napus]
Length=186

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 108/156 (69%), Gaps = 10/156 (6%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH++ I YP QGHV PL+  ++ LA  G   ITFV T+  H++I+  S+L+  + DD
Sbjct  1    MGRPHVMFITYPEQGHVRPLLIFSRNLASQG---ITFVNTEFNHNRII--SSLSKPSHDD  55

Query  244  ----GIHLVSVLDA-SESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVI  408
                GI LVS+ D   +S E  NVPGKL E++   MP KVE+LI  + + +S + I+CV+
Sbjct  56   HVVDGIKLVSIPDGLDDSPEERNVPGKLSESVLHFMPTKVEELIERMISETSGAVISCVV  115

Query  409  ADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNI  516
            ADQSLGWA+E+A K G++ AAF PAAAA++VLGF+I
Sbjct  116  ADQSLGWAMEVAAKFGIRRAAFCPAAAASMVLGFSI  151



>ref|XP_009388394.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 113/185 (61%), Gaps = 7/185 (4%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
            +PH L++PYPAQGHVIPLM LA CL  HG   +TFV T+  +++++ + A    A    I
Sbjct  4    SPHALLLPYPAQGHVIPLMALAHCLVDHG-FKVTFVNTEFNYARLVAALADMEQAASGRI  62

Query  250  HLVSV---LDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
             LV+V   LD  +S   S++ GKL   + K +P  +E+LIR      S   ITCVIADQ 
Sbjct  63   ELVTVPDGLDLEDSGGRSDI-GKLTAGLLKAIPPCLEELIR--RRGDSGDQITCVIADQG  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + W LE+AKK+GV+ AA  PA+AA L    +IP+LI  G+I+  G+P     F+  P + 
Sbjct  120  MAWTLEVAKKMGVRAAAIWPASAAVLATMLSIPELIARGVIDANGLPMAEGVFELGPGVL  179

Query  601  FMNTS  615
             MNT+
Sbjct  180  PMNTA  184



>ref|XP_003621428.1| UDP-glucosyltransferase HRA25 [Medicago truncatula]
Length=441

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH L IPYP QGHV PLM+ +Q LA HG   +TF+ T+  H +     +   V+  D I 
Sbjct  5    PHFLAIPYPVQGHVNPLMQFSQILANHG-CKVTFLHTEFNHER-----SKTGVSEQDKIQ  58

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            +V++ D  E  +  +   K+  +I   MP ++ KLI  +NA + ++ I C+I   S+GWA
Sbjct  59   VVTLPDGLEPEDDRSDIKKVLLSIKSTMPPRLPKLIEEVNALNVDNKINCIIVTFSMGWA  118

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            LE+   LG++ A   PA++  L     IPKLI+DGII++EG P + +  Q +P +P MNT
Sbjct  119  LEVGHNLGIKGALLCPASSTTLACAVCIPKLIEDGIIDSEGNPTKKQEIQISPDIPMMNT  178

Query  613  S  615
            +
Sbjct  179  T  179



>gb|AES77646.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=441

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH L IPYP QGHV PLM+ +Q LA HG   +TF+ T+  H +     +   V+  D I 
Sbjct  5    PHFLAIPYPVQGHVNPLMQFSQILANHG-CKVTFLHTEFNHER-----SKTGVSEQDKIQ  58

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            +V++ D  E  +  +   K+  +I   MP ++ KLI  +NA + ++ I C+I   S+GWA
Sbjct  59   VVTLPDGLEPEDDRSDIKKVLLSIKSTMPPRLPKLIEEVNALNVDNKINCIIVTFSMGWA  118

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            LE+   LG++ A   PA++  L     IPKLI+DGII++EG P + +  Q +P +P MNT
Sbjct  119  LEVGHNLGIKGALLCPASSTTLACAVCIPKLIEDGIIDSEGNPTKKQEIQISPDIPMMNT  178

Query  613  S  615
            +
Sbjct  179  T  179



>gb|KCW59976.1| hypothetical protein EUGRSUZ_H02704 [Eucalyptus grandis]
Length=418

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 12/181 (7%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG---  246
            H+L IP+PAQGHV PL++L+ C+A HG I +T V T++ H+Q++ ++ L     DDG   
Sbjct  6    HVLCIPFPAQGHVTPLLKLSHCIADHG-IKVTVVNTESVHTQVMAANQL-----DDGSNP  59

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHITCVIADQ  417
            I  V+  D  E++E      KL E+IS++MPG +++ I  +   S    +  I  VIAD 
Sbjct  60   IDFVAFPDGLETDEERKDWVKLLESISRVMPGYLQEFIEKVKQQSKGNEDEQINFVIADL  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GWALE+A+++G++ A F PA+ ++L L  +I KLI+ G+I+NEGI  +N     +  +
Sbjct  120  TAGWALEVAERMGIKRAGFWPASVSSLALTLHIRKLIEGGVIDNEGIALKNDAISISKDL  179

Query  598  P  600
            P
Sbjct  180  P  180



>ref|NP_001168592.1| hypothetical protein [Zea mays]
 gb|ACN26763.1| unknown [Zea mays]
 gb|ACN28790.1| unknown [Zea mays]
 tpg|DAA51461.1| TPA: hypothetical protein ZEAMMB73_745958 [Zea mays]
Length=460

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (60%), Gaps = 4/182 (2%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNN--VALDDGI  249
            H+LV+P P QGHV PLMEL+  L   G   +TFV T    + ++ +   +    AL  GI
Sbjct  6    HVLVLPMPCQGHVTPLMELSHLLVDQG-FEVTFVNTDVDRAAVVAALEASGGVAALGGGI  64

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
            HL S+ D    +E      KL +A ++ MPG +E+L+  + A+        ++AD ++GW
Sbjct  65   HLASIPDGLADDEDRKDISKLVDAYTRHMPGYLERLLADMEAAG-RPRAKWLVADTNMGW  123

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            + E+AKKLG++  +F PAA A L     IPKLI DG+++++G+P   +TFQ AP MP ++
Sbjct  124  SFEVAKKLGIRVVSFWPAATACLAFMLKIPKLIQDGLLDDKGLPVRQETFQLAPGMPPLH  183

Query  610  TS  615
            +S
Sbjct  184  SS  185



>gb|EMT15057.1| Putative UDP-glucosyltransferase [Aegilops tauschii]
Length=437

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 113/182 (62%), Gaps = 10/182 (5%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH++V+P  AQGHV PLMEL+  L  H G+ +TFV T+ TH+ ++++  L    + +GIH
Sbjct  6    PHVMVLPLAAQGHVTPLMELSHRLVEH-GLEVTFVCTEPTHALVIDALRLRETTV-EGIH  63

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG-W  429
            LVS+ D     +     GK+ +A+S+ MPG VE+L+R       E  +T ++AD +LG  
Sbjct  64   LVSMPDGLADGDDRRDLGKVLDALSRCMPGYVEELVR-------EKKVTWLVADANLGSL  116

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
              E AKKLGV+ A+F PA+AA L     IP+LI+DG  +++G P   +  + AP MP + 
Sbjct  117  CFEAAKKLGVRVASFFPASAACLGTLSRIPQLIEDGFFDDKGFPKRREAVELAPEMPPVY  176

Query  610  TS  615
            TS
Sbjct  177  TS  178



>gb|KCW59981.1| hypothetical protein EUGRSUZ_H02712 [Eucalyptus grandis]
Length=445

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 12/181 (7%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG---  246
            H+L IP+PAQGHV PL++L+ C+A HG I +T V T++ H+Q++ ++ L     DDG   
Sbjct  6    HVLCIPFPAQGHVTPLLKLSHCIADHG-IKVTVVNTESVHTQVMAANQL-----DDGSNP  59

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHITCVIADQ  417
            I  V+  D  E++E      KL E+IS++MPG +++ I  +   S    +  I  VIAD 
Sbjct  60   IDFVAFPDGLETDEERKDWVKLLESISRVMPGYLQEFIEKVKQQSKGNEDEQINFVIADL  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GWALE+A+++G++ A F PA+ ++L L  +I KLI+ G+I+NEGI  +N     +  +
Sbjct  120  TAGWALEVAERMGIKRAGFWPASVSSLALTLHIRKLIEGGVIDNEGIALKNDAISISKDL  179

Query  598  P  600
            P
Sbjct  180  P  180



>ref|XP_010026710.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
Length=428

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 12/181 (7%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG---  246
            H+L IP+PAQGHV PL++L+ C+A HG I +T V T++ H+Q++ ++ L     DDG   
Sbjct  6    HVLCIPFPAQGHVTPLLKLSHCIADHG-IKVTVVNTESVHTQVMAANQL-----DDGSNP  59

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHITCVIADQ  417
            I  V+  D  E++E      KL E+IS++MPG +++ I  +   S    +  I  VIAD 
Sbjct  60   IDFVAFPDGLETDEERKDWVKLLESISRVMPGYLQEFIEKVKQQSKGNEDEQINFVIADL  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GWALE+A+++G++ A F PA+ ++L L  +I KLI+ G+I+NEGI  +N     +  +
Sbjct  120  TAGWALEVAERMGIKRAGFWPASVSSLALTLHIRKLIEGGVIDNEGIALKNDAISISKDL  179

Query  598  P  600
            P
Sbjct  180  P  180



>ref|XP_008348241.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Malus domestica]
Length=450

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 115/183 (63%), Gaps = 7/183 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  PHI+ IPYPAQGHVIPLME +Q L  HG I ++FV T+  H +I+ +     +A + 
Sbjct  1    MSRPHIVAIPYPAQGHVIPLMEFSQSLVNHG-IKVSFVNTEYNHKRIVKA-----LAGES  54

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  E  +   +L EA+  IMP K+E+LI  IN    E ++TCV+AD  +
Sbjct  55   LIDLVSLPDGLEPWEDKSELEQLSEAMKWIMPEKLEELIEKINGGEGE-NVTCVMADHHI  113

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+A+K+ V+  AF PAAAA+L +  ++PK ID+GI++ +G   +++       MP 
Sbjct  114  SWALEVAEKMNVKAVAFWPAAAASLAVVXSVPKYIDEGIVDKDGTILKSQNVDLGTNMPT  173

