BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP015D12 470 bp,:Filtered

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11432.1|  unnamed protein product                              76.3    6e-15   Coffea canephora [robusta coffee]
ref|XP_009627813.1|  PREDICTED: uncharacterized protein LOC104118301  74.7    2e-14   Nicotiana tomentosiformis
ref|XP_009764165.1|  PREDICTED: uncharacterized protein LOC104215926  74.7    3e-14   Nicotiana sylvestris
ref|XP_006359046.1|  PREDICTED: uncharacterized protein LOC102585655  73.6    6e-14   
ref|XP_010097663.1|  hypothetical protein L484_023803                 73.2    8e-14   Morus notabilis
ref|XP_010320114.1|  PREDICTED: uncharacterized protein LOC104647137  73.6    8e-14   Solanum lycopersicum
ref|XP_003634523.1|  PREDICTED: uncharacterized protein LOC100854843  71.6    3e-13   Vitis vinifera
ref|XP_007019583.1|  Mediator of RNA polymerase II transcription ...  71.2    5e-13   Theobroma cacao [chocolate]
ref|XP_011101196.1|  PREDICTED: uncharacterized protein LOC105179276  69.7    1e-12   Sesamum indicum [beniseed]
ref|XP_002306717.1|  hypothetical protein POPTR_0005s21760g           69.3    2e-12   Populus trichocarpa [western balsam poplar]
emb|CBI18237.3|  unnamed protein product                              69.7    3e-12   Vitis vinifera
ref|XP_010268571.1|  PREDICTED: uncharacterized protein LOC104605490  68.6    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_002302161.1|  hypothetical protein POPTR_0002s06580g           67.4    1e-11   Populus trichocarpa [western balsam poplar]
gb|KJB28970.1|  hypothetical protein B456_005G077700                  67.0    2e-11   Gossypium raimondii
gb|KDP36568.1|  hypothetical protein JCGZ_08335                       67.0    2e-11   Jatropha curcas
gb|EYU36830.1|  hypothetical protein MIMGU_mgv1a017284mg              66.6    2e-11   Erythranthe guttata [common monkey flower]
gb|KDO83797.1|  hypothetical protein CISIN_1g034641mg                 65.9    4e-11   Citrus sinensis [Valencia orange]
ref|XP_006434510.1|  hypothetical protein CICLE_v10003573mg           65.9    4e-11   Citrus clementina
ref|NP_001058402.1|  Os06g0686600                                     65.9    5e-11   
gb|KGN45893.1|  hypothetical protein Csa_6G017090                     64.7    9e-11   Cucumis sativus [cucumbers]
gb|AFK41103.1|  unknown                                               64.3    1e-10   Lotus japonicus
ref|XP_010062094.1|  PREDICTED: uncharacterized protein LOC104449583  63.5    3e-10   Eucalyptus grandis [rose gum]
ref|XP_010932053.1|  PREDICTED: uncharacterized protein LOC105052817  63.9    4e-10   Elaeis guineensis
ref|XP_003592063.1|  hypothetical protein MTR_1g098310                63.2    4e-10   Medicago truncatula
ref|XP_003556161.1|  PREDICTED: uncharacterized protein LOC100776380  62.8    5e-10   Glycine max [soybeans]
ref|XP_003563451.1|  PREDICTED: uncharacterized protein LOC100826521  62.8    5e-10   Brachypodium distachyon [annual false brome]
ref|XP_002976822.1|  hypothetical protein SELMODRAFT_105899           62.8    6e-10   Selaginella moellendorffii
ref|XP_007143570.1|  hypothetical protein PHAVU_007G082800g           62.8    6e-10   Phaseolus vulgaris [French bean]
ref|XP_007151977.1|  hypothetical protein PHAVU_004G091400g           62.4    7e-10   Phaseolus vulgaris [French bean]
ref|XP_006656402.1|  PREDICTED: uncharacterized protein LOC102718280  62.4    8e-10   Oryza brachyantha
ref|XP_002524325.1|  conserved hypothetical protein                   62.4    9e-10   
gb|EMT21739.1|  hypothetical protein F775_30902                       62.0    1e-09   Aegilops tauschii
gb|ACU16913.1|  unknown                                               61.6    1e-09   Glycine max [soybeans]
dbj|BAK02428.1|  predicted protein                                    61.6    1e-09   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008793904.1|  PREDICTED: uncharacterized protein LOC103710078  61.2    2e-09   Phoenix dactylifera
ref|XP_002438896.1|  hypothetical protein SORBIDRAFT_10g027850        61.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_004966250.1|  PREDICTED: uncharacterized protein LOC101782426  61.2    2e-09   Setaria italica
ref|NP_001152913.1|  uncharacterized protein LOC100276361             60.8    3e-09   Zea mays [maize]
gb|KHN41303.1|  hypothetical protein glysoja_030141                   60.5    3e-09   Glycine soja [wild soybean]
ref|NP_001143448.1|  uncharacterized protein LOC100276103             60.1    5e-09   
ref|XP_004290488.1|  PREDICTED: uncharacterized protein LOC101310479  59.7    6e-09   Fragaria vesca subsp. vesca
gb|ABK22684.1|  unknown                                               59.3    1e-08   Picea sitchensis
ref|XP_009401372.1|  PREDICTED: uncharacterized protein LOC103985414  57.8    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010652886.1|  PREDICTED: uncharacterized protein LOC104879927  57.0    6e-08   Vitis vinifera
ref|XP_009403203.1|  PREDICTED: uncharacterized protein LOC103986822  57.4    8e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006288984.1|  hypothetical protein CARUB_v10002358mg           56.6    9e-08   Capsella rubella
ref|NP_192727.1|  uncharacterized protein                             56.6    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237494.1|  PREDICTED: uncharacterized protein LOC103336230  56.6    9e-08   Prunus mume [ume]
emb|CDP12860.1|  unnamed protein product                              56.2    1e-07   Coffea canephora [robusta coffee]
ref|XP_002310621.1|  hypothetical protein POPTR_0007s06990g           56.2    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007201433.1|  hypothetical protein PRUPE_ppa013713mg           56.6    1e-07   Prunus persica
ref|XP_002872475.1|  hypothetical protein ARALYDRAFT_489838           55.5    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010096474.1|  hypothetical protein L484_006721                 55.5    2e-07   Morus notabilis
gb|KFK32039.1|  hypothetical protein AALP_AA6G192400                  55.5    2e-07   Arabis alpina [alpine rockcress]
emb|CAN64856.1|  hypothetical protein VITISV_030491                   56.6    3e-07   Vitis vinifera
ref|XP_003518540.1|  PREDICTED: uncharacterized protein LOC100306191  54.7    3e-07   Glycine max [soybeans]
ref|XP_004496440.1|  PREDICTED: uncharacterized protein LOC101513...  54.7    4e-07   
ref|XP_009113577.1|  PREDICTED: uncharacterized protein LOC103838879  54.7    4e-07   Brassica rapa
ref|XP_007048178.1|  Uncharacterized protein TCM_001296               53.9    6e-07   Theobroma cacao [chocolate]
ref|XP_006427923.1|  hypothetical protein CICLE_v10026866mg           53.9    7e-07   Citrus clementina
ref|XP_001766440.1|  predicted protein                                53.5    9e-07   Physcomitrella patens
gb|KDO57123.1|  hypothetical protein CISIN_1g034773mg                 53.5    1e-06   Citrus sinensis [Valencia orange]
gb|EPS71133.1|  hypothetical protein M569_03627                       53.1    1e-06   Genlisea aurea
ref|XP_001766447.1|  predicted protein                                53.1    1e-06   Physcomitrella patens
emb|CDX99512.1|  BnaC09g24800D                                        53.1    1e-06   Brassica napus [oilseed rape]
ref|NP_001049870.1|  Os03g0302500                                     53.5    2e-06   
gb|EYU24060.1|  hypothetical protein MIMGU_mgv1a017325mg              52.8    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_009768396.1|  PREDICTED: uncharacterized protein LOC104219405  53.1    2e-06   Nicotiana sylvestris
gb|AFG44226.1|  hypothetical protein 2_1728_01                        53.1    2e-06   Pinus taeda
gb|AEW08166.1|  hypothetical protein 2_1728_01                        53.1    2e-06   Pinus radiata
gb|KHN09564.1|  hypothetical protein glysoja_011838                   52.8    2e-06   Glycine soja [wild soybean]
ref|XP_006856469.1|  hypothetical protein AMTR_s00046p00044470        52.4    2e-06   
gb|ABK21328.1|  unknown                                               52.8    3e-06   Picea sitchensis
emb|CDY57721.1|  BnaC04g51930D                                        52.8    3e-06   Brassica napus [oilseed rape]
ref|XP_003528030.2|  PREDICTED: uncharacterized protein LOC100795724  52.4    3e-06   
gb|EAY89670.1|  hypothetical protein OsI_11203                        53.1    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_002530262.1|  conserved hypothetical protein                   52.4    3e-06   
gb|EAY89674.1|  hypothetical protein OsI_11208                        53.1    3e-06   Oryza sativa Indica Group [Indian rice]
gb|KDP35289.1|  hypothetical protein JCGZ_09448                       52.0    3e-06   Jatropha curcas
ref|XP_009349933.1|  PREDICTED: uncharacterized protein LOC103941464  52.0    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_008660225.1|  PREDICTED: uncharacterized protein LOC103639235  52.4    4e-06   Zea mays [maize]
ref|XP_003603170.1|  hypothetical protein MTR_3g104640                52.0    4e-06   Medicago truncatula
ref|XP_008795587.1|  PREDICTED: uncharacterized protein LOC103711279  53.1    4e-06   Phoenix dactylifera
gb|KHN17682.1|  hypothetical protein glysoja_005879                   52.4    4e-06   Glycine soja [wild soybean]
ref|NP_001236822.1|  uncharacterized protein LOC100527749             52.4    4e-06   Glycine max [soybeans]
ref|XP_007204834.1|  hypothetical protein PRUPE_ppa026980mg           52.4    5e-06   Prunus persica
ref|XP_009349378.1|  PREDICTED: uncharacterized protein LOC103940922  52.4    5e-06   Pyrus x bretschneideri [bai li]
ref|NP_182270.1|  uncharacterized protein                             52.0    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337723.1|  PREDICTED: uncharacterized protein LOC103400824  52.0    5e-06   Malus domestica [apple tree]
ref|XP_007154634.1|  hypothetical protein PHAVU_003G135000g           52.0    5e-06   Phaseolus vulgaris [French bean]
gb|AFK46816.1|  unknown                                               52.0    5e-06   Medicago truncatula
ref|XP_009142529.1|  PREDICTED: uncharacterized protein LOC103866376  52.0    5e-06   Brassica rapa
gb|AFK37685.1|  unknown                                               52.0    6e-06   Medicago truncatula
ref|XP_004984650.1|  PREDICTED: histone acetyltransferase KAT2A-like  52.0    6e-06   Setaria italica
ref|XP_010069874.1|  PREDICTED: uncharacterized protein LOC104456719  51.6    6e-06   Eucalyptus grandis [rose gum]
ref|XP_008242377.1|  PREDICTED: uncharacterized protein LOC103340711  52.4    6e-06   Prunus mume [ume]
ref|XP_007136845.1|  hypothetical protein PHAVU_009G079000g           51.6    6e-06   Phaseolus vulgaris [French bean]
ref|XP_007207520.1|  hypothetical protein PRUPE_ppa013987mg           51.2    6e-06   Prunus persica
ref|XP_002882120.1|  hypothetical protein ARALYDRAFT_904223           51.6    6e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_006842334.1|  hypothetical protein AMTR_s00079p00164570        51.2    7e-06   
ref|XP_006480043.1|  PREDICTED: uncharacterized protein LOC102625735  51.6    7e-06   Citrus sinensis [Valencia orange]
ref|XP_002308546.1|  hypothetical protein POPTR_0006s24240g           51.6    7e-06   Populus trichocarpa [western balsam poplar]
gb|AFK48123.1|  unknown                                               51.6    7e-06   Lotus japonicus
ref|XP_010544986.1|  PREDICTED: uncharacterized protein LOC104817471  51.2    8e-06   Tarenaya hassleriana [spider flower]
gb|KJB65518.1|  hypothetical protein B456_010G098600                  51.2    9e-06   Gossypium raimondii
dbj|BAJ91043.1|  predicted protein                                    51.6    9e-06   Hordeum vulgare subsp. vulgare [barley]
ref|XP_004243747.1|  PREDICTED: uncharacterized protein LOC101265147  51.2    9e-06   Solanum lycopersicum
ref|XP_006357712.1|  PREDICTED: uncharacterized protein LOC102593175  51.6    1e-05   Solanum tuberosum [potatoes]
ref|NP_001235166.1|  uncharacterized protein LOC100305934             51.2    1e-05   Glycine max [soybeans]
gb|KHN29707.1|  hypothetical protein glysoja_016329                   51.2    1e-05   Glycine soja [wild soybean]
ref|XP_001772172.1|  predicted protein                                50.1    1e-05   Physcomitrella patens
ref|NP_001236849.1|  uncharacterized protein LOC100306567             50.8    1e-05   Glycine max [soybeans]
gb|KHN06628.1|  hypothetical protein glysoja_040133                   50.8    1e-05   Glycine soja [wild soybean]
ref|XP_002878468.1|  hypothetical protein ARALYDRAFT_907837           50.8    1e-05   Arabidopsis lyrata subsp. lyrata
ref|NP_001144614.1|  hypothetical protein                             50.8    1e-05   Zea mays [maize]
gb|AAM63039.1|  unknown                                               50.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397942.1|  hypothetical protein EUTSA_v10001686mg           50.8    1e-05   Eutrema salsugineum
ref|XP_009615642.1|  PREDICTED: uncharacterized protein LOC104108337  50.8    1e-05   Nicotiana tomentosiformis
ref|XP_010242270.1|  PREDICTED: uncharacterized protein LOC104586667  50.8    1e-05   Nelumbo nucifera [Indian lotus]
gb|EPS65655.1|  hypothetical protein M569_09126                       50.1    1e-05   Genlisea aurea
ref|XP_006397132.1|  hypothetical protein EUTSA_v10029196mg           50.4    1e-05   Eutrema salsugineum
ref|XP_002467994.1|  hypothetical protein SORBIDRAFT_01g037750        51.6    1e-05   Sorghum bicolor [broomcorn]
ref|NP_191823.1|  uncharacterized protein                             50.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051058.1|  Uncharacterized protein TCM_004766               50.4    1e-05   Theobroma cacao [chocolate]
ref|XP_007012782.1|  Uncharacterized protein TCM_037625               50.8    1e-05   Theobroma cacao [chocolate]
ref|XP_009606358.1|  PREDICTED: uncharacterized protein LOC104100753  50.8    1e-05   Nicotiana tomentosiformis
ref|XP_010648337.1|  PREDICTED: uncharacterized protein LOC104878982  50.4    2e-05   Vitis vinifera
gb|KJB54658.1|  hypothetical protein B456_009G043500                  50.4    2e-05   Gossypium raimondii
gb|AFW88628.1|  hypothetical protein ZEAMMB73_822579                  51.6    2e-05   Zea mays [maize]
ref|XP_009757028.1|  PREDICTED: uncharacterized protein LOC104209953  50.8    2e-05   Nicotiana sylvestris
emb|CDP03142.1|  unnamed protein product                              50.4    2e-05   Coffea canephora [robusta coffee]
ref|XP_009411641.1|  PREDICTED: uncharacterized protein LOC103993342  50.4    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011100119.1|  PREDICTED: uncharacterized protein LOC105178320  50.4    2e-05   Sesamum indicum [beniseed]
ref|XP_008450877.1|  PREDICTED: uncharacterized protein LOC103492339  50.4    2e-05   Cucumis melo [Oriental melon]
ref|XP_009121895.1|  PREDICTED: uncharacterized protein LOC103846677  50.1    2e-05   Brassica rapa
emb|CDX69715.1|  BnaA10g20640D                                        50.1    2e-05   Brassica napus [oilseed rape]
ref|XP_011100834.1|  PREDICTED: uncharacterized protein LOC105178940  50.4    2e-05   Sesamum indicum [beniseed]
ref|XP_006855324.1|  hypothetical protein AMTR_s00057p00084630        50.1    2e-05   
ref|XP_008393620.1|  PREDICTED: uncharacterized protein LOC103455808  50.4    2e-05   Malus domestica [apple tree]
ref|XP_006399717.1|  hypothetical protein EUTSA_v10015080mg           50.1    2e-05   Eutrema salsugineum
gb|KFK35432.1|  hypothetical protein AALP_AA5G283700                  50.1    2e-05   Arabis alpina [alpine rockcress]
gb|KCW69787.1|  hypothetical protein EUGRSUZ_F03151                   50.1    2e-05   Eucalyptus grandis [rose gum]
ref|XP_007163161.1|  hypothetical protein PHAVU_001G211500g           49.7    2e-05   Phaseolus vulgaris [French bean]
ref|XP_006444450.1|  hypothetical protein CICLE_v10022952mg           50.1    2e-05   Citrus clementina
ref|XP_009361636.1|  PREDICTED: uncharacterized protein LOC103951883  50.1    2e-05   Pyrus x bretschneideri [bai li]
gb|KFK25455.1|  hypothetical protein AALP_AA8G117500                  49.7    3e-05   Arabis alpina [alpine rockcress]
ref|XP_009124308.1|  PREDICTED: uncharacterized protein LOC103849252  49.7    3e-05   Brassica rapa
emb|CDX70437.1|  BnaC03g05210D                                        49.7    3e-05   Brassica napus [oilseed rape]
ref|XP_011460334.1|  PREDICTED: uncharacterized protein LOC101305515  50.1    3e-05   Fragaria vesca subsp. vesca
ref|XP_009362205.1|  PREDICTED: uncharacterized protein LOC103952357  50.1    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_010062657.1|  PREDICTED: uncharacterized protein LOC104449994  49.7    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010090075.1|  hypothetical protein L484_027306                 50.1    3e-05   Morus notabilis
ref|XP_009131248.1|  PREDICTED: uncharacterized protein LOC103855949  49.7    3e-05   Brassica rapa
emb|CDY60739.1|  BnaA07g35980D                                        49.7    3e-05   Brassica napus [oilseed rape]
ref|XP_007223475.1|  hypothetical protein PRUPE_ppa013495mg           49.7    3e-05   Prunus persica
ref|XP_008220505.1|  PREDICTED: uncharacterized protein LOC103320582  49.7    3e-05   Prunus mume [ume]
ref|XP_010468934.1|  PREDICTED: uncharacterized protein LOC104749060  49.7    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010094301.1|  hypothetical protein L484_000591                 49.7    3e-05   Morus notabilis
ref|XP_009606571.1|  PREDICTED: uncharacterized protein LOC104100905  48.9    3e-05   Nicotiana tomentosiformis
ref|XP_010413260.1|  PREDICTED: uncharacterized protein LOC104699622  49.7    3e-05   Camelina sativa [gold-of-pleasure]
emb|CDP08289.1|  unnamed protein product                              50.1    4e-05   Coffea canephora [robusta coffee]
ref|XP_008440092.1|  PREDICTED: uncharacterized protein LOC103484674  48.9    4e-05   
gb|KGN48410.1|  hypothetical protein Csa_6G486830                     48.9    4e-05   Cucumis sativus [cucumbers]
emb|CDX97159.1|  BnaC09g44660D                                        49.3    4e-05   Brassica napus [oilseed rape]
gb|KDP33854.1|  hypothetical protein JCGZ_07425                       49.7    4e-05   Jatropha curcas
ref|XP_004144117.1|  PREDICTED: uncharacterized protein LOC101207995  49.3    4e-05   Cucumis sativus [cucumbers]
ref|XP_004501457.1|  PREDICTED: uncharacterized protein LOC101508769  49.3    4e-05   Cicer arietinum [garbanzo]
ref|NP_001143497.1|  uncharacterized protein LOC100276175             49.3    4e-05   Zea mays [maize]
tpg|DAA58612.1|  TPA: hypothetical protein ZEAMMB73_794061            49.3    4e-05   Zea mays [maize]
gb|KFK41693.1|  hypothetical protein AALP_AA2G160700                  49.3    4e-05   Arabis alpina [alpine rockcress]
gb|KGN47609.1|  hypothetical protein Csa_6G364115                     48.5    5e-05   Cucumis sativus [cucumbers]
ref|XP_010536185.1|  PREDICTED: uncharacterized protein LOC104811234  48.9    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_008670679.1|  PREDICTED: uncharacterized protein LOC100277467  48.5    5e-05   Zea mays [maize]
ref|XP_006644258.1|  PREDICTED: secretory carrier-associated memb...  49.3    5e-05   Oryza brachyantha
ref|XP_011093755.1|  PREDICTED: uncharacterized protein LOC105173634  49.3    6e-05   Sesamum indicum [beniseed]
ref|XP_006359891.1|  PREDICTED: uncharacterized protein LOC102586099  48.9    6e-05   Solanum tuberosum [potatoes]
ref|XP_004247381.1|  PREDICTED: uncharacterized protein LOC101261064  49.7    6e-05   Solanum lycopersicum
ref|XP_009125840.1|  PREDICTED: uncharacterized protein LOC103850805  48.9    6e-05   Brassica rapa
gb|KDP34075.1|  hypothetical protein JCGZ_07646                       48.9    6e-05   Jatropha curcas
ref|XP_002873541.1|  hypothetical protein ARALYDRAFT_488039           48.9    6e-05   Arabidopsis lyrata subsp. lyrata
ref|NP_001060710.1|  Os07g0690200                                     48.5    6e-05   
ref|XP_007024534.1|  Uncharacterized protein TCM_029075               48.9    6e-05   Theobroma cacao [chocolate]
ref|XP_002515317.1|  conserved hypothetical protein                   48.9    6e-05   
ref|NP_196758.1|  uncharacterized protein                             48.5    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043368.1|  Os01g0567400                                     49.3    6e-05   
ref|XP_006390627.1|  hypothetical protein EUTSA_v10019700mg           48.9    6e-05   Eutrema salsugineum
gb|KJB49853.1|  hypothetical protein B456_008G141600                  48.5    7e-05   Gossypium raimondii
gb|KCW81706.1|  hypothetical protein EUGRSUZ_C03059                   48.9    7e-05   Eucalyptus grandis [rose gum]
gb|EYU29346.1|  hypothetical protein MIMGU_mgv1a024776mg              48.9    7e-05   Erythranthe guttata [common monkey flower]
ref|XP_010652227.1|  PREDICTED: uncharacterized protein LOC104879791  48.5    7e-05   Vitis vinifera
ref|XP_011041610.1|  PREDICTED: uncharacterized protein LOC105137530  48.5    7e-05   Populus euphratica
ref|XP_002320985.1|  hypothetical protein POPTR_0014s11870g           48.5    7e-05   Populus trichocarpa [western balsam poplar]
gb|KDP40744.1|  hypothetical protein JCGZ_24743                       48.9    7e-05   Jatropha curcas
ref|XP_009790773.1|  PREDICTED: uncharacterized protein LOC104238174  48.5    8e-05   Nicotiana sylvestris
ref|XP_008463430.1|  PREDICTED: uncharacterized protein LOC103501594  48.5    8e-05   
ref|XP_006346016.1|  PREDICTED: uncharacterized protein LOC102600018  48.1    8e-05   
ref|XP_002521377.1|  conserved hypothetical protein                   48.5    8e-05   
ref|XP_009397468.1|  PREDICTED: uncharacterized protein LOC103982302  48.5    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237797.1|  uncharacterized protein LOC100527044             48.5    8e-05   Glycine max [soybeans]
ref|XP_002516091.1|  conserved hypothetical protein                   48.5    9e-05   Ricinus communis
ref|NP_001235468.1|  uncharacterized protein LOC100500259             48.5    9e-05   Glycine max [soybeans]
ref|XP_004507952.1|  PREDICTED: uncharacterized protein LOC101497454  48.5    9e-05   Cicer arietinum [garbanzo]
ref|XP_004968999.1|  PREDICTED: uncharacterized protein LOC101766251  48.5    9e-05   Setaria italica
ref|XP_006293045.1|  hypothetical protein CARUB_v10019325mg           48.1    9e-05   Capsella rubella
ref|NP_565454.1|  uncharacterized protein                             48.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298832.1|  hypothetical protein CARUB_v10014938mg           48.5    1e-04   Capsella rubella
ref|XP_009604760.1|  PREDICTED: uncharacterized protein LOC104099460  48.1    1e-04   Nicotiