BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015E05 633 bp,

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011071034.1|  PREDICTED: homeobox-leucine zipper protein H...  67.4    4e-10   Sesamum indicum [beniseed]
ref|XP_003517924.1|  PREDICTED: homeobox-leucine zipper protein H...  65.1    3e-09   
ref|XP_009801498.1|  PREDICTED: homeobox-leucine zipper protein H...  62.0    5e-09   Nicotiana sylvestris
ref|XP_006574472.1|  PREDICTED: homeodomain-leucine zipper protei...  63.2    1e-08   Glycine max [soybeans]
ref|XP_009801495.1|  PREDICTED: homeobox-leucine zipper protein H...  62.0    2e-08   Nicotiana sylvestris
ref|XP_004489987.1|  PREDICTED: homeobox-leucine zipper protein H...  62.4    2e-08   
ref|XP_011086401.1|  PREDICTED: homeobox-leucine zipper protein HAT5  61.6    4e-08   
ref|XP_007157405.1|  hypothetical protein PHAVU_002G067200g           61.6    5e-08   Phaseolus vulgaris [French bean]
gb|ACJ85136.1|  unknown                                               56.6    3e-07   Medicago truncatula
ref|XP_002269605.2|  PREDICTED: homeobox-leucine zipper protein HAT5  58.2    6e-07   Vitis vinifera
ref|XP_006842102.1|  hypothetical protein AMTR_s00078p00085160        57.8    7e-07   Amborella trichopoda
ref|XP_009594284.1|  PREDICTED: homeobox-leucine zipper protein A...  57.0    2e-06   Nicotiana tomentosiformis
ref|XP_007037211.1|  Homeobox protein, putative isoform 1             55.5    5e-06   
ref|XP_003613578.1|  Homeobox-leucine zipper protein ATHB-16          55.5    6e-06   
ref|XP_007037212.1|  Homeobox protein, putative isoform 2             54.3    1e-05   Theobroma cacao [chocolate]
ref|XP_008339943.1|  PREDICTED: homeobox-leucine zipper protein H...  54.3    1e-05   
ref|XP_011028710.1|  PREDICTED: homeobox-leucine zipper protein H...  52.8    5e-05   Populus euphratica
ref|XP_007225072.1|  hypothetical protein PRUPE_ppa018002mg           51.6    1e-04   Prunus persica
ref|XP_008221689.1|  PREDICTED: homeobox-leucine zipper protein H...  51.6    1e-04   Prunus mume [ume]
ref|XP_002321530.2|  hypothetical protein POPTR_0015s07640g           51.6    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002271692.1|  PREDICTED: homeobox-leucine zipper protein H...  50.8    2e-04   Vitis vinifera
emb|CBI15277.3|  unnamed protein product                              50.4    2e-04   Vitis vinifera
gb|EYU22443.1|  hypothetical protein MIMGU_mgv1a012337mg              50.1    3e-04   Erythranthe guttata [common monkey flower]



>ref|XP_011071034.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Sesamum 
indicum]
Length=316

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 53/109 (49%), Gaps = 12/109 (11%)
 Frame = +3

Query  315  MEGTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfngg------  476
            MEG           VLL+N+R P  SEVLD  W+P S+P F  S S+ V           
Sbjct  1    MEGCKSYDDSHMENVLLKNERIPCTSEVLDCLWVPNSSPPFHVSGSAAVVNFEEIRGENS  60

Query  477  ------ggemergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                       +     +   G F+Q EKKRRL+ EQV FLE+SFEVEN
Sbjct  61   TERPFFTQVDSKVENLSEEFDGCFHQPEKKRRLTVEQVQFLEKSFEVEN  109



>ref|XP_003517924.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Glycine 
max]
 gb|KHN01166.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=345

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 60/105 (57%), Gaps = 10/105 (10%)
 Frame = +3

Query  321  GTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNP-SFQASAS---------SMVnfn  470
             +GK+ +  +  +LLQN+R P  SEVL+S W  TSNP SFQ S S         S V   
Sbjct  2    ASGKLYAGSNMSLLLQNERLPCSSEVLESLWAHTSNPASFQGSKSVVDFENVNGSRVTDR  61

Query  471  ggggemergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                 +E+    ++   G F+Q  KKRRL+ EQV FLE++FEVEN
Sbjct  62   PFFQALEKEENCDEDYEGCFHQPGKKRRLTSEQVQFLERNFEVEN  106



>ref|XP_009801498.1| PREDICTED: homeobox-leucine zipper protein HAT5-like, partial 
[Nicotiana sylvestris]
Length=135

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = +3

Query  351  NRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggemerggg---------  503
            N  +L N+ FP PS+VLDS W+  S+P+F  S S MVNF+   G   +            
Sbjct  2    NSFILPNESFPLPSKVLDSLWISNSSPTFHGSVS-MVNFDDTRGTKTKERSFFPSLDKEE  60

Query  504  -nedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
             + +     F+Q EKKRRL P+QV FLE+SFEVEN
Sbjct  61   NSNEDYEVSFHQPEKKRRLLPKQVQFLEKSFEVEN  95



>ref|XP_006574472.1| PREDICTED: homeodomain-leucine zipper protein 57 isoform X1 [Glycine 
max]
 gb|KHN28720.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=345

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 10/105 (10%)
 Frame = +3

Query  321  GTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNP-SFQAS---------ASSMVnfn  470
             +GK+ +  +  +LLQN+R P  SEVL+S W  TSNP SFQ S         + S +   
Sbjct  2    ASGKLYAGSNMSLLLQNERLPCSSEVLESLWAQTSNPASFQGSKPVVDFENVSGSRMTDR  61

Query  471  ggggemergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                 +E+    ++   G F+Q  KKRRL+ EQV FLE++FEVEN
Sbjct  62   PFFQALEKEENCDEDYEGCFHQPGKKRRLTSEQVQFLERNFEVEN  106



>ref|XP_009801495.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nicotiana 
sylvestris]
Length=295

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = +3

Query  351  NRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggemerg----------g  500
            N  +L N+ FP PS+VLDS W+  S+P+F  S S MVNF+   G   +            
Sbjct  2    NSFILPNESFPLPSKVLDSLWISNSSPTFHGSVS-MVNFDDTRGTKTKERSFFPSLDKEE  60

Query  501  gnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
             + +     F+Q EKKRRL P+QV FLE+SFEVEN
Sbjct  61   NSNEDYEVSFHQPEKKRRLLPKQVQFLEKSFEVEN  95



>ref|XP_004489987.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cicer arietinum]
Length=330

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 13/108 (12%)
 Frame = +3

Query  321  GTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNP-SFQASASSMVnfngggge----  485
             +GK+    +  +LLQN+R P  SEVL+S W+ TSNP SFQ S S +   N G G     
Sbjct  2    ASGKLFGGSNMSLLLQNERLPCSSEVLESLWVHTSNPASFQGSKSVVDFENVGSGSRVVT  61

Query  486  --------mergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                     +     ++     F+Q  KKRRLS EQV FLE++FEVEN
Sbjct  62   DRPFFQQIEKEENCGDEDYDACFHQQGKKRRLSSEQVQFLERNFEVEN  109



>ref|XP_011086401.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Sesamum indicum]
Length=318

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 17/102 (17%)
 Frame = +3

Query  348  DNRV---LLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggemerg-------  497
            D+R+   LL+N+R P  SEVLDS W+  S+PSF ASA SMVNF    GE +         
Sbjct  6    DSRISNALLKNERLPCTSEVLDSLWVQNSSPSFHASA-SMVNFANVQGETKTERPFLPQI  64

Query  498  ------ggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                         G  F+  EKKRRL+P QV FLE+SF+ EN
Sbjct  65   DTKAENCNEGALDGCSFHHPEKKRRLTPNQVQFLEKSFDEEN  106



>ref|XP_007157405.1| hypothetical protein PHAVU_002G067200g [Phaseolus vulgaris]
 gb|AAK84886.1|AF402605_1 homeodomain leucine zipper protein HDZ2 [Phaseolus vulgaris]
 gb|ESW29399.1| hypothetical protein PHAVU_002G067200g [Phaseolus vulgaris]
Length=327

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 56/103 (54%), Gaps = 10/103 (10%)
 Frame = +3

Query  327  GKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSN-PSFQASAS---------SMVnfngg  476
            GK+    +  +LLQNDR P  SEVL+S W  TSN  SFQ S S           V     
Sbjct  4    GKLHPGSNMSLLLQNDRLPCSSEVLESLWAHTSNAASFQGSKSMVDFENVSGGRVTDRPF  63

Query  477  ggemergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
               +E+    +D   G F+Q  KKRRL+ EQV FLE++FEVEN
Sbjct  64   FQALEKEDNCDDDYEGCFHQPGKKRRLTSEQVQFLERNFEVEN  106



>gb|ACJ85136.1| unknown [Medicago truncatula]
Length=125

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +3

Query  327  GKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfngggge-------  485
            GK+    +  +LLQN+R P  SEVL+S W+ T   SFQ S S +   NGGG         
Sbjct  4    GKLFGGSNMSLLLQNERLPCTSEVLESLWVHTP-ASFQGSNSVVNFENGGGSNRVVTDRP  62

Query  486  -----mergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                  +     ++     ++Q  KKRRLS EQV FLE+SFEVEN
Sbjct  63   FFQQLEKEENCGDEDYEACYHQQGKKRRLSSEQVQFLEKSFEVEN  107



>ref|XP_002269605.2| PREDICTED: homeobox-leucine zipper protein HAT5 [Vitis vinifera]
 emb|CBI32024.3| unnamed protein product [Vitis vinifera]
Length=321

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 9/106 (8%)
 Frame = +3

Query  315  MEGTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggemer  494
            M+G        +  VLL+ +  PSPSE+L+SFW+P S+ +F  S S +     GG + + 
Sbjct  1    MDGRKLYGGGSNMAVLLRKETLPSPSELLESFWIPDSSTTFHGSKSVVNFEGVGGDDTKD  60

Query  495  ---------gggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                         ++   G F++ EKKRRL+  QV FLE++FEVEN
Sbjct  61   RPFFQTLHEEENGDEDFEGCFHRPEKKRRLTAGQVQFLERNFEVEN  106



>ref|XP_006842102.1| hypothetical protein AMTR_s00078p00085160 [Amborella trichopoda]
 gb|ERN03777.1| hypothetical protein AMTR_s00078p00085160 [Amborella trichopoda]
Length=305

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = +3

Query  327  GKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggemergggn  506
            G++    +  V+LQ +  P  S+ LD+  +  S+PSF   A SMVNF            +
Sbjct  4    GRVYGGSNLNVVLQGEGLPCSSDALDALLVSCSSPSFHG-ARSMVNFEEINANSTEEDFD  62

Query  507  edyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
            E      F+Q EKKRRLSP+QV FLE++FEVEN
Sbjct  63   EC-----FHQPEKKRRLSPDQVQFLEKNFEVEN  90



>ref|XP_009594284.1| PREDICTED: homeobox-leucine zipper protein ATHB-54-like [Nicotiana 
tomentosiformis]
Length=312

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 54/95 (57%), Gaps = 11/95 (12%)
 Frame = +3

Query  351  NRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggemerg----------g  500
            N  +L N+ FP PS+VLDS W+  S+P+F  S S MVNFN   G+  +            
Sbjct  16   NGFILPNEIFPPPSKVLDSLWISNSSPTFHGSVS-MVNFNDTRGKKTKERSFFPSLDKEE  74

Query  501  gnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
             + +     F+Q EKK RL P+QV FL +SFEVEN
Sbjct  75   NSNEDYQVSFHQPEKKSRLLPKQVQFLAKSFEVEN  109



>ref|XP_007037211.1| Homeobox protein, putative isoform 1 [Theobroma cacao]
 gb|EOY21712.1| Homeobox protein, putative isoform 1 [Theobroma cacao]
Length=332

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 10/110 (9%)
 Frame = +3

Query  306  KLYMEGTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfngggge  485
            ++Y   T       +  VLLQ+ R PS SE LD  ++P S+PS      SMV+F      
Sbjct  5    RVYPSNTSSAGGSNNLSVLLQSQRVPSSSEPLDPLFIPGSSPSSFLGRRSMVSFEDVHRA  64

Query  486  m----------ergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                       ++    ++     F+Q EKKRRLS +QV FLE+SFEVEN
Sbjct  65   NIANRSFFRTFDQEENGDEDLDEYFHQPEKKRRLSVDQVQFLEKSFEVEN  114



>ref|XP_003613578.1| Homeobox-leucine zipper protein ATHB-16 [Medicago truncatula]
 gb|AES96536.1| homeobox leucine zipper family protein [Medicago truncatula]
Length=324

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 58/109 (53%), Gaps = 14/109 (13%)
 Frame = +3

Query  315  MEGTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfngggge---  485
            M G GK+    +  +LLQN+R P  SEVL+S W+ T   SFQ S S +   NGGG     
Sbjct  1    MAG-GKLFGGSNMSLLLQNERLPCTSEVLESLWVHTP-ASFQGSNSVVNFENGGGSNRVV  58

Query  486  ---------mergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                      +     ++     ++Q  KKRRLS EQV FLE+SFEVEN
Sbjct  59   TDRPFFQQLEKEENCGDEDYEACYHQQGKKRRLSSEQVQFLEKSFEVEN  107



>ref|XP_007037212.1| Homeobox protein, putative isoform 2 [Theobroma cacao]
 gb|EOY21713.1| Homeobox protein, putative isoform 2 [Theobroma cacao]
Length=334

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 12/112 (11%)
 Frame = +3

Query  306  KLYMEGTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPS------------FQASA  449
            ++Y   T       +  VLLQ+ R PS SE LD  ++P S+PS            F+   
Sbjct  5    RVYPSNTSSAGGSNNLSVLLQSQRVPSSSEPLDPLFIPGSSPSSFLVSGRRSMVSFEDVH  64

Query  450  SSMVnfnggggemergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
             + +         ++    ++     F+Q EKKRRLS +QV FLE+SFEVEN
Sbjct  65   RANIANRSFFRTFDQEENGDEDLDEYFHQPEKKRRLSVDQVQFLEKSFEVEN  116



>ref|XP_008339943.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Malus domestica]
Length=327

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (59%), Gaps = 11/104 (11%)
 Frame = +3

Query  324  TGKM-SSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggem----  488
            +GK+  S  D +V+ QN++ P  S+VL+S W+PT + SF  S +SMVNF           
Sbjct  3    SGKLYGSSADMKVIFQNEKRPRSSDVLESLWIPTPSSSFHGS-NSMVNFENVSEGDSLDR  61

Query  489  -----ergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                 ++   +EDY GG  +Q  KKRRL+  QV FLE+ FE+EN
Sbjct  62   PFFQPKQENEDEDYYGGYLHQPGKKRRLTANQVQFLEKKFELEN  105



>ref|XP_011028710.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Populus 
euphratica]
 ref|XP_011028711.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Populus 
euphratica]
Length=314

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 12/105 (11%)
 Frame = +3

Query  321  GTGKMSSCVDNRVLLQNDRFP-SPSEVLDSFWLPTSNPSFQASASSMVnfnggggemer-  494
            GTG  +S +   VLLQ+ R P + S+ L+SF+L  S+PSF  S S M   +         
Sbjct  4    GTGGSNSNL--SVLLQSQRGPCAASQPLESFFLSGSSPSFLGSRSMMSFEDVHQANGSTR  61

Query  495  --------gggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                        +D     F+Q EKKRRL+ +QV FLE+SFEVEN
Sbjct  62   PFFRSFDHEDNGDDDLDEYFHQPEKKRRLTVDQVQFLERSFEVEN  106



>ref|XP_007225072.1| hypothetical protein PRUPE_ppa018002mg [Prunus persica]
 gb|EMJ26271.1| hypothetical protein PRUPE_ppa018002mg [Prunus persica]
Length=321

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 53/103 (51%), Gaps = 8/103 (8%)
 Frame = +3

Query  321  GTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQA--------SASSMVnfngg  476
              GK+ S  D  V+ QN++ P  S+VL+S W+PTS+ SF          SAS   + +  
Sbjct  2    AGGKLYSASDMNVIFQNEKLPCSSDVLESIWVPTSSSSFHGSNSMVHFESASGEDSLDRS  61

Query  477  ggemergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                      +D       Q  KKRRL+ +QV FLE++FEVEN
Sbjct  62   FFRPIDKENGDDDYDASLNQPGKKRRLTVDQVQFLEKNFEVEN  104



>ref|XP_008221689.1| PREDICTED: homeobox-leucine zipper protein HAT5 isoform X2 [Prunus 
mume]
Length=321

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = +3

Query  315  MEGTGKMSSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQA--------SASSMVnfn  470
            M G GK+ S  D  V+ QN++ P  S+VL+S W+PTS+ SF          SAS   + +
Sbjct  1    MSG-GKLYSASDMNVIFQNEKLPCSSDVLESIWVPTSSSSFHGSNSVVNFESASGEDSLD  59

Query  471  ggggemergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                        +D       Q  KKRRL+ +QV FLE++FEVEN
Sbjct  60   RSFFRPIDKENGDDDYDASLNQPGKKRRLTVDQVQFLEKNFEVEN  104



>ref|XP_002321530.2| hypothetical protein POPTR_0015s07640g [Populus trichocarpa]
 gb|ABK95823.1| unknown [Populus trichocarpa]
 gb|EEF05657.2| hypothetical protein POPTR_0015s07640g [Populus trichocarpa]
Length=314

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 12/105 (11%)
 Frame = +3

Query  321  GTGKMSSCVDNRVLLQNDRFP-SPSEVLDSFWLPTSNPSFQASASSMVnfnggggemer-  494
            GTG  +S +   VLLQ+ R P + S+ L+SF+L  S+PSF  S S M   +         
Sbjct  4    GTGGSNSNL--SVLLQSQRGPCAASQPLESFFLSGSSPSFLGSRSMMSFEDVHQANGSTR  61

Query  495  --------gggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                        +D     F+Q EKKRRL+ +QV FLE+SFE+EN
Sbjct  62   PFFRSFDHEDNGDDDLDEYFHQPEKKRRLTVDQVQFLEKSFELEN  106



>ref|XP_002271692.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Vitis vinifera]
Length=317

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (54%), Gaps = 9/99 (9%)
 Frame = +3

Query  336  SSCVDNRVLLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggem---------  488
            S  V+   +LQN R P  S+ LD+ +L  S+PSF  S S +   +   G+          
Sbjct  3    SGRVNLAAMLQNQRVPCSSQPLDALFLSASSPSFLGSRSMLSFEDVRAGKRPDNPFFCQF  62

Query  489  ergggnedyggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
            +     ++     F+Q EKKRRL+ +QV FLE++FEVEN
Sbjct  63   DHDENGDEDLDEYFHQPEKKRRLTADQVQFLERNFEVEN  101



>emb|CBI15277.3| unnamed protein product [Vitis vinifera]
Length=263

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 9/91 (10%)
 Frame = +3

Query  360  LLQNDRFPSPSEVLDSFWLPTSNPSFQASASSMVnfnggggem---------ergggned  512
            +LQN R P  S+ LD+ +L  S+PSF  S S +   +   G+          +     ++
Sbjct  1    MLQNQRVPCSSQPLDALFLSASSPSFLGSRSMLSFEDVRAGKRPDNPFFCQFDHDENGDE  60

Query  513  yggggFYQAEKKRRLSPEQVHFLEQSFEVEN  605
                 F+Q EKKRRL+ +QV FLE++FEVEN
Sbjct  61   DLDEYFHQPEKKRRLTADQVQFLERNFEVEN  91



>gb|EYU22443.1| hypothetical protein MIMGU_mgv1a012337mg [Erythranthe guttata]
Length=253

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +3

Query  405  SFWLPTSNPSFQASASSMVnfnggggemergggnedyggggFYQAEKKRRLSPEQVHFLE  584
            S W   S+PSF  SAS +           +   + +   G F+Q+EKKRRL P+QV FLE
Sbjct  4    SIWASNSSPSFHGSASMVNFEEFRDNNKNKNNNSNEELDGSFHQSEKKRRLKPDQVRFLE  63

Query  585  QSFEVEN  605
            +SF++EN
Sbjct  64   KSFDLEN  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370