Query  604  MNT  612
            M T
Sbjct  174  MKT  176



>gb|KHN13560.1| UDP-glycosyltransferase 83A1 [Glycine soja]
Length=617

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 109/183 (60%), Gaps = 3/183 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH L IP+P QGHV PLM+ +Q LA+H G  +TFV T+  H +   S A N      
Sbjct  3    MGIPHFLCIPFPVQGHVNPLMQFSQLLAKH-GCKVTFVHTEFNHKRAKTSGADN--LEHS  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LV++ D  ++ +  +   K+  +I   MP  + KLI  +NA   +  ITC+I   ++
Sbjct  60   QVGLVTLPDGLDAEDDRSDVTKVLLSIKSNMPALLPKLIEDVNALDVDKKITCIIVTFTM  119

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
             WALE+  +LG++ A   PA+A +L     IPKLIDDGII+++G+P + +  Q +P MP 
Sbjct  120  SWALEVGHRLGIKGALLCPASATSLASVACIPKLIDDGIIDSQGLPTKKQEIQLSPNMPT  179

Query  604  MNT  612
            MNT
Sbjct  180  MNT  182



>ref|XP_010026718.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
Length=458

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 114/181 (63%), Gaps = 12/181 (7%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG---  246
            H+L IP+PAQGHV PL++L+QC+A HG I +T V T++ H+Q++ ++       DDG   
Sbjct  6    HVLCIPFPAQGHVTPLLKLSQCIANHG-IKVTVVNTESVHAQVMAANQP-----DDGSNR  59

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHITCVIADQ  417
            I+ V+  D  E++E      KL E+IS++MPG +++LI  +   S    +  I+ V+ D 
Sbjct  60   INFVAFPDGLETDEERKDWAKLLESISRVMPGHLQELIEKVKQQSKGNEDKQISFVMVDL  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
              GWALE+A+++G++ A F  A+ + L L  +IPKLI+ G+I+NEGI  ++     +  +
Sbjct  120  IAGWALEVAERMGIKRAGFWAASVSALALTLHIPKLIEGGVIDNEGIALKSDVIPISKDL  179

Query  598  P  600
            P
Sbjct  180  P  180



>ref|XP_003621430.1| UDP-glucosyltransferase HRA25 [Medicago truncatula]
 gb|AES77648.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=442

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 109/181 (60%), Gaps = 6/181 (3%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH LVIP+P QGHV PLM+ +Q LA+HG   +TF+ T+  H +     +   V   D I 
Sbjct  5    PHFLVIPFPVQGHVNPLMQFSQVLAKHG-CKVTFLHTEFNHKR-----SKTGVFEQDKIQ  58

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
            ++++ D  ES +  +   K+  +I   MP K+ KLI  +NA + ES I C++   ++GWA
Sbjct  59   VMTLPDGLESEDDRSDIKKVILSIKSTMPSKLPKLIEEVNALNVESKINCIVVTFNMGWA  118

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            LE+   LG++ A   PA+A  L  G  + KLI+DGII+++G P + +  Q +P +P M+T
Sbjct  119  LEVGHNLGIKGALLFPASATTLACGVCVHKLIEDGIIDSQGNPTKKQEIQISPDIPMMDT  178

Query  613  S  615
            +
Sbjct  179  T  179



>ref|XP_007139509.1| hypothetical protein PHAVU_008G035800g [Phaseolus vulgaris]
 gb|ESW11503.1| hypothetical protein PHAVU_008G035800g [Phaseolus vulgaris]
Length=445

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 109/186 (59%), Gaps = 4/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQ--ILNSSALNNVAL  237
            MG PH L+IPYP+ GHV PLM+L+  LARHG   ITF+ T+  H +        L+N   
Sbjct  1    MGIPHFLLIPYPSVGHVNPLMQLSHVLARHG-CKITFLNTEFNHKRANTGGDDELDNPK-  58

Query  238  DDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
            +  I  V++ D     +  N P K+  ++   MP  + KLI+ INA    + ITC++   
Sbjct  59   EPQIKFVTLPDGLGPEDDRNDPKKVIFSLKTHMPDMLPKLIQDINALHVNNKITCIVVTI  118

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            ++GWALE+  KLG++ A   PA+A +L     IPKLI DGI++++G P E K  Q  P M
Sbjct  119  NMGWALEVGHKLGIKGALLWPASATSLATCDCIPKLIHDGILDSDGNPVEKKEIQLYPNM  178

Query  598  PFMNTS  615
            P M+T+
Sbjct  179  PMMDTA  184



>ref|XP_004981714.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Setaria 
italica]
Length=458

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 110/187 (59%), Gaps = 5/187 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   H+LV+P+PAQGHV PLMEL+  L  HG   +TFV T+  H+ ++ +          
Sbjct  1    MAKAHVLVLPFPAQGHVTPLMELSHRLVDHG-FEVTFVNTEVNHALVVGALQAAAGGGTS  59

Query  244  ---GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
               GIHL S+ D    +E      KL +  ++ MPG +E+LI  + A+     +  ++ D
Sbjct  60   ALAGIHLESISDGVADDEDRKDLNKLIDCCTRHMPGHLERLIAEMEAAG-RPKVKWLVPD  118

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
              + W+ ++AKK G++ A+F PAA A L +   IPKL ++G++NN+G P  ++TFQ AP 
Sbjct  119  VCMWWSFDVAKKFGIRVASFWPAAVACLAISLKIPKLTEEGLLNNKGWPERDETFQLAPG  178

Query  595  MPFMNTS  615
            +P ++TS
Sbjct  179  IPPLHTS  185



>ref|XP_010039072.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
 gb|KCW48893.1| hypothetical protein EUGRSUZ_K02515 [Eucalyptus grandis]
Length=462

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 114/181 (63%), Gaps = 11/181 (6%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD---G  246
            H+LVIP PAQGHV PL++L+ C+A +G + +TFV T++ H+Q++ +    N  LDD    
Sbjct  9    HVLVIPSPAQGHVTPLLKLSHCIADYG-VKVTFVNTESIHAQVMAA----NPGLDDESRR  63

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHITCVIADQ  417
            I  V++ D  E++E      K+ +++ ++MPG +++L+  +   S    +  I  VIAD 
Sbjct  64   IKFVAIPDGLETDEERRDSTKMVDSVLRVMPGHLQELLEQVKQQSKGNEDEQINFVIADL  123

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GW LE+A+++G++ A F PA+ + L L  NIPKLI+DG+I+N+G   +N     +  +
Sbjct  124  TAGWVLEVAERMGIERAGFWPASVSTLALTLNIPKLIEDGVIDNKGCALKNDLITISKDL  183

Query  598  P  600
            P
Sbjct  184  P  184



>ref|XP_003621427.1| UDP-glucosyltransferase HRA25 [Medicago truncatula]
 gb|AES77645.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=451

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 111/191 (58%), Gaps = 8/191 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQ-------ILNSSAL  222
            MG PH LVIPYP  GHV PLM+L+  L++HG   ITF+ T+ ++ +       I     L
Sbjct  1    MGVPHFLVIPYPIAGHVNPLMQLSHLLSKHG-CKITFLNTEFSNKRTNKNNISISKKDNL  59

Query  223  NNVALDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITC  402
             N    + I+ V++ D  E  ++ +   K+  +I + MP  +  LI  +NA  +E+ I+C
Sbjct  60   KNEQSQETINFVTLPDGLEDEDNRSDQRKVIFSIRRNMPPLLPNLIEDVNAMDAENKISC  119

Query  403  VIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQ  582
            +I   ++GWALE+   LG++      A+A +L   ++IPKLIDDG++++ GIP   +  Q
Sbjct  120  IIVTFNMGWALEVGHSLGIKGVLLWTASATSLAYCYSIPKLIDDGVMDSAGIPTTKQEIQ  179

Query  583  FAPTMPFMNTS  615
              P MP ++T+
Sbjct  180  LFPNMPMIDTA  190



>ref|XP_007139491.1| hypothetical protein PHAVU_008G034000g [Phaseolus vulgaris]
 gb|ESW11485.1| hypothetical protein PHAVU_008G034000g [Phaseolus vulgaris]
Length=442

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH L +P P QGHV PLM+ +  LA+HG   +TFV T+ +H +  N++  +N   + 
Sbjct  1    MGRPHFLCLPLPIQGHVNPLMQFSLLLAKHG-CKVTFVHTEFSHKRA-NTAGGDNKE-EA  57

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LV++ D  +  +  +   KL  ++   MP  + KLI+ I+AS  E+ ITC+I   ++
Sbjct  58   QVELVTLPDGLDPQDDRSDVAKLLLSMKSTMPALLPKLIQDIDASDVENKITCIIVTINM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GWALE+  KLG++ A   PA+A +L    +IPKLI DGII+++G+  + +  Q +PTMP 
Sbjct  118  GWALEVGHKLGIKGALLCPASATSLASAASIPKLIQDGIIDSQGLATKKQEIQLSPTMPK  177

Query  604  MNTS  615
            M+T+
Sbjct  178  MDTA  181



>ref|XP_010026719.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
Length=458

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 113/181 (62%), Gaps = 12/181 (7%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDG---  246
            H+L IP+P QGHV PL++L+ C+A HG I +T V T++ H+Q++ ++ L     DDG   
Sbjct  6    HVLCIPFPLQGHVTPLLKLSHCIADHG-IKVTVVNTESVHAQVMAANQL-----DDGSNP  59

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHITCVIADQ  417
            I  V+  D  E++E      KL E+IS++MPG +++ I  +   S    +  I  VIAD 
Sbjct  60   IDFVAFPDGLETDEERKDWAKLVESISRVMPGYLQEFIEKVKQQSKGNEDEQINFVIADL  119

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GWALE+A+++G++ A F PA+ ++L L  +I KLI+ G+I+NEGI  +N     +  +
Sbjct  120  TAGWALEVAERMGIKRAGFWPASVSSLALILHIRKLIEGGVIDNEGIALKNDAISISKDL  179

