BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015E02 358 bp,:Filtered

Length=313
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU25073.1|  hypothetical protein MIMGU_mgv1a004626mg              65.9    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_006353341.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  63.2    4e-09   Solanum tuberosum [potatoes]
ref|XP_004234369.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    63.2    4e-09   Solanum lycopersicum
ref|XP_009611987.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    61.2    2e-08   Nicotiana tomentosiformis
ref|XP_009780428.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    60.8    2e-08   Nicotiana sylvestris
ref|XP_011076205.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    60.8    2e-08   Sesamum indicum [beniseed]
gb|KJB23887.1|  hypothetical protein B456_004G120500                  60.5    3e-08   Gossypium raimondii
gb|KJB23888.1|  hypothetical protein B456_004G120500                  60.5    3e-08   Gossypium raimondii
gb|KJB23889.1|  hypothetical protein B456_004G120500                  60.5    3e-08   Gossypium raimondii
gb|KHG14370.1|  E3 ubiquitin-protein ligase XBAT33                    58.9    3e-08   Gossypium arboreum [tree cotton]
gb|KEH43741.1|  E3 ubiquitin-protein ligase XBOS33, putative          60.1    5e-08   Medicago truncatula
ref|XP_006599617.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  59.7    5e-08   Glycine max [soybeans]
ref|XP_003548210.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  59.7    5e-08   Glycine max [soybeans]
gb|KHN31521.1|  E3 ubiquitin-protein ligase XBAT33                    59.7    5e-08   Glycine soja [wild soybean]
ref|XP_007143379.1|  hypothetical protein PHAVU_007G067600g           59.7    5e-08   Phaseolus vulgaris [French bean]
ref|XP_004515712.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  59.3    7e-08   Cicer arietinum [garbanzo]
ref|XP_010693474.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    58.9    1e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007038626.1|  XB3 in isoform 1                                 58.9    1e-07   Theobroma cacao [chocolate]
gb|KDO60057.1|  hypothetical protein CISIN_1g010335mg                 58.5    1e-07   Citrus sinensis [Valencia orange]
gb|KDO60056.1|  hypothetical protein CISIN_1g010335mg                 58.9    1e-07   Citrus sinensis [Valencia orange]
gb|KHG14369.1|  E3 ubiquitin-protein ligase XBAT33                    58.5    1e-07   Gossypium arboreum [tree cotton]
gb|KJB52820.1|  hypothetical protein B456_008G279200                  58.9    1e-07   Gossypium raimondii
gb|KEH43740.1|  E3 ubiquitin-protein ligase XBOS33, putative          58.5    1e-07   Medicago truncatula
gb|KJB52821.1|  hypothetical protein B456_008G279200                  58.9    1e-07   Gossypium raimondii
ref|XP_006490350.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  58.5    1e-07   Citrus sinensis [Valencia orange]
ref|XP_006421881.1|  hypothetical protein CICLE_v10004762mg           58.5    1e-07   Citrus clementina
ref|XP_003556093.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  58.5    1e-07   Glycine max [soybeans]
gb|KHN21722.1|  E3 ubiquitin-protein ligase XBAT33                    58.5    2e-07   Glycine soja [wild soybean]
ref|XP_003536476.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  58.2    2e-07   Glycine max [soybeans]
ref|XP_008377291.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  58.2    2e-07   Malus domestica [apple tree]
ref|XP_003534009.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  58.2    2e-07   Glycine max [soybeans]
gb|KHM99147.1|  E3 ubiquitin-protein ligase XBAT33                    58.2    2e-07   Glycine soja [wild soybean]
ref|XP_002278915.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    57.8    2e-07   Vitis vinifera
gb|KHN26672.1|  E3 ubiquitin-protein ligase XBAT33                    57.4    2e-07   Glycine soja [wild soybean]
ref|XP_002322458.1|  ankyrin repeat family protein                    57.8    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011048674.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  57.8    3e-07   Populus euphratica
ref|XP_007038628.1|  XB3 in isoform 3                                 57.0    4e-07   Theobroma cacao [chocolate]
ref|XP_010107417.1|  E3 ubiquitin-protein ligase XBAT33               57.0    4e-07   Morus notabilis
ref|XP_003635934.1|  Ankyrin repeat-containing protein                57.0    5e-07   
ref|XP_011012368.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  56.6    5e-07   Populus euphratica
ref|XP_011030079.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  56.6    5e-07   Populus euphratica
ref|XP_011012367.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  56.6    6e-07   Populus euphratica
ref|XP_002318233.2|  ankyrin repeat family protein                    56.6    6e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011030078.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  56.6    6e-07   Populus euphratica
ref|XP_004308108.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    56.6    6e-07   Fragaria vesca subsp. vesca
ref|XP_004496592.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  56.6    7e-07   Cicer arietinum [garbanzo]
ref|XP_007219024.1|  hypothetical protein PRUPE_ppa004397mg           56.2    8e-07   Prunus persica
ref|XP_010035107.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  56.2    9e-07   Eucalyptus grandis [rose gum]
ref|XP_008234275.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  56.2    9e-07   Prunus mume [ume]
ref|XP_008467229.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.8    9e-07   Cucumis melo [Oriental melon]
ref|XP_010035108.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.8    1e-06   Eucalyptus grandis [rose gum]
ref|XP_008467228.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.8    1e-06   Cucumis melo [Oriental melon]
ref|XP_004143630.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.8    1e-06   Cucumis sativus [cucumbers]
ref|XP_010035106.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.8    1e-06   Eucalyptus grandis [rose gum]
ref|XP_010546090.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.5    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_008376541.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.5    1e-06   
ref|XP_010546089.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.5    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_008376540.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  55.5    2e-06   Malus domestica [apple tree]
emb|CDY66355.1|  BnaCnng50490D                                        55.5    2e-06   Brassica napus [oilseed rape]
ref|XP_007152320.1|  hypothetical protein PHAVU_004G119800g           55.1    2e-06   Phaseolus vulgaris [French bean]
ref|XP_009371305.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    55.1    2e-06   Pyrus x bretschneideri [bai li]
emb|CDP05231.1|  unnamed protein product                              54.7    3e-06   Coffea canephora [robusta coffee]
gb|KFK25121.1|  hypothetical protein AALP_AA8G068400                  53.9    4e-06   Arabis alpina [alpine rockcress]
emb|CDX98991.1|  BnaC09g48440D                                        53.9    5e-06   Brassica napus [oilseed rape]
emb|CAB87283.1|  putative protein                                     53.9    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287529.1|  hypothetical protein CARUB_v10000735mg           53.9    5e-06   Capsella rubella
ref|XP_006399209.1|  hypothetical protein EUTSA_v10013287mg           53.9    6e-06   Eutrema salsugineum
ref|XP_010452683.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    53.9    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009122357.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT33    53.9    6e-06   Brassica rapa
ref|XP_010423234.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  53.5    6e-06   Camelina sativa [gold-of-pleasure]
ref|NP_196344.2|  E3 ubiquitin-protein ligase XBAT33                  53.5    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDP22309.1|  hypothetical protein JCGZ_26140                       53.1    9e-06   Jatropha curcas
ref|XP_002510819.1|  ankyrin repeat-containing protein, putative      52.8    1e-05   Ricinus communis
ref|XP_010255493.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  50.4    7e-05   Nelumbo nucifera [Indian lotus]
gb|AAG13435.1|AC051634_16  hypothetical protein                       49.3    7e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ95562.1|  predicted protein                                    48.9    9e-05   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003574216.1|  PREDICTED: probable E3 ubiquitin-protein lig...  50.1    9e-05   Brachypodium distachyon [annual false brome]
ref|XP_010278584.1|  PREDICTED: E3 ubiquitin-protein ligase XBAT3...  49.7    1e-04   Nelumbo nucifera [Indian lotus]
dbj|BAJ88593.1|  predicted protein                                    49.3    2e-04   Hordeum vulgare subsp. vulgare [barley]
gb|ABG66196.1|  pollen ankyrin, putative, expressed                   48.5    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010919261.1|  PREDICTED: probable E3 ubiquitin-protein lig...  48.9    2e-04   Elaeis guineensis
ref|XP_006661969.1|  PREDICTED: probable E3 ubiquitin-protein lig...  48.9    2e-04   Oryza brachyantha
ref|XP_010933861.1|  PREDICTED: probable E3 ubiquitin-protein lig...  48.9    3e-04   Elaeis guineensis
ref|XP_010933862.1|  PREDICTED: probable E3 ubiquitin-protein lig...  48.5    3e-04   Elaeis guineensis
gb|AAM92304.1|  hypothetical protein                                  48.5    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51282.1|  hypothetical protein OsJ_32192                        48.5    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008799539.1|  PREDICTED: probable E3 ubiquitin-protein lig...  48.5    3e-04   Phoenix dactylifera
gb|EEC67327.1|  hypothetical protein OsI_34359                        48.5    3e-04   Oryza sativa Indica Group [Indian rice]
sp|Q337A0.1|XB33_ORYSJ  RecName: Full=Probable E3 ubiquitin-prote...  48.5    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004983888.1|  PREDICTED: probable E3 ubiquitin-protein lig...  48.1    4e-04   Setaria italica
ref|XP_006857844.1|  hypothetical protein AMTR_s00069p00056230        47.8    5e-04   Amborella trichopoda
ref|XP_002465047.1|  hypothetical protein SORBIDRAFT_01g031230        47.4    8e-04   Sorghum bicolor [broomcorn]



>gb|EYU25073.1| hypothetical protein MIMGU_mgv1a004626mg [Erythranthe guttata]
Length=517

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            GVRLEKTTCSNMFWGRRSCSRENQCNAEIN
Sbjct  487  GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  516



>ref|XP_006353341.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Solanum tuberosum]
Length=511

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  5    VRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            VRLEKTTCSNMFWGRRSCSRE+QCNAEIN 
Sbjct  482  VRLEKTTCSNMFWGRRSCSREHQCNAEINA  511



>ref|XP_004234369.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Solanum lycopersicum]
Length=511

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  5    VRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            VRLEKTTCSNMFWGRRSCSRE+QCNAEIN 
Sbjct  482  VRLEKTTCSNMFWGRRSCSREHQCNAEINA  511



>ref|XP_009611987.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Nicotiana tomentosiformis]
Length=509

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +2

Query  5    VRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            VRLEKTTCSNMFWGRRSCSRE+QCNAEIN
Sbjct  480  VRLEKTTCSNMFWGRRSCSREHQCNAEIN  508



>ref|XP_009780428.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Nicotiana sylvestris]
Length=511

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +2

Query  5    VRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            VRLEKTTCSNMFWGRRSCSRE+QCNAEIN
Sbjct  482  VRLEKTTCSNMFWGRRSCSREHQCNAEIN  510



>ref|XP_011076205.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Sesamum indicum]
 ref|XP_011076206.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Sesamum indicum]
Length=512

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G+RLEKTTCS+MFWGRRSCSRE+QCNAEIN
Sbjct  482  GMRLEKTTCSSMFWGRRSCSREHQCNAEIN  511



>gb|KJB23887.1| hypothetical protein B456_004G120500 [Gossypium raimondii]
Length=428

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+TTCSNMFWGRRSCSRE+QCN+EIN
Sbjct  398  GPRLERTTCSNMFWGRRSCSREHQCNSEIN  427



>gb|KJB23888.1| hypothetical protein B456_004G120500 [Gossypium raimondii]
Length=510

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+TTCSNMFWGRRSCSRE+QCN+EIN 
Sbjct  480  GPRLERTTCSNMFWGRRSCSREHQCNSEINA  510



>gb|KJB23889.1| hypothetical protein B456_004G120500 [Gossypium raimondii]
Length=521

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+TTCSNMFWGRRSCSRE+QCN+EIN 
Sbjct  491  GPRLERTTCSNMFWGRRSCSREHQCNSEINA  521



>gb|KHG14370.1| E3 ubiquitin-protein ligase XBAT33 [Gossypium arboreum]
Length=270

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN 
Sbjct  240  GPRLERTTCSSMFWGRRSCSREHQCNSEINA  270



>gb|KEH43741.1| E3 ubiquitin-protein ligase XBOS33, putative [Medicago truncatula]
Length=512

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G +L+KTTCSNMFWGRRSCSRE+QCN+EIN 
Sbjct  482  GPKLDKTTCSNMFWGRRSCSREHQCNSEINA  512



>ref|XP_006599617.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X2 
[Glycine max]
Length=504

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKTTCS MFWGRRSCSRE+QCN+EIN 
Sbjct  474  GPRLEKTTCSGMFWGRRSCSREHQCNSEINA  504



>ref|XP_003548210.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X1 
[Glycine max]
Length=511

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKTTCS MFWGRRSCSRE+QCN+EIN 
Sbjct  481  GPRLEKTTCSGMFWGRRSCSREHQCNSEINA  511



>gb|KHN31521.1| E3 ubiquitin-protein ligase XBAT33 [Glycine soja]
Length=511

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKTTCS MFWGRRSCSRE+QCN+EIN 
Sbjct  481  GPRLEKTTCSGMFWGRRSCSREHQCNSEINA  511



>ref|XP_007143379.1| hypothetical protein PHAVU_007G067600g [Phaseolus vulgaris]
 gb|ESW15373.1| hypothetical protein PHAVU_007G067600g [Phaseolus vulgaris]
Length=512

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RL+KTTCS+MFWGRRSCSRENQCN+EIN
Sbjct  482  GPRLDKTTCSSMFWGRRSCSRENQCNSEIN  511



>ref|XP_004515712.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Cicer arietinum]
Length=515

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RL KTTCS+MFWGRRSCSRENQCN+EIN 
Sbjct  485  GPRLVKTTCSSMFWGRRSCSRENQCNSEINA  515



>ref|XP_010693474.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Beta vulgaris 
subsp. vulgaris]
Length=507

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+T+CS+MFWGRRSCSRENQCN+EIN 
Sbjct  477  GPRLERTSCSSMFWGRRSCSRENQCNSEINA  507



>ref|XP_007038626.1| XB3 in isoform 1 [Theobroma cacao]
 ref|XP_007038627.1| XB3 in isoform 1 [Theobroma cacao]
 gb|EOY23127.1| XB3 in isoform 1 [Theobroma cacao]
 gb|EOY23128.1| XB3 in isoform 1 [Theobroma cacao]
Length=510

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN 
Sbjct  480  GPRLERTTCSSMFWGRRSCSREHQCNSEINA  510



>gb|KDO60057.1| hypothetical protein CISIN_1g010335mg [Citrus sinensis]
Length=431

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  401  GPRLERTTCSSMFWGRRSCSREHQCNSEIN  430



>gb|KDO60056.1| hypothetical protein CISIN_1g010335mg [Citrus sinensis]
Length=489

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN 
Sbjct  459  GPRLERTTCSSMFWGRRSCSREHQCNSEINA  489



>gb|KHG14369.1| E3 ubiquitin-protein ligase XBAT33 [Gossypium arboreum]
Length=484

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  454  GPRLERTTCSSMFWGRRSCSREHQCNSEIN  483



>gb|KJB52820.1| hypothetical protein B456_008G279200 [Gossypium raimondii]
Length=511

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN 
Sbjct  481  GPRLERTTCSSMFWGRRSCSREHQCNSEINA  511



>gb|KEH43740.1| E3 ubiquitin-protein ligase XBOS33, putative [Medicago truncatula]
Length=408

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G +L+KTTCSNMFWGRRSCSRE+QCN+EIN
Sbjct  378  GPKLDKTTCSNMFWGRRSCSREHQCNSEIN  407



>gb|KJB52821.1| hypothetical protein B456_008G279200 [Gossypium raimondii]
Length=542

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN 
Sbjct  512  GPRLERTTCSSMFWGRRSCSREHQCNSEINA  542



>ref|XP_006490350.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Citrus sinensis]
 gb|KDO60055.1| hypothetical protein CISIN_1g010335mg [Citrus sinensis]
Length=513

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  483  GPRLERTTCSSMFWGRRSCSREHQCNSEIN  512



>ref|XP_006421881.1| hypothetical protein CICLE_v10004762mg [Citrus clementina]
 ref|XP_006421882.1| hypothetical protein CICLE_v10004762mg [Citrus clementina]
 gb|ESR35121.1| hypothetical protein CICLE_v10004762mg [Citrus clementina]
 gb|ESR35122.1| hypothetical protein CICLE_v10004762mg [Citrus clementina]
Length=513

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  483  GPRLERTTCSSMFWGRRSCSREHQCNSEIN  512



>ref|XP_003556093.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Glycine max]
Length=512

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RL+KTTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  482  GPRLDKTTCSSMFWGRRSCSREHQCNSEIN  511



>gb|KHN21722.1| E3 ubiquitin-protein ligase XBAT33 [Glycine soja]
Length=517

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RL+KTTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  487  GPRLDKTTCSSMFWGRRSCSREHQCNSEIN  516



>ref|XP_003536476.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Glycine max]
Length=512

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RL+KTTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  482  GPRLDKTTCSSMFWGRRSCSREHQCNSEIN  511



>ref|XP_008377291.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Malus domestica]
Length=512

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RL KTTCSNMFW RRSCSRE+QCNAEIN 
Sbjct  482  GPRLGKTTCSNMFWSRRSCSREHQCNAEINA  512



>ref|XP_003534009.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Glycine max]
Length=511

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEK TCS MFWGRRSCSRE+QCN+EIN 
Sbjct  481  GPRLEKMTCSGMFWGRRSCSREHQCNSEINA  511



>gb|KHM99147.1| E3 ubiquitin-protein ligase XBAT33 [Glycine soja]
Length=511

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEK TCS MFWGRRSCSRE+QCN+EIN 
Sbjct  481  GPRLEKMTCSGMFWGRRSCSREHQCNSEINA  511



>ref|XP_002278915.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Vitis vinifera]
 emb|CBI31819.3| unnamed protein product [Vitis vinifera]
Length=512

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLE+T+CS+MFWGRRSCSRE+QCN+EIN 
Sbjct  482  GARLERTSCSSMFWGRRSCSREHQCNSEINA  512



>gb|KHN26672.1| E3 ubiquitin-protein ligase XBAT33 [Glycine soja]
Length=329

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RL+KTTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  299  GPRLDKTTCSSMFWGRRSCSREHQCNSEIN  328



>ref|XP_002322458.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF06585.1| ankyrin repeat family protein [Populus trichocarpa]
Length=511

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLEKT+CS+MFWGRRSCSRE+QCN+EIN
Sbjct  481  GPRLEKTSCSSMFWGRRSCSREHQCNSEIN  510



>ref|XP_011048674.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Populus euphratica]
Length=511

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLEKT+CS+MFWGRRSCSRE+QCN+EIN
Sbjct  481  GPRLEKTSCSSMFWGRRSCSREHQCNSEIN  510



>ref|XP_007038628.1| XB3 in isoform 3 [Theobroma cacao]
 ref|XP_007038629.1| XB3 in isoform 3 [Theobroma cacao]
 gb|EOY23129.1| XB3 in isoform 3 [Theobroma cacao]
 gb|EOY23130.1| XB3 in isoform 3 [Theobroma cacao]
Length=424

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  394  GPRLERTTCSSMFWGRRSCSREHQCNSEIN  423



>ref|XP_010107417.1| E3 ubiquitin-protein ligase XBAT33 [Morus notabilis]
 gb|EXC15955.1| E3 ubiquitin-protein ligase XBAT33 [Morus notabilis]
Length=420

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G R E+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  390  GPRFERTTCSSMFWGRRSCSREHQCNSEIN  419



>ref|XP_003635934.1| Ankyrin repeat-containing protein [Medicago truncatula]
 gb|KEH17363.1| E3 ubiquitin-protein ligase XBOS32 [Medicago truncatula]
Length=513

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G +L K TCSNMFWGRRSCSRENQCN+EIN
Sbjct  483  GPKLVKKTCSNMFWGRRSCSRENQCNSEIN  512



>ref|XP_011012368.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X2 
[Populus euphratica]
Length=429

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKT+CS+MFWGRRSCSRE+QC +EIN 
Sbjct  399  GPRLEKTSCSSMFWGRRSCSREHQCTSEINA  429



>ref|XP_011030079.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X2 
[Populus euphratica]
Length=429

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKT+CS+MFWGRRSCSRE+QC +EIN 
Sbjct  399  GPRLEKTSCSSMFWGRRSCSREHQCTSEINA  429



>ref|XP_011012367.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X1 
[Populus euphratica]
Length=511

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKT+CS+MFWGRRSCSRE+QC +EIN 
Sbjct  481  GPRLEKTSCSSMFWGRRSCSREHQCTSEINA  511



>ref|XP_002318233.2| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEE96453.2| ankyrin repeat family protein [Populus trichocarpa]
Length=511

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKT+CS+MFWGRRSCSRE+QC +EIN 
Sbjct  481  GPRLEKTSCSSMFWGRRSCSREHQCTSEINA  511



>ref|XP_011030078.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X1 
[Populus euphratica]
Length=511

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RLEKT+CS+MFWGRRSCSRE+QC +EIN 
Sbjct  481  GPRLEKTSCSSMFWGRRSCSREHQCTSEINA  511



>ref|XP_004308108.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Fragaria vesca 
subsp. vesca]
Length=510

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLEKT+CS+MFW RRSCSRE+QCNAEIN
Sbjct  480  GPRLEKTSCSSMFWSRRSCSREHQCNAEIN  509



>ref|XP_004496592.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Cicer arietinum]
Length=510

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L+KTTCSNMFWGRRSCSRE+QCN+EIN
Sbjct  483  LDKTTCSNMFWGRRSCSREHQCNSEIN  509



>ref|XP_007219024.1| hypothetical protein PRUPE_ppa004397mg [Prunus persica]
 gb|EMJ20223.1| hypothetical protein PRUPE_ppa004397mg [Prunus persica]
Length=512

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLEKT+CS+MFW RRSCSRE+QCNAEIN
Sbjct  482  GPRLEKTSCSSMFWSRRSCSREHQCNAEIN  511



>ref|XP_010035107.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 isoform X2 [Eucalyptus 
grandis]
 gb|KCW46403.1| hypothetical protein EUGRSUZ_K00236 [Eucalyptus grandis]
Length=511

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  8    RLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            R+E+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  483  RVERTTCSSMFWGRRSCSREHQCNSEIN  510



>ref|XP_008234275.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase XBAT33 
[Prunus mume]
Length=512

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLEKT+CS+MFW RRSCSRE+QCNAEIN
Sbjct  482  GPRLEKTSCSSMFWSRRSCSREHQCNAEIN  511



>ref|XP_008467229.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 isoform X2 [Cucumis 
melo]
Length=430

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G R E+T+CS+MFWGRRSCSRENQCN+EIN
Sbjct  400  GPRSERTSCSSMFWGRRSCSRENQCNSEIN  429



>ref|XP_010035108.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 isoform X3 [Eucalyptus 
grandis]
Length=495

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  8    RLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            R+E+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  467  RVERTTCSSMFWGRRSCSREHQCNSEIN  494



>ref|XP_008467228.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 isoform X1 [Cucumis 
melo]
Length=512

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G R E+T+CS+MFWGRRSCSRENQCN+EIN 
Sbjct  482  GPRSERTSCSSMFWGRRSCSRENQCNSEINA  512



>ref|XP_004143630.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Cucumis sativus]
 ref|XP_004162759.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Cucumis sativus]
 gb|KGN50414.1| hypothetical protein Csa_5G172930 [Cucumis sativus]
Length=512

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G R E+T+CS+MFWGRRSCSRENQCN+EIN 
Sbjct  482  GPRSERTSCSSMFWGRRSCSRENQCNSEINA  512



>ref|XP_010035106.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 isoform X1 [Eucalyptus 
grandis]
Length=515

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  8    RLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            R+E+TTCS+MFWGRRSCSRE+QCN+EIN
Sbjct  487  RVERTTCSSMFWGRRSCSREHQCNSEIN  514



>ref|XP_010546090.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 isoform X2 [Tarenaya 
hassleriana]
Length=436

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 1/31 (3%)
 Frame = +2

Query  2    GVRLEKTTCSNM-FWGRRSCSRENQCNAEIN  91
            G RLEKTTCS+M FWGRRSCSRE+QCN+EIN
Sbjct  405  GPRLEKTTCSSMMFWGRRSCSREHQCNSEIN  435



>ref|XP_008376541.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X2 
[Malus domestica]
Length=430

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RL KTTCS+MFW RRSC+RE+QCNAEIN
Sbjct  400  GPRLGKTTCSSMFWSRRSCTREHQCNAEIN  429



>ref|XP_010546089.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 isoform X1 [Tarenaya 
hassleriana]
Length=518

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTTCSNM-FWGRRSCSRENQCNAEINV  94
            G RLEKTTCS+M FWGRRSCSRE+QCN+EIN 
Sbjct  487  GPRLEKTTCSSMMFWGRRSCSREHQCNSEINA  518



>ref|XP_008376540.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like isoform X1 
[Malus domestica]
Length=512

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RL KTTCS+MFW RRSC+RE+QCNAEIN 
Sbjct  482  GPRLGKTTCSSMFWSRRSCTREHQCNAEINA  512



>emb|CDY66355.1| BnaCnng50490D [Brassica napus]
Length=513

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEK-TTCSNMFWGRRSCSRENQCNAEINV  94
            G RL K TTCS+MFWGRRSCSRENQCNAEIN 
Sbjct  482  GQRLGKATTCSSMFWGRRSCSRENQCNAEINA  513



>ref|XP_007152320.1| hypothetical protein PHAVU_004G119800g [Phaseolus vulgaris]
 gb|ESW24314.1| hypothetical protein PHAVU_004G119800g [Phaseolus vulgaris]
Length=510

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RL+KTTCS MFWGRRS SRE+QCN+EIN 
Sbjct  480  GPRLDKTTCSGMFWGRRSYSREHQCNSEINA  510



>ref|XP_009371305.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Pyrus x bretschneideri]
Length=512

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G RL KTTCS+MFW RRSC+RE+QCNAEIN 
Sbjct  482  GPRLGKTTCSSMFWTRRSCTREHQCNAEINA  512



>emb|CDP05231.1| unnamed protein product [Coffea canephora]
Length=512

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
             VRL K TCS+MFWGRRSCSRE++CNAEIN
Sbjct  482  AVRLGKATCSSMFWGRRSCSREHRCNAEIN  511



>gb|KFK25121.1| hypothetical protein AALP_AA8G068400, partial [Arabis alpina]
Length=411

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  380  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  411



>emb|CDX98991.1| BnaC09g48440D [Brassica napus]
Length=514

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  483  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  514



>emb|CAB87283.1| putative protein [Arabidopsis thaliana]
Length=519

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  488  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  519



>ref|XP_006287529.1| hypothetical protein CARUB_v10000735mg [Capsella rubella]
 gb|EOA20427.1| hypothetical protein CARUB_v10000735mg [Capsella rubella]
Length=515

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  484  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  515



>ref|XP_006399209.1| hypothetical protein EUTSA_v10013287mg [Eutrema salsugineum]
 gb|ESQ40662.1| hypothetical protein EUTSA_v10013287mg [Eutrema salsugineum]
Length=511

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  480  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  511



>ref|XP_010452683.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Camelina sativa]
Length=514

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  483  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  514



>ref|XP_009122357.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33 [Brassica rapa]
 emb|CDX70022.1| BnaA10g23710D [Brassica napus]
Length=515

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  484  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  515



>ref|XP_010423234.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Camelina 
sativa]
Length=514

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  483  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  514



>ref|NP_196344.2| E3 ubiquitin-protein ligase XBAT33 [Arabidopsis thaliana]
 sp|Q4FE45.1|XB33_ARATH RecName: Full=E3 ubiquitin-protein ligase XBAT33; AltName: Full=Ankyrin 
repeat domain and RING finger-containing protein 
XBAT33; AltName: Full=Protein XB3 homolog 3 [Arabidopsis thaliana]
 gb|AAZ14070.1| At5g07270 [Arabidopsis thaliana]
 gb|ABK32111.1| At5g07270 [Arabidopsis thaliana]
 gb|AED91131.1| E3 ubiquitin-protein ligase XBAT33 [Arabidopsis thaliana]
Length=513

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +2

Query  2    GVRLEKTT-CSNMFWGRRSCSRENQCNAEINV  94
            G RL KTT CS+MFWGRRSCSRENQCN+EIN 
Sbjct  482  GQRLGKTTTCSSMFWGRRSCSRENQCNSEINA  513



>gb|KDP22309.1| hypothetical protein JCGZ_26140 [Jatropha curcas]
Length=513

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +2

Query  2    GVRLEKTTCSNM-FWGRRSCSRENQCNAEIN  91
            G RLEKT+CS M FWGRRSCSRE+QCN+EIN
Sbjct  482  GPRLEKTSCSGMMFWGRRSCSREHQCNSEIN  512



>ref|XP_002510819.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF51421.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=513

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = +2

Query  2    GVRLEKTTCSNM-FWGRRSCSRENQCNAEIN  91
            G RLEKT+CS M FWGRRSCSRE+QCN+EIN
Sbjct  482  GPRLEKTSCSGMMFWGRRSCSREHQCNSEIN  512



>ref|XP_010255493.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Nelumbo nucifera]
 ref|XP_010255494.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Nelumbo nucifera]
 ref|XP_010255495.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Nelumbo nucifera]
Length=512

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+ +CSNMFW +RSC RE+QCN+E N
Sbjct  482  GPRLERVSCSNMFWNKRSCHREHQCNSETN  511



>gb|AAG13435.1|AC051634_16 hypothetical protein [Oryza sativa Japonica Group]
Length=236

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEINV  94
            L++T+CS MFW RRSC RE QCNAEIN 
Sbjct  209  LDRTSCSGMFWSRRSCHREEQCNAEINA  236



>dbj|BAJ95562.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=221

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEINV  94
            +++TTCS MFW RRSC RE QCNAEIN 
Sbjct  194  VDRTTCSGMFWSRRSCQREQQCNAEINA  221



>ref|XP_003574216.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS33 [Brachypodium 
distachyon]
Length=520

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L++TTCS MFW RRSC RE QCNAEIN
Sbjct  493  LDQTTCSGMFWSRRSCQREQQCNAEIN  519



>ref|XP_010278584.1| PREDICTED: E3 ubiquitin-protein ligase XBAT33-like [Nelumbo nucifera]
Length=511

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G RLE+ +CS +FW RRSC RE+QCN+EIN
Sbjct  481  GPRLERVSCSRLFWNRRSCHREHQCNSEIN  510



>dbj|BAJ88593.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            +++TTCS MFW RRSC RE QCNAEIN
Sbjct  493  VDRTTCSGMFWSRRSCQREQQCNAEIN  519



>gb|ABG66196.1| pollen ankyrin, putative, expressed [Oryza sativa Japonica Group]
Length=334

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEINV  94
            L++T+CS MFW RRSC RE QCNAEIN 
Sbjct  307  LDRTSCSGMFWSRRSCHREEQCNAEINA  334



>ref|XP_010919261.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS33 [Elaeis 
guineensis]
Length=517

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  8    RLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            R+++T+CS MFW RRSC RE+QCN+EIN
Sbjct  489  RVDRTSCSGMFWNRRSCHREHQCNSEIN  516



>ref|XP_006661969.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS33-like [Oryza 
brachyantha]
Length=519

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L++T+CS MFW RRSC RE QCNAEIN
Sbjct  492  LDRTSCSGMFWSRRSCHREEQCNAEIN  518



>ref|XP_010933861.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS33 isoform 
X1 [Elaeis guineensis]
Length=518

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  8    RLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            R+++T+CS MFW RRSC RE+QCN+EIN
Sbjct  490  RVDRTSCSGMFWNRRSCHREHQCNSEIN  517



>ref|XP_010933862.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS33 isoform 
X2 [Elaeis guineensis]
Length=514

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  8    RLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            R+++T+CS MFW RRSC RE+QCN+EIN
Sbjct  486  RVDRTSCSGMFWNRRSCHREHQCNSEIN  513



>gb|AAM92304.1| hypothetical protein [Oryza sativa Japonica Group]
Length=539

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L++T+CS MFW RRSC RE QCNAEIN
Sbjct  512  LDRTSCSGMFWSRRSCHREEQCNAEIN  538



>gb|EEE51282.1| hypothetical protein OsJ_32192 [Oryza sativa Japonica Group]
Length=520

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L++T+CS MFW RRSC RE QCNAEIN
Sbjct  493  LDRTSCSGMFWSRRSCHREEQCNAEIN  519



>ref|XP_008799539.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS33 [Phoenix 
dactylifera]
Length=517

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  8    RLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            R+++T+CS MFW RRSC RE+QCN+EIN 
Sbjct  489  RVDRTSCSGMFWNRRSCHREHQCNSEINA  517



>gb|EEC67327.1| hypothetical protein OsI_34359 [Oryza sativa Indica Group]
Length=520

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L++T+CS MFW RRSC RE QCNAEIN
Sbjct  493  LDRTSCSGMFWSRRSCHREEQCNAEIN  519



>sp|Q337A0.1|XB33_ORYSJ RecName: Full=Probable E3 ubiquitin-protein ligase XBOS33; AltName: 
Full=Ankyrin repeat domain and RING finger-containing 
protein XBOS33; AltName: Full=XB3 protein homolog 3 [Oryza 
sativa Japonica Group]
 gb|ABB47902.2| pollen ankyrin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG89425.1| unnamed protein product [Oryza sativa Japonica Group]
Length=520

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L++T+CS MFW RRSC RE QCNAEIN
Sbjct  493  LDRTSCSGMFWSRRSCHREEQCNAEIN  519



>ref|XP_004983888.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS33-like [Setaria 
italica]
Length=519

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEIN  91
            G  L++T+CS MFW RRSC RE QC+AEIN
Sbjct  489  GEDLDRTSCSGMFWSRRSCHREQQCDAEIN  518



>ref|XP_006857844.1| hypothetical protein AMTR_s00069p00056230 [Amborella trichopoda]
 gb|ERN19311.1| hypothetical protein AMTR_s00069p00056230 [Amborella trichopoda]
Length=519

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    GVRLEKTTCSNMFWGRRSCSRENQCNAEINV  94
            G  +EKT+CS MFW RRSC RE+QC +EIN 
Sbjct  489  GAWIEKTSCSKMFWNRRSCHREHQCTSEINA  519



>ref|XP_002465047.1| hypothetical protein SORBIDRAFT_01g031230 [Sorghum bicolor]
 gb|EER92045.1| hypothetical protein SORBIDRAFT_01g031230 [Sorghum bicolor]
Length=520

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  11   LEKTTCSNMFWGRRSCSRENQCNAEIN  91
            L++T+CS MFW RRSC RE QC+AEIN
Sbjct  493  LDRTSCSGMFWSRRSCHREQQCDAEIN  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556888308225