Query  598  P  600
            P
Sbjct  180  P  180



>gb|KDP27232.1| hypothetical protein JCGZ_19931 [Jatropha curcas]
Length=421

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 16/164 (10%)
 Frame = +1

Query  124  MELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIHLVSVLDASESNESSNVP  303
            MEL+QCLA+HG   ITFV  ++ H  I N+S  +  +  D I+LVS+ D +    S    
Sbjct  1    MELSQCLAKHG-FKITFVNAESNHQLIKNASTSSTSS--DQINLVSISDDAVKLSS----  53

Query  304  GKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWALELAKKLGVQTaaflpa  483
                +A+ ++MP KVE+LI  +N       I+C+IADQS+GWALE+A++ G++ AAF PA
Sbjct  54   ----DAVLRVMPSKVEELIEQLN-----DKISCIIADQSIGWALEIAERKGIRRAAFCPA  104

Query  484  aaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNTS  615
            AAA LVLGF+IPKLI DGII++ G P + +  + +PTMP MNT+
Sbjct  105  AAAQLVLGFSIPKLIQDGIIDDYGTPTKKEIVRISPTMPAMNTA  148



>emb|CDP11402.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 113/165 (68%), Gaps = 5/165 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS-SALNNVALD  240
            MG PH+L IPY AQGHV+ LMELA CL +  GI +TFV T+  H +++ S S   NV   
Sbjct  1    MGIPHVLAIPYTAQGHVLLLMELALCLVK-SGIKVTFVNTEFDHKRVIESLSGEGNVP--  57

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
            D +HLVS+ D  ES +  N  GKL + I ++MP K+E L+  IN S ++  ITC+I D+S
Sbjct  58   DMMHLVSIPDGLESWDDRNDLGKLTKTIFRVMPAKLEALMEKINESETDK-ITCLITDES  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            +GWALE+AKK+GV+  AF PAAAA   L  NIPKLI DGII++ G
Sbjct  117  MGWALEIAKKMGVRAVAFWPAAAAVSALELNIPKLIHDGIIDSSG  161



>ref|XP_003530432.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
 gb|KHN11177.1| UDP-glycosyltransferase 83A1 [Glycine soja]
Length=447

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILN---SSALNNVA  234
            M  PH L+IPYP  GHV PL++L+Q L +HG  NITF+ T+ +H ++ N   ++ L+N+ 
Sbjct  1    MATPHFLLIPYPVLGHVNPLIQLSQILIKHG-CNITFLNTEFSHKRLNNNTGAAGLDNLR  59

Query  235  LDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
               GI  V++ D     +  +   K+  +I   MP  + KLI+ +NAS   + ITC++A 
Sbjct  60   -RSGIKFVALPDGLGPEDDRSDQKKVVLSIKTNMPSMLPKLIQDVNASDVSNKITCIVAT  118

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
             S+ WAL++   LG++ A   PA+A +L L   IP+LI DG+I++ G+P   +  QF+  
Sbjct  119  LSMTWALKVGHNLGIKGALLWPASATSLALCDFIPRLIHDGVIDSRGVPIRRQQIQFSSN  178

Query  595  MPFMNT  612
            MP M+T
Sbjct  179  MPLMDT  184



>ref|XP_003559289.2| PREDICTED: uncharacterized protein LOC100829644 [Brachypodium 
distachyon]
Length=1188

 Score =   127 bits (319),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 71/184 (39%), Positives = 110/184 (60%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M   H++V+P P QGHV+PLMEL+  L  HG   +TFV T+  H+ +L +      AL  
Sbjct  1    MAKGHVMVLPMPCQGHVVPLMELSHRLVDHG-FEVTFVNTEVDHALVLAALPKGGEALR-  58

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GIHL S+ D    +E      KL +A S+ MPG +E L+  + A+     +  ++ D ++
Sbjct  59   GIHLASIPDGLADDEDRKDLNKLIDAYSRHMPGYLESLVADMEAAG-RPKVKWLVGDVNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW+  +A+KLG++ A+F PA+ A L +   IP LI DG++N++G P   +T + AP MP 
Sbjct  118  GWSFPVARKLGIRVASFWPASMACLAIMLKIPNLIQDGVLNDKGWPEREETLELAPGMPP  177

Query  604  MNTS  615
            ++TS
Sbjct  178  LHTS  181


 Score =   115 bits (288),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 74/191 (39%), Positives = 105/191 (55%), Gaps = 10/191 (5%)
 Frame = +1

Query  46   TFKQSRMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALN  225
            T+       PH++V+P+PAQGHV PLMEL+  L   G   +TFV T  TH  +LN  AL 
Sbjct  723  TYNDMAAAAPHVMVLPFPAQGHVTPLMELSHRLVERG-FQVTFVCTGLTHGLLLN--ALR  779

Query  226  NVA------LDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSE  387
                       +GI LV V D     +      K  +A+ + +PG +E LIR   AS + 
Sbjct  780  RTGDGGSGDTVEGIRLVPVPDGMADGDDRRDLCKFLDAVWRRVPGFLEDLIRETEASGA-  838

Query  388  SHITCVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAE  567
            + +  ++AD ++ +  ++AK LGV+ A   PAAAA L   F IPK+I DG I+ +GIP  
Sbjct  839  AKVKWLVADVNMWFCFQVAKNLGVRVAGVWPAAAACLGTSFAIPKMIQDGFIDEKGIPKR  898

Query  568  NKTFQFAPTMP  600
              T++ AP MP
Sbjct  899  QGTYEVAPKMP  909


 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 64/163 (39%), Positives = 96/163 (59%), Gaps = 4/163 (2%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS--SALNNVALDDG  246
            PH++V+P PAQGHV PLMEL+  L  H G  +TFV T  TH+ +L +     N     +G
Sbjct  493  PHVMVLPSPAQGHVTPLMELSHGLVDH-GFQVTFVCTGLTHALLLKALRQTPNGGDTLEG  551

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
            I LV + D     +      K  +A+S+ +PG VE LI+   A+ +   +  +I D ++G
Sbjct  552  IRLVPIPDGMADGDDRRDLCKFVDAVSRCVPGYVEGLIKASGAAPA-PRVKWLIGDVTMG  610

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            +  ++AK LGV+ AA  PA+AA+L   F IP++I DG I++ G
Sbjct  611  FCFQVAKDLGVRVAAVWPASAASLGTAFRIPQMIQDGFIDDMG  653



>ref|XP_009396737.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 104/182 (57%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH LV+P+PAQGHVIPL+EL+ CL  H G  ITFV T+  H+ I  +       +D  +
Sbjct  4    QPHALVVPFPAQGHVIPLLELSYCLVDH-GFKITFVNTEINHALIAAALPEGPSMMDPMV  62

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             LVS  D     E      KL + + K MP  +E+LI   +    E  ITC++ D    W
Sbjct  63   RLVSFDDGLAPGEDRRDLLKLRDCLMKTMPMCLEELILK-SHEPGEDKITCMVVDGMAPW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
             LE+A++ G+++AAF   AAA       IPKLI+DG+I+ +G P + + FQ AP +P MN
Sbjct  122  VLEVAREKGLRSAAFWSMAAAVAATIMKIPKLIEDGVIDADGFPMKQEMFQLAPGLPLMN  181

Query  610  TS  615
             +
Sbjct  182  PA  183



>ref|XP_007139492.1| hypothetical protein PHAVU_008G034100g [Phaseolus vulgaris]
 gb|ESW11486.1| hypothetical protein PHAVU_008G034100g [Phaseolus vulgaris]
Length=445

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 110/184 (60%), Gaps = 9/184 (5%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD---  243
            PH LVIPYP  GHV PL+ L+Q LA+HG  +ITF+ T+ +H ++    +   V LD+   
Sbjct  5    PHFLVIPYPVLGHVNPLIHLSQILAKHG-CSITFLNTEFSHKRL----STTGVGLDNLKG  59

Query  244  -GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
             GI  V++ D     +  +   K+  +I   MP  + KLI+ +NA  + + ITC++   S
Sbjct  60   SGIKFVTLPDGLGPEDDRSDQKKVVRSIKTNMPSMLPKLIQDLNALDANNKITCMVVTLS  119

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + WAL++   LG++     PA+A +L L   IP+LIDDG+I++ G+P+  +  Q +P MP
Sbjct  120  MTWALKVGHTLGIKGTLLWPASATSLALCDCIPRLIDDGVIDSYGVPSRRQKIQLSPNMP  179

Query  601  FMNT  612
             M+T
Sbjct  180  LMDT  183



>gb|KCW59998.1| hypothetical protein EUGRSUZ_H02732 [Eucalyptus grandis]
Length=846

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 116/189 (61%), Gaps = 12/189 (6%)
 Frame = +1

Query  52   KQSRMGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNV  231
            + +R    H+L IP+P QGHV PL++L+ C+A HG I +T V T++ H+Q++ ++ L   
Sbjct  386  EMARKSLKHVLCIPFPLQGHVTPLLKLSHCIADHG-IKVTVVNTESVHAQVMAANQL---  441

Query  232  ALDDG---IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESH  393
              DDG   I  V+  D  E++E      KL E+IS++MPG +++ I  +   S    +  
Sbjct  442  --DDGSNPIDFVAFPDGLETDEERKDWAKLVESISRVMPGYLQEFIEKVKQQSKGNEDEQ  499

Query  394  ITCVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENK  573
            I  VIAD + GWALE+A+++G++ A F PA+ ++L L  +I KLI+ G+I+NEGI  +N 
Sbjct  500  INFVIADLTAGWALEVAERMGIKRAGFWPASVSSLALILHIRKLIEGGVIDNEGIALKND  559

Query  574  TFQFAPTMP  600
                +  +P
Sbjct  560  AISISKDLP  568


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (60%), Gaps = 6/127 (5%)
 Frame = +1

Query  238  DDG---IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS---SESHIT  399
            DDG   I+ V+  D  E++E      KL E+IS++MPG +++LI  +   S    +  I+
Sbjct  7    DDGSNRINFVAFPDGLETDEERKDWAKLLESISRVMPGHLQELIEKVKQQSKGNEDKQIS  66

Query  400  CVIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTF  579
             V+ D   GWALE+A+++G++ A F  A+ + L L  +IPKLI+ G+I+NEGI  ++   
Sbjct  67   FVMVDLIAGWALEVAERMGIKRAGFWAASVSALALTLHIPKLIEGGVIDNEGIALKSDVI  126

Query  580  QFAPTMP  600
              +  +P
Sbjct  127  PISKDLP  133



>dbj|BAJ86871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 111/182 (61%), Gaps = 10/182 (5%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH++V+P  AQGHV PLMEL+  L  H G  +TFV T+ TH+ +L++       + DGI 
Sbjct  6    PHVMVLPLAAQGHVTPLMELSHRLVEH-GFEVTFVCTEPTHALVLDALRQRQPTV-DGIR  63

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG-W  429
            LVS+ D     +     GK+ +A+S+ MPG VE+LIR       E  +T ++AD +LG  
Sbjct  64   LVSMPDGLADVDDRRDLGKVLDALSRCMPGYVEELIR-------EKKVTWLVADANLGSL  116

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
              E+AKKLGV+ A+F PA+AA L     IP+LI+DG  +++G P   +  + AP MP + 
Sbjct  117  CFEVAKKLGVRVASFFPASAACLGTLSRIPQLIEDGFFDDKGFPKGREAVELAPEMPPVY  176

Query  610  TS  615
            TS
Sbjct  177  TS  178



>emb|CAN66174.1| hypothetical protein VITISV_022262 [Vitis vinifera]
Length=456

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 103/162 (64%), Gaps = 2/162 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH+L+IP+PAQGHV PLM+ A  ++ HG I +TFV +   H +++ +    + A   
Sbjct  1    MGRPHVLIIPFPAQGHVTPLMKFAYQISIHG-IKVTFVNSDFIHEKLVAALPDEDEARSR  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I L S+ D     E      KL ++I ++MPG +++LI  +N S+ +  ITCVIAD + 
Sbjct  60   -IGLASIPDGLGPGEDRKDSLKLTDSILRVMPGHLKELIEKVNNSNDDEKITCVIADSAF  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINN  549
            GWALE+A K+G++  AF P    +L L F+IP+LI+ G++N+
Sbjct  119  GWALEVADKMGIKRVAFCPFGPGSLALAFHIPRLIEAGLLNS  160



>ref|XP_010037222.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
 ref|XP_010037223.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
 gb|KCW48888.1| hypothetical protein EUGRSUZ_K02510 [Eucalyptus grandis]
Length=458

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 115/185 (62%), Gaps = 10/185 (5%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH-  252
            H+LVI +PAQGHVIPL++L+ C+A HG + +TFV  +  H+Q++ +    N  LD+  H 
Sbjct  6    HVLVISFPAQGHVIPLLKLSHCIADHG-VKVTFVNAEFIHAQVMAA----NPGLDNESHR  60

Query  253  --LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASS--SESHITCVIADQS  420
               V++ D   S E    P K+ +++S++MPG +++LI  +  S+   +  I+ +IAD  
Sbjct  61   IKFVAIPDGLISYEERKDPIKMLDSMSRVMPGHLQELIEKVKQSNGIEDEQISFLIADVM  120

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+A+++G+Q A F   + + +VL  +IPKLI+ G+I+N G   +N   + +  + 
Sbjct  121  VGWALEVAERMGIQRATFCAPSVSGVVLALHIPKLIEGGVIDNNGFVLKNDLIRISKDLR  180

Query  601  FMNTS  615
               +S
Sbjct  181  SYKSS  185



>ref|XP_010039070.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Eucalyptus grandis]
Length=459

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 116/186 (62%), Gaps = 11/186 (6%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH-  252
            H+LVI +PAQGHVIPL++L+ C+A HG + +TFV  +  H+Q++ +    N  LD+  H 
Sbjct  6    HVLVISFPAQGHVIPLLKLSHCIADHG-VKVTFVNAEFIHAQVMAA----NPGLDNESHR  60

Query  253  --LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSS---ESHITCVIADQ  417
               V++ D   + E    P K+ +++ ++MPG +++LI  +   S+   +  I+ VIAD 
Sbjct  61   IKFVAIPDGLITYEDRKDPIKMLDSMLRVMPGHLQELIEKVKKQSNGIEDEQISFVIADA  120

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
             +GWALE+A+++G+Q A F P + ++LVL  +IPKLI+ G+I+N G   +N   + +  +
Sbjct  121  MVGWALEVAERMGIQRATFCPPSVSSLVLALHIPKLIEGGVIDNNGFALKNDLIRISKDL  180

Query  598  PFMNTS  615
                +S
Sbjct  181  RSYKSS  186



>ref|XP_002281262.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
 emb|CAN70537.1| hypothetical protein VITISV_040069 [Vitis vinifera]
Length=455

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 101/161 (63%), Gaps = 2/161 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH+L+IP+PAQGHV P M+ A  ++ HG I +TFV +   H +++ +    + A   
Sbjct  1    MGRPHVLIIPFPAQGHVTPFMKFAYQISDHG-IKVTFVNSDFIHEKLVAALPDEDEARSR  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I L S+ D     E      KL ++I ++MPG +++LI  +N S+ +  ITCVIAD + 
Sbjct  60   -IGLASIPDGLGPGEDRKDSLKLTDSILRVMPGHLKELIEKVNNSNDDEKITCVIADSAF  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIIN  546
            GWALE+A K+G++  AF P    +L L F+IP+LI+ G++N
Sbjct  119  GWALEVADKMGIKRVAFCPFGPGSLALAFHIPRLIEAGLLN  159



>gb|KCW48891.1| hypothetical protein EUGRSUZ_K02513 [Eucalyptus grandis]
Length=474

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 116/186 (62%), Gaps = 11/186 (6%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH-  252
            H+LVI +PAQGHVIPL++L+ C+A HG + +TFV  +  H+Q++ +    N  LD+  H 
Sbjct  21   HVLVISFPAQGHVIPLLKLSHCIADHG-VKVTFVNAEFIHAQVMAA----NPGLDNESHR  75

Query  253  --LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSS---ESHITCVIADQ  417
               V++ D   + E    P K+ +++ ++MPG +++LI  +   S+   +  I+ VIAD 
Sbjct  76   IKFVAIPDGLITYEDRKDPIKMLDSMLRVMPGHLQELIEKVKKQSNGIEDEQISFVIADA  135

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
             +GWALE+A+++G+Q A F P + ++LVL  +IPKLI+ G+I+N G   +N   + +  +
Sbjct  136  MVGWALEVAERMGIQRATFCPPSVSSLVLALHIPKLIEGGVIDNNGFALKNDLIRISKDL  195

Query  598  PFMNTS  615
                +S
Sbjct  196  RSYKSS  201



>ref|XP_007037524.1| UDP-Glycosyltransferase superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY22025.1| UDP-Glycosyltransferase superfamily protein isoform 1 [Theobroma 
cacao]
Length=453

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 112/182 (62%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH++VIP+ AQGHV PLM+L+  +A HG + +TFV T+  H ++  +S          I
Sbjct  4    QPHVMVIPHAAQGHVAPLMKLSLQIAAHG-VKVTFVNTEFIHEKV-KASLPAKAEQQSLI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
            +LVS+ D  E  +      KL E++ ++MPG +  LI  IN S+    IT VIAD + GW
Sbjct  62   NLVSIPDGLEPEDDRQDFVKLTESMLRVMPGHLRNLIENINRSNVTEQITWVIADMAAGW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            ALE+AKK+G++ AA L ++ A++ L  ++P+LI+ GII+ +G   +++    +  +P  N
Sbjct  122  ALEVAKKMGIKRAAVLLSSPASMALALHVPRLIEAGIIDTDGTLIKDEPITLSEDIPAWN  181

Query  610  TS  615
            +S
Sbjct  182  SS  183



>ref|XP_006440717.1| hypothetical protein CICLE_v10024412mg [Citrus clementina]
 gb|ESR53957.1| hypothetical protein CICLE_v10024412mg [Citrus clementina]
Length=471

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 109/181 (60%), Gaps = 5/181 (3%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA-LDDG  246
            N H+L++ +PAQGHV  LM+LA  LA    + +TFV T+    +I  S  L + + + D 
Sbjct  17   NVHVLLVSFPAQGHVASLMKLAHRLA-DCRVKVTFVTTEFICERIKESQQLGSFSEMGDA  75

Query  247  IHLVSVL---DASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
              LV ++   D  E  +      K+  +ISK+MPG +E+LI+ IN    +  ITCVIAD 
Sbjct  76   QQLVRIVPLPDGLEPEDDRKDEAKMTRSISKVMPGYLEELIQKINQQEDDEKITCVIADV  135

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GWAL++A KLG++ A+   +A   L +  NIPK I+ GII+++GI  +N+  + +P +
Sbjct  136  TFGWALQVAAKLGLKKASVYTSAPGILAMIMNIPKFIEAGIISSDGIVIKNEKIELSPYL  195

Query  598  P  600
            P
Sbjct  196  P  196



>ref|XP_002466429.1| hypothetical protein SORBIDRAFT_01g007640 [Sorghum bicolor]
 gb|EER93427.1| hypothetical protein SORBIDRAFT_01g007640 [Sorghum bicolor]
Length=461

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (59%), Gaps = 5/187 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQI---LNSSALNNVA  234
            M   H+LV+P P QGHV PLMEL+  L   G   +TFV T   H+ +   L+++     A
Sbjct  4    MAKAHVLVLPMPCQGHVTPLMELSHRLVDQG-FEVTFVNTDVDHALVVTALDATGGGVAA  62

Query  235  LDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIAD  414
            L  GIHL S+ D    +E      KL +A S+ MPG +E L+  + A+        ++ D
Sbjct  63   LGGGIHLASIPDGLADDEDRKDINKLVDAYSRHMPGYLESLLADMEAAG-RPRAKWLVGD  121

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
             ++GW+ E+AKK G++  +F PAA+A L     IP LI++G+IN++G+P   +TFQ AP 
Sbjct  122  VNMGWSFEVAKKFGIRVVSFWPAASACLAFMLKIPNLIEEGLINDKGLPVRQETFQLAPG  181

Query  595  MPFMNTS  615
            MP +++S
Sbjct  182  MPPLHSS  188



>ref|XP_011465691.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 110/176 (63%), Gaps = 6/176 (3%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSA-LNNVALDDGIH  252
            H+L++ YP QGHV P ++LA  +A  G + +TFV+T+  H++++ +   L+N    + + 
Sbjct  21   HMLLVSYPLQGHVTPFIKLAYLIAGRG-VMVTFVITEFAHARLMAAEPDLDNER--NKVR  77

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGWA  432
             V+V D    +++ N  GKLF++ISK+MPG + +++  +N   ++  +TC+IAD   GWA
Sbjct  78   YVAVPDGLSEDDARNDEGKLFQSISKVMPGHLREVLEKVNMEGNQ--VTCIIADPMFGWA  135

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            LE+A+ L ++ A F  +A   L L  NIPKLI DGII+ +G    +   Q +P +P
Sbjct  136  LEIAETLKLKWAIFWTSAPGVLALILNIPKLIKDGIIDTKGSSKIDGKVQLSPDLP  191



>gb|AFK36901.1| unknown [Medicago truncatula]
Length=451

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 109/191 (57%), Gaps = 8/191 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQ-------ILNSSAL  222
            MG PH LVIPYP  GHV PLM+L+  L++HG   ITF+ T+ ++ +       I     L
Sbjct  1    MGVPHFLVIPYPIAGHVNPLMQLSHLLSKHG-CKITFLNTEFSNKRTNKNNISISKKDNL  59

Query  223  NNVALDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITC  402
             N    + I+ V++ D  E  ++ +   K+  +I + MP  +  LI  +NA  +E+ I+C
Sbjct  60   KNEQSQETINFVTLPDGLEDEDNRSDQRKVIFSIRRNMPPLLPNLIEDVNAMDAENKISC  119

Query  403  VIADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQ  582
            +I   + GWALE+   LG++      A+A +L   ++IPK IDDG++++ GIP   +  Q
Sbjct  120  IIVTFNKGWALEVGHSLGIKGVLLWTASATSLAYCYSIPKPIDDGVMDSAGIPTTKQEIQ  179

Query  583  FAPTMPFMNTS  615
              P MP ++T+
Sbjct  180  LFPNMPMIDTA  190



>gb|KDP27235.1| hypothetical protein JCGZ_19934 [Jatropha curcas]
Length=449

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNN-VALD  240
            MGNPH+LVIPYPAQGHV PLM  +Q +A   GI ITFV T   H ++L++   N+ V   
Sbjct  1    MGNPHVLVIPYPAQGHVNPLMHFSQRIANL-GIKITFVNTDFVHKRVLSAIVDNDSVGSS  59

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
              ++LVS+ D   S +  N  GKL +++   M  K+E+LI+ +N    +  I+C++AD  
Sbjct  60   PFVNLVSIPDGLGSEDDRNDFGKLCDSMLTTMLKKLEELIQDLNG--DDGPISCIVADGH  117

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIIN-NEGIPAENKTFQFAPTM  597
            +GW  E+AKK+G++ A   PA+AA   L   IPKLI DG I+ ++G   +    Q +P +
Sbjct  118  MGWVREVAKKIGIRVAIVWPASAALFSLEAIIPKLIRDGTIDSSDGFSTKKHIIQLSPGI  177

Query  598  PFMNT  612
            P  +T
Sbjct  178  PNFDT  182



>ref|XP_009397258.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 113/187 (60%), Gaps = 9/187 (5%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD----  240
            P +LV+P+PAQGHV+  M L++ L   G   ITFV T+  H +I  ++A+++   D    
Sbjct  5    PQVLVLPFPAQGHVVSFMSLSRGLVEQG-FRITFVNTEFNHGRI--AAAMSDKGCDAAGQ  61

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHIT--CVIAD  414
             GI +V++ D     +  N  GKL +   ++MPG +E+LI  IN S          +IAD
Sbjct  62   GGIRMVAIPDGLAPGDDRNDLGKLVDGYLRVMPGCLEELITSINQSGGGEGDGIGWMIAD  121

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
            +++ WALE+AKK+G++ A +  A+AA L    +IPK+I +GI+  +G+P  +  +Q +P 
Sbjct  122  ENMAWALEVAKKMGIRAACYWTASAAMLATMMSIPKMIREGILGADGLPRRHGKYQLSPG  181

Query  595  MPFMNTS  615
            MP ++T+
Sbjct  182  MPSVSTT  188



>gb|AAM47589.1| putative glucosyl transferase [Sorghum bicolor]
Length=457

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 109/186 (59%), Gaps = 4/186 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS--SALNNVAL  237
            M   H+LV+P P QGHV PLMEL+  L   G   +TFV T   H+ ++ +  ++    A 
Sbjct  1    MAKAHVLVLPMPCQGHVTPLMELSHRLVDQG-FEVTFVNTDVDHALVVTALEASGGAAAF  59

Query  238  DDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
              GIHL S+ D    +E      KL +A S+ MPG +E L+  + A+        ++ D 
Sbjct  60   GGGIHLASIPDGLADDEDRKDINKLVDAYSRHMPGYLESLLADMEAAG-RPRAKWLVGDV  118

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            ++GW+ E+AKK G++  +F PAA+A L     IP LI++G+IN++G+P   +TFQ AP M
Sbjct  119  NMGWSFEIAKKFGIRVVSFWPAASACLAFMLKIPNLIEEGLINDKGLPVRQETFQLAPGM  178

Query  598  PFMNTS  615
            P +++S
Sbjct  179  PPLHSS  184



>ref|XP_010273391.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 110/183 (60%), Gaps = 9/183 (5%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIHL  255
            H+LVIP P QGHV PLMEL+Q LA   GI +TFV  ++   +I+ ++  N  ++   IHL
Sbjct  8    HVLVIPAPVQGHVTPLMELSQSLAI-CGIKVTFVTEESVKQRIM-AALPNKGSMHSLIHL  65

Query  256  VSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSES---HITCVIADQSLG  426
             S+ D ++  + +    K  +A  K+MPG +E LI+ IN  S  +    I CVIA  +L 
Sbjct  66   ASIPDGAKFGDDT----KEVDAARKVMPGYLENLIKKINEESDNNNNNQINCVIASAALK  121

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            W +E+A+K+G++ AAF   +   L L  +IPKLI  GIIN  GI  +N+  Q +P  P +
Sbjct  122  WPMEVAEKMGIKRAAFSTTSVGVLALLLHIPKLIQAGIINEAGIALKNEMIQLSPNAPAI  181

Query  607  NTS  615
            +T+
Sbjct  182  STA  184



>ref|XP_009147383.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Brassica rapa]
Length=151

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 10/150 (7%)
 Frame = +1

Query  82   LVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD----GI  249
            + I YP QGHV PL+  ++ LA  G   ITFV T+  H++I+  S+L+  + DD    GI
Sbjct  1    MFITYPEQGHVRPLLIFSRNLASQG---ITFVNTEFNHNRII--SSLSKPSHDDHVVDGI  55

Query  250  HLVSVLDASE-SNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
             LVS+ D  E S E  NVPGKL E++ + MP KVE+LI  + + +S + I+CV+ADQSLG
Sbjct  56   KLVSIPDGLEDSPEEKNVPGKLSESVLRFMPTKVEELIERMISETSGAVISCVVADQSLG  115

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNI  516
            WA+E+A K G++ AAF PAAAA++VLGF+I
Sbjct  116  WAMEVAAKFGIRRAAFCPAAAASMVLGFSI  145



>ref|XP_010273390.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Nelumbo 
nucifera]
Length=517

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 110/183 (60%), Gaps = 9/183 (5%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIHL  255
            H+LVIP P QGHV PLMEL+Q LA   GI +TFV  ++   +I+ ++  N  ++   IHL
Sbjct  72   HVLVIPAPVQGHVTPLMELSQSLA-ICGIKVTFVTEESVKQRIM-AALPNKGSMHSLIHL  129

Query  256  VSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSES---HITCVIADQSLG  426
             S+ D ++  + +    K  +A  K+MPG +E LI+ IN  S  +    I CVIA  +L 
Sbjct  130  ASIPDGAKFGDDT----KEVDAARKVMPGYLENLIKKINEESDNNNNNQINCVIASAALK  185

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            W +E+A+K+G++ AAF   +   L L  +IPKLI  GIIN  GI  +N+  Q +P  P +
Sbjct  186  WPMEVAEKMGIKRAAFSTTSVGVLALLLHIPKLIQAGIINEAGIALKNEMIQLSPNAPAI  245

Query  607  NTS  615
            +T+
Sbjct  246  STA  248



>ref|XP_008786148.1| PREDICTED: UDP-glycosyltransferase 83A1-like, partial [Phoenix 
dactylifera]
Length=161

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 104/161 (65%), Gaps = 2/161 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG+P  ++IPYP QGHVIPL+ L+  +  HG   ITF+ ++ +H +++ + +  +    +
Sbjct  1    MGSPQAIMIPYPMQGHVIPLLALSHSMVAHG-FKITFINSEFSHDRVVAALSQKDGDGAE  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI +VS  D     E  N   K+ E   ++MP  +E+LI  +N S  +  + CVIAD ++
Sbjct  60   GIQMVSFPDGLAPGEDHNDLQKVTEGFLRVMPRCLEELINQMNTSGGD-RVACVIADVNM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIIN  546
            GWALE+A+K+G+++AAF PA+ A L +  +IPK+I DGI++
Sbjct  119  GWALEVAQKMGIRSAAFWPASTAVLAIFLSIPKMIQDGIVD  159



>ref|XP_007037532.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY22033.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 107/182 (59%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
            +PH LVIP+PAQGHV PLM+L+  +A HG + +TFV T+  H +I+  S          I
Sbjct  4    HPHALVIPFPAQGHVAPLMKLSLQIAAHG-VKVTFVNTEFIHEKIM-VSVPEKAEGRSLI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             L S+ D  E  +      KL E++ + MPG +E  I  IN S+    I+CVIAD S+GW
Sbjct  62   SLASLPDGLELEDDRTDYAKLIESVRRTMPGYLEDFILKINQSNINEKISCVIADTSVGW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            ALE+AKK+G++  A  PA    L L  ++P+L++  II+++G   +++    +  +P  +
Sbjct  122  ALEVAKKVGIEAVAVWPAGGPCLALALHVPQLLEAEIIDHDGTVMKDEPISVSKDVPAWS  181

Query  610  TS  615
             S
Sbjct  182  RS  183



>gb|KCW48890.1| hypothetical protein EUGRSUZ_K02512 [Eucalyptus grandis]
Length=447

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 110/178 (62%), Gaps = 17/178 (10%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD---G  246
            H+LVIP PAQGHV PL++L+ C+A +G   +TFV T++ H+Q++ +    N  LDD    
Sbjct  6    HVLVIPSPAQGHVTPLLKLSHCIADYGA-KVTFVNTESIHAQVMAA----NPGLDDESRR  60

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
            I  V++ D  E++E      K+ +++S++MP  V++          +  I  +IAD + G
Sbjct  61   IKFVAIPDGLETDEERKDSTKMVDSVSRVMPAAVKR---------QDEQINFMIADLTAG  111

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            WALE+A+++G++ A F PA+ + L L  +IPKLI+DG+I+N+G   +N     +  +P
Sbjct  112  WALEVAERMGIERAGFWPASVSTLALTLHIPKLIEDGVIDNKGCALKNDLITISKDLP  169



>ref|XP_003531851.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=443

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH L IP+P QGHV PLM+ +  L +HG   +TFV T+ +  +   S A N      
Sbjct  1    MGIPHFLCIPFPVQGHVNPLMQFSLLLVKHG-CKVTFVHTEFSLKRTKTSGADN--LEHS  57

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             + LV++ D  E+ +  +   KL  +I   MP  + KLI  INA  +++ ITC+I   ++
Sbjct  58   QVKLVTLPDGLEAEDDRSDVTKLLLSIKSNMPALLPKLIEDINALDADNKITCIIVTFNM  117

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPF  603
            GW LE+  KLG++ A   PA+A +L     IPKLI DGII+++G+P + +  Q +P MP 
Sbjct  118  GWPLEVGHKLGIKGALLCPASATSLASAACIPKLIHDGIIDSQGLPTKTQEIQLSPNMPL  177

Query  604  MNTS  615
            ++T 
Sbjct  178  IDTE  181



>ref|XP_006477727.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Citrus sinensis]
 gb|KDO54614.1| hypothetical protein CISIN_1g012083mg [Citrus sinensis]
Length=471

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 108/181 (60%), Gaps = 5/181 (3%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA-LDDG  246
            N H+L++ +PAQGHV  LM+LA  LA    I +TFV T+    +I  S  L + + + D 
Sbjct  17   NVHVLLVSFPAQGHVASLMKLAHRLA-DCRIKVTFVTTEFICERIKESRQLGSFSEMGDA  75

Query  247  IHLVSVL---DASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
              LV ++   D  E  +      K+  +ISK+MPG +E+LI+ IN    +  ITCVIAD 
Sbjct  76   QQLVRIVPLPDGLEPEDDRKDEAKMTRSISKVMPGYLEELIQKINQQEEDEKITCVIADV  135

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTM  597
            + GWAL++A KL ++ A+   +A   L +  NIPK I+ GII+++GI  +N+  + +P +
Sbjct  136  TFGWALQVAAKLELKKASIYTSAPGILAMIMNIPKFIEAGIISSDGIVIKNEKIELSPYL  195

Query  598  P  600
            P
Sbjct  196  P  196



>ref|XP_010273509.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Nelumbo nucifera]
Length=454

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 7/181 (4%)
 Frame = +1

Query  76   HILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIHL  255
            H+LVIP   QGHV PLMEL+Q LA  G I +TFV  ++   +I+ ++  N  ++   IHL
Sbjct  6    HVLVIPASVQGHVTPLMELSQSLAIRG-IKVTFVTEESVKERIM-AAFPNKGSMHSLIHL  63

Query  256  VSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH-ITCVIADQSLGWA  432
             S+ D ++  + +    K  +A  K+MPG +E LIR IN  S  ++ I C IA  +L WA
Sbjct  64   ASIPDGAKFGDDT----KEIDAARKVMPGYLENLIRKINEESDNNNKINCFIASAALKWA  119

Query  433  LELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNT  612
            +E+A+K+G++ A F   +   L L  +IPKLI  GIIN  G   +N+  Q +P  P ++T
Sbjct  120  MEVAEKMGIKRAVFSTTSVGVLALLLHIPKLIQAGIINESGTALKNEMIQLSPNAPAIST  179

Query  613  S  615
            +
Sbjct  180  A  180



>ref|XP_004489530.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Cicer arietinum]
Length=373

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 110/187 (59%), Gaps = 9/187 (5%)
 Frame = +1

Query  64   MGN-PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD  240
            MGN PH L IP+  QGHV PLM+ +Q L ++G   +TF+ T+  H +       NN    
Sbjct  1    MGNLPHFLAIPFQVQGHVNPLMQFSQILTKYG-CKVTFLHTEFNHKRSNMDDCQNN----  55

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH--ITCVIAD  414
              I +V++ D  ES +  +   K+  +I   MP K+ KLI  INA   +++  I C++  
Sbjct  56   -KIKVVTLSDGLESEDDRSDTKKVMLSIKSTMPNKLPKLIEDINALEVDNNNKINCIVVT  114

Query  415  QSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPT  594
             S+GWALE+  KLG++ A   PA+A +L     IP+LI+DGII++EG P + +  Q +P 
Sbjct  115  FSMGWALEVGHKLGIKGALLFPASATSLACVVCIPRLIEDGIIDSEGNPTKQQEIQISPD  174

Query  595  MPFMNTS  615
            +P M+T+
Sbjct  175  IPMMDTT  181



>ref|XP_006837103.1| hypothetical protein AMTR_s00110p00117920 [Amborella trichopoda]
 gb|ERM99956.1| hypothetical protein AMTR_s00110p00117920 [Amborella trichopoda]
Length=191

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 100/169 (59%), Gaps = 7/169 (4%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNV----  231
            MG PH LVI YPAQGH+IP+MEL+  +  H G  +TFV T  TH ++L++S   +     
Sbjct  1    MGVPHALVITYPAQGHIIPMMELSYRMVEH-GFFVTFVNTDFTHKRVLDASMKAHPQSHP  59

Query  232  -ALDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVI  408
                + I LVS+ D  E +   N  G L +AI   MP  +E LI+ IN    +S +TCV+
Sbjct  60   NKSTESIRLVSIPDGLEPDADRNQLGVLCDAILSSMPNALEMLIKDINGLEGDS-VTCVV  118

Query  409  ADQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            AD ++GWAL++AKKLG+  AA  PAAA  L       +LI  G+I  EG
Sbjct  119  ADVNMGWALDVAKKLGIPRAAVWPAAAGCLTTLLRFQELIQKGVITEEG  167



>ref|XP_010663276.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X2 [Vitis 
vinifera]
Length=459

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+L+IP+PAQGHV PLM+ A  ++ HG I +TFV +   H +++ +    + A    I
Sbjct  9    RPHVLIIPFPAQGHVTPLMKFAYQISDHG-IKVTFVNSDFIHEKLVAALPDEDEARSR-I  66

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             L S+ D     E    P K  ++I ++MPG +++LI  +N S+ +  ITCVIAD ++GW
Sbjct  67   GLASIPDGLGPGEDRKDPLKSTDSILRVMPGHLKELIEKVNNSNDDEKITCVIADTTVGW  126

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIIN  546
            ALE+A+K+G+++ AF P     L L F+IP+LI+ G +N
Sbjct  127  ALEVAEKMGIESVAFCPCGPGTLALVFDIPRLIEAGHVN  165



>gb|KHN13562.1| UDP-glycosyltransferase 83A1 [Glycine soja]
Length=448

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 108/184 (59%), Gaps = 6/184 (3%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS----SALNNVALD  240
            PH L+IPYP  GHV PL+ L+Q L +HG  NITF+ T+ +H ++ N+    S L+N+   
Sbjct  4    PHFLLIPYPVLGHVNPLIHLSQILVKHG-CNITFLNTEFSHKRLNNNTGSGSGLDNLK-T  61

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
             GI  V++ D     +  +   K+  +I   MP  + KLI  +NA    + ITC++   S
Sbjct  62   SGIKFVTLPDGLSPEDDRSDQKKVVLSIKTNMPSMLPKLIHDVNALDVNNKITCLVVTLS  121

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + WAL++   LG++ A   PA+A +L +   IPKLI DG+I++ G+P   +  Q +P MP
Sbjct  122  MTWALKVGHNLGIKGALLWPASATSLAMCDFIPKLIHDGVIDSYGVPIRRQEIQLSPNMP  181

Query  601  FMNT  612
             M+T
Sbjct  182  MMDT  185



>ref|XP_003551756.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=448

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 108/184 (59%), Gaps = 6/184 (3%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNS----SALNNVALD  240
            PH L+IPYP  GHV PL+ L+Q L +HG  NITF+ T+ +H ++ N+    S L+N+   
Sbjct  4    PHFLLIPYPVLGHVNPLIHLSQILVKHG-CNITFLNTEFSHKRLNNNTGSGSGLDNLK-T  61

Query  241  DGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
             GI  V++ D     +  +   K+  +I   MP  + KLI  +NA    + ITC++   S
Sbjct  62   SGIKFVTLPDGLSPEDDRSDQKKVVLSIKTNMPSMLPKLIHDVNALDVNNKITCLVVTLS  121

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            + WAL++   LG++ A   PA+A +L +   IPKLI DG+I++ G+P   +  Q +P MP
Sbjct  122  MTWALKVGHNLGIKGALLWPASATSLAMCDFIPKLIHDGVIDSYGVPIRRQEIQLSPNMP  181

Query  601  FMNT  612
             M+T
Sbjct  182  MMDT  185



>ref|XP_002284355.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X1 [Vitis 
vinifera]
Length=462

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+L+IP+PAQGHV PLM+ A  ++ HG I +TFV +   H +++ +    + A    I
Sbjct  9    RPHVLIIPFPAQGHVTPLMKFAYQISDHG-IKVTFVNSDFIHEKLVAALPDEDEARSR-I  66

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             L S+ D     E    P K  ++I ++MPG +++LI  +N S+ +  ITCVIAD ++GW
Sbjct  67   GLASIPDGLGPGEDRKDPLKSTDSILRVMPGHLKELIEKVNNSNDDEKITCVIADTTVGW  126

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIIN  546
            ALE+A+K+G+++ AF P     L L F+IP+LI+ G +N
Sbjct  127  ALEVAEKMGIESVAFCPCGPGTLALVFDIPRLIEAGHVN  165



>ref|XP_010663277.1| PREDICTED: UDP-glycosyltransferase 83A1-like isoform X3 [Vitis 
vinifera]
Length=457

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+L+IP+PAQGHV PLM+ A  ++ HG I +TFV +   H +++ +    + A    I
Sbjct  4    RPHVLIIPFPAQGHVTPLMKFAYQISDHG-IKVTFVNSDFIHEKLVAALPDEDEARSR-I  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             L S+ D     E    P K  ++I ++MPG +++LI  +N S+ +  ITCVIAD ++GW
Sbjct  62   GLASIPDGLGPGEDRKDPLKSTDSILRVMPGHLKELIEKVNNSNDDEKITCVIADTTVGW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIIN  546
            ALE+A+K+G+++ AF P     L L F+IP+LI+ G +N
Sbjct  122  ALEVAEKMGIESVAFCPCGPGTLALVFDIPRLIEAGHVN  160



>gb|KHN19240.1| UDP-glycosyltransferase 83A1 [Glycine soja]
Length=454

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            M  P +LV+PYPAQGHV PLM L+Q L  H G  + FV T   H +++ S      +LD+
Sbjct  1    MSIPTVLVLPYPAQGHVNPLMTLSQKLVEH-GCKVIFVNTDFDHKRVVASMGEQQDSLDE  59

Query  244  G-IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
              + LVS+ D  E ++  N  GKL +A+   MP  +EKLI  ++  + ++ I+  +AD  
Sbjct  60   SLLKLVSIPDGLEPDDDQNDAGKLCDAMQNTMPTMLEKLIEDVHL-NGDNKISLSVADFC  118

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGI  558
            +GWAL++  KLG++ A    + AA   L +NIPKLIDDGII+++G+
Sbjct  119  MGWALDVGSKLGIKGALLWASPAALFGLLYNIPKLIDDGIIDSDGV  164



>gb|AAK16181.1|AC079887_13 putative glucosyltransferase [Oryza sativa Japonica Group]
 gb|ABF98963.1| UDP-glucoronosyl and UDP-glucosyl transferase family protein, 
expressed [Oryza sativa Japonica Group]
 gb|EAY91913.1| hypothetical protein OsI_13598 [Oryza sativa Indica Group]
Length=462

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 107/188 (57%), Gaps = 5/188 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVA--L  237
            M   H+LV+P P QGHVIP MEL+  LA  G   +TFV T+  H+ ++ +      A   
Sbjct  1    MAKGHVLVLPMPCQGHVIPFMELSHRLADEG-FEVTFVNTEVDHALVVAALPPGGAAELR  59

Query  238  DDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH--ITCVIA  411
               IHL ++ D    +E      KL +A S+ MPG +E+LI  I A +      +  ++ 
Sbjct  60   QRRIHLAAIPDGLAGDEDRKDLNKLIDAYSRHMPGHLERLIGEIEAGAGGGRPKVRWLVG  119

Query  412  DQSLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAP  591
            D ++GW+  +A++LG++  +F  A+ A L +   IPKLI+DG++N +G P   +T Q AP
Sbjct  120  DVNMGWSFAVARRLGIRVVSFWAASTACLAIMLKIPKLIEDGVLNEKGWPERQETLQLAP  179

Query  592  TMPFMNTS  615
             MP ++TS
Sbjct  180  GMPPLHTS  187



>ref|XP_008786154.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Phoenix dactylifera]
Length=173

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG P  ++IPYP QGH IPL+ L+  +  HG   ITF+ ++  H +++ + +  +    +
Sbjct  1    MGTPQAIMIPYPEQGHGIPLLALSHSMVAHG-FKITFINSEFNHDRVVAALSQKDGDGAE  59

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
            GI +VS  D     E  N   K  E   ++MP  +E+LI  +N S  +  + CVIAD ++
Sbjct  60   GIQMVSFPDGLAPGEDRNDLRKKTEGFLRVMPRCLEELINQMNTSGGD-RVACVIADPNM  118

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            GWALE+A+K+G+++AAF PA+ A L +  +IPK+I DGII+  G
Sbjct  119  GWALEVAQKMGIRSAAFWPASTAVLAMFLSIPKMIQDGIIDANG  162



>ref|XP_007032717.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY03643.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=308

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 91/166 (55%), Gaps = 34/166 (20%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MGNPH+LVIPYP QGHVIPL EL+Q L +H G  ITFV ++  H +++N+ A     +D 
Sbjct  1    MGNPHVLVIPYPTQGHVIPLAELSQSLVKH-GFKITFVNSEFNHERVMNALA---KKVDG  56

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             I LVS+ D  E  ES    GKL EAI ++MPG +++ I+  N S  +  ITCV+AD ++
Sbjct  57   SIRLVSIADGMEDGESKKHLGKLTEAIRQVMPGGLKEFIKKTNRSEDDK-ITCVLADINM  115

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIP  561
            G                             + KLIDDG+I+    P
Sbjct  116  G-----------------------------VQKLIDDGLIDENASP  132



>ref|XP_002281210.2| PREDICTED: UDP-glycosyltransferase 83A1-like [Vitis vinifera]
Length=457

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+L+IP+PAQGHV PLM+ A  ++ HG I +TFV +   H +++ +    + A    I
Sbjct  4    RPHVLIIPFPAQGHVAPLMKFAYQISDHG-IKVTFVNSDFIHEKLVAALPDEDEARSR-I  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             L S+ D     E      KL ++I ++MPG +++ +  +N S+ +  ITCVIAD + GW
Sbjct  62   GLASIPDGLGPGEDRKDSLKLTDSIFRVMPGHLKEFMEKVNNSNDDEKITCVIADSAFGW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINN  549
            ALE+A K+G++  AF P    +L L F+IP+LI+ G++N+
Sbjct  122  ALEVADKMGIKRVAFCPFGPGSLALAFHIPRLIEAGLLNS  161



>ref|XP_009392508.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Musa acuminata 
subsp. malaccensis]
Length=167

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 101/164 (62%), Gaps = 5/164 (3%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
            +PH L++PYPAQGHVIP M LA  L  HG   +TFV T+ +H++++ + A    A    I
Sbjct  4    SPHALLLPYPAQGHVIPFMALAHFLVNHG-FKVTFVNTEFSHARLVAALADMEQAASGRI  62

Query  250  HLVSVLDASESNESSNVP--GKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             LVS+ D  E  +S      GKL   + K M   +E+LIR   +  +   ITC+IA Q +
Sbjct  63   ELVSIPDGLELEDSGARSDHGKLMAGLQKAMHPCLEELIR--RSGDAGDQITCMIAFQGM  120

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
             WALE+AKK+GV+TAAF PA+AA L    +IP+LI  G+I+  G
Sbjct  121  AWALEVAKKMGVRTAAFWPASAAVLATILSIPELIARGVIDENG  164



>ref|XP_004489506.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Cicer arietinum]
 gb|AGU14132.1| UDP-glycosyltransferase [Cicer arietinum]
Length=443

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 110/183 (60%), Gaps = 8/183 (4%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGIH  252
            PH L IP+P QGHV PLM+ +Q L ++G   +TF+ T+ +H +  N+    N    D I 
Sbjct  5    PHFLAIPFPVQGHVNPLMQFSQILTKYG-CKVTFLHTEFSHKR-SNTDDYQN----DKIK  58

Query  253  LVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESH--ITCVIADQSLG  426
            +V++ D  ES +  +   K+  +I   MP K+ KLI  INA   +++  I C++   ++G
Sbjct  59   VVTLPDGLESKDDRSDIKKVMLSIKSTMPNKLSKLIEDINALEVDNNNKINCIVVTFNMG  118

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            WALE+  KLG++ A   PA+A +L     IP+LI+D II++EG P + +  Q +P +P +
Sbjct  119  WALEVGHKLGIKGALLCPASATSLACAVCIPRLIEDEIIDSEGNPTKQQEIQISPDIPMI  178

Query  607  NTS  615
            +T+
Sbjct  179  DTT  181



>ref|XP_003530433.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
 gb|KHN11176.1| UDP-glycosyltransferase 83A1 [Glycine soja]
Length=442

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 111/184 (60%), Gaps = 5/184 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH L+IPYP  GHV PLM+L+Q LARH G  ITF+ T+  H    N++A   V +D+
Sbjct  1    MGVPHFLLIPYPTLGHVNPLMQLSQVLARH-GCKITFLNTEFNHKGA-NTAA--GVGIDN  56

Query  244  G-IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQS  420
              I  V++ D     +  +   K+  +I   MP  + KLI+ I+A  + ++ITC++   +
Sbjct  57   AHIKFVTLPDGLVPEDDRSDHKKVIFSIKSHMPPMLPKLIQDIDALDANNNITCIVVTVN  116

Query  421  LGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMP  600
            +GWALE+  KLG++ A   PA+A +L     IP LI DGII+++G P + +  Q +  +P
Sbjct  117  MGWALEVGHKLGIKGALLWPASATSLATCDCIPWLIHDGIIDSDGNPIKKQEIQLSTNLP  176

Query  601  FMNT  612
             M+T
Sbjct  177  MMDT  180



>ref|XP_007037530.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY22031.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=456

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 106/182 (58%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+L IP+PAQGHV P M+LA  +A +G + ITFV +++ H +I+ +S   ++     I
Sbjct  4    KPHVLAIPFPAQGHVAPFMKLALQIAANG-VKITFVNSESVHERIM-ASVSADIEEQSLI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLGW  429
             LVS+ DA ES  +        +   K MPG ++ LI  IN S+    ITCV+AD +  W
Sbjct  62   SLVSIPDALESRGAQRNAVNFTKRAQKGMPGSLKNLIEKINQSNINEQITCVLADTTAVW  121

Query  430  ALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMN  609
            ALE+AK++G+   A   A  A L L   IP+L+  GI++N+GI  + ++   +  +P  +
Sbjct  122  ALEVAKEMGIGRIAVQVAGPAVLALSLQIPQLLGAGILDNDGILVKGESISLSKEIPAWS  181

Query  610  TS  615
             S
Sbjct  182  RS  183



>emb|CBI15141.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 118/196 (60%), Gaps = 6/196 (3%)
 Frame = +1

Query  37   GSKTFKQSR-MGN-PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILN  210
            G    K +R MG  PH+L+IP PAQGHV PLM+LA  ++ HG I +TFV +   H+++L 
Sbjct  39   GGSVGKLARTMGRRPHVLIIPLPAQGHVAPLMKLAHRISDHG-IKVTFVNSDFIHAKLL-  96

Query  211  SSALNNVALDDGIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSES  390
            ++  +      GI L S+ D  +  +      KL E+IS++MPG ++ LI  +N S+ + 
Sbjct  97   AALPHEAEARSGIGLASIPDGLDPGDDRKNMLKLTESISRVMPGHLKDLIEKVNHSNDDE  156

Query  391  HITCVIADQSL-GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINN-EGIPA  564
             ITCVIAD +L  W +E+A+K+G++   F P  A    L  +IPKLI+ GI+N+ +G P 
Sbjct  157  QITCVIADITLERWPMEVAEKMGIEGVPFCPMGAGIWALALHIPKLIEAGIVNSTDGSPL  216

Query  565  ENKTFQFAPTMPFMNT  612
             ++    +  +P +++
Sbjct  217  NDELICVSKGIPVLSS  232



>gb|ACU24307.1| unknown [Glycine max]
Length=456

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSA-LNNVALD  240
            M  P +LV+P+P QGHV P+  L+Q L  H G  + FV T   H ++L+S     + +LD
Sbjct  1    MSIPTVLVLPFPFQGHVNPMTTLSQKLVEH-GCKVVFVNTDFNHKRVLSSMVEQQDHSLD  59

Query  241  DGI-HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
            + +  LVS+ D    ++  +  GKL +A+   MP  +EKLI  I+    ++ I+ ++AD 
Sbjct  60   ESLMKLVSISDGLGPDDDRSNIGKLCDAMISTMPSTLEKLIEDIHL-KGDNRISFIVADL  118

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG-IPAENKTFQFAPT  594
            ++GWAL +  KLG++ A F PA+AA   + +N+P+LIDDGIIN++G I   NKT + +P 
Sbjct  119  NMGWALNVGCKLGIKGALFWPASAAVFGMLYNVPRLIDDGIINSDGSILTSNKTIRLSPN  178

Query  595  MPFMNTS  615
            MP M T+
Sbjct  179  MPEMETT  185



>ref|XP_003559280.2| PREDICTED: UDP-glycosyltransferase 83A1-like [Brachypodium distachyon]
Length=876

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 69/183 (38%), Positives = 103/183 (56%), Gaps = 10/183 (5%)
 Frame = +1

Query  73   PHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALD--DG  246
            PH++V+P+PAQGHV PLMEL+  L  HG   +TFV T+  H+ +LN+   ++   D   G
Sbjct  6    PHVMVLPFPAQGHVTPLMELSHRLVDHG-FQVTFVCTEPIHALVLNALRRDDENSDAMPG  64

Query  247  IHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG  426
            I LVS+ D     +      K  + +S+ +PG VE+LIR       E+ +  ++ D ++G
Sbjct  65   IRLVSIPDGLADGDDRRDLCKFLDGVSRRIPGYVEELIR-------ETGVKWLVGDANMG  117

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
               E+AKKLGV  A   PA+ A L     +P+LI DG  +++G P     F+  P +P M
Sbjct  118  LCFEVAKKLGVLVACVWPASGAGLGTLLRVPQLIQDGFFDDKGFPKRTGAFELFPNVPPM  177

Query  607  NTS  615
             TS
Sbjct  178  YTS  180


 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 72/177 (41%), Positives = 108/177 (61%), Gaps = 6/177 (3%)
 Frame = +1

Query  100  AQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSAL----NNVALDDGIHLVSVL  267
            AQGHVIPLMEL+  L  HG + +TFV T+  HS IL + A     +N    +GI +VS+ 
Sbjct  414  AQGHVIPLMELSHRLVEHG-VKVTFVNTELNHSLILGALASKDGESNSIGGNGIDMVSIP  472

Query  268  DASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSS-ESHITCVIADQSLGWALELA  444
            D     E       L ++ S++MPG++EKLI  I+ S+  E  +T +IAD ++ WA  +A
Sbjct  473  DGLGHGEDRKDLSLLTQSFSEVMPGELEKLIGRISESTGGERELTWLIADANMAWAFPVA  532

Query  445  KKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFMNTS  615
            ++LG++ AAF P+AAA      +IP++I DG+++  G+P     FQ AP MP ++ S
Sbjct  533  RRLGLRVAAFNPSAAAMFATRTSIPEMIRDGVVDERGLPKRPGPFQLAPLMPAIDPS  589



>ref|XP_002281187.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera]
Length=458

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 112/183 (61%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+L+IP PAQGHV PLM+LA  ++ HG I +TFV +   H+++L ++  +      GI
Sbjct  4    RPHVLIIPLPAQGHVAPLMKLAHRISDHG-IKVTFVNSDFIHAKLL-AALPHEAEARSGI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL-G  426
             L S+ D  +  +      KL E+IS++MPG ++ LI  +N S+ +  ITCVIAD +L  
Sbjct  62   GLASIPDGLDPGDDRKNMLKLTESISRVMPGHLKDLIEKVNHSNDDEQITCVIADITLER  121

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINN-EGIPAENKTFQFAPTMPF  603
            W +E+A+K+G++   F P  A    L  +IPKLI+ GI+N+ +G P  ++    +  +P 
Sbjct  122  WPMEVAEKMGIEGVPFCPMGAGIWALALHIPKLIEAGIVNSTDGSPLNDELICVSKGIPV  181

Query  604  MNT  612
            +++
Sbjct  182  LSS  184



>ref|XP_003516842.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Glycine max]
Length=456

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSA-LNNVALD  240
            M  P +LV+P+P QGHV P+  L+Q L  H G  + FV T   H ++L+S     + +LD
Sbjct  1    MSIPTVLVLPFPFQGHVNPMTTLSQKLVEH-GCKVVFVNTDFNHKRVLSSMVEQQDHSLD  59

Query  241  DGI-HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQ  417
            + +  LVS+ D    ++  +  GKL +A+   MP  +EKLI  I+    ++ I+ ++AD 
Sbjct  60   ESLMKLVSISDGLGPDDDRSNIGKLCDAMISTMPSTLEKLIEDIHL-KGDNRISFIVADL  118

Query  418  SLGWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG-IPAENKTFQFAPT  594
            ++GWAL +  KLG++ A F PA+AA   + +N+P+LIDDGIIN++G I   NKT + +P 
Sbjct  119  NMGWALNVGCKLGIKGALFWPASAAVFGMLYNVPRLIDDGIINSDGSILTSNKTIRLSPN  178

Query  595  MPFMNTS  615
            MP M T+
Sbjct  179  MPEMETT  185



>ref|XP_002281171.2| PREDICTED: UDP-glycosyltransferase 83A1-like [Vitis vinifera]
Length=457

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 109/182 (60%), Gaps = 3/182 (2%)
 Frame = +1

Query  70   NPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDDGI  249
             PH+L+IP PAQGHV PLM+LA  ++ HG I +TFV +   H+++L ++  +      GI
Sbjct  4    RPHVLIIPLPAQGHVAPLMKLAHRISDHG-IKVTFVNSDFIHAKLL-AALPHEAEARSGI  61

Query  250  HLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSLG-  426
             L S+ D  +  +      KL E+IS++MP  ++ LI  +N S+ +  I CV+AD +LG 
Sbjct  62   GLASIPDGLDPGDDRKDLPKLTESISRVMPSHLKDLIEKVNRSNDDEQIICVVADITLGW  121

Query  427  WALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEGIPAENKTFQFAPTMPFM  606
            WA+E+A+K+G+    F P+    L L  +IPKLI+  I++ +G P  ++    +  +P  
Sbjct  122  WAMEVAEKMGILGVPFFPSGPEILALALHIPKLIEARILDADGSPLNDELICLSKDIPVF  181

Query  607  NT  612
            ++
Sbjct  182  SS  183



>gb|KJB40917.1| hypothetical protein B456_007G082400 [Gossypium raimondii]
Length=152

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 96/164 (59%), Gaps = 19/164 (12%)
 Frame = +1

Query  64   MGNPHILVIPYPAQGHVIPLMELAQCLARHGGINITFVLTQTTHSQILNSSALNNVALDD  243
            MG PH++VIPYPAQGHVI +MEL+Q LA+  GI I F + +                   
Sbjct  1    MGKPHVVVIPYPAQGHVISVMELSQNLAKQ-GIKINFKVDENGL----------------  43

Query  244  GIHLVSVLDASESNESSNVPGKLFEAISKIMPGKVEKLIRGINASSSESHITCVIADQSL  423
             IHL+SV D  E  E  N  GKL E++ ++MP + ++LI  +N  + +  I+CV+ D  +
Sbjct  44   -IHLLSVPDGLEDGEDRNQLGKLTESLYQVMPTQPKELIHKVNGLNDDK-ISCVLVDIGM  101

Query  424  GWALELAKKLGVQTaaflpaaaaNLVLGFNIPKLIDDGIINNEG  555
            G AL++A +LG+ T    PAA   L +   +PKLIDDG+I+  G
Sbjct  102  GLALDVAAELGIPTVGLWPAAVLQLAVLLKVPKLIDDGLIDENG  145



Lambda      K        H        a         alpha
   0.317    0.134    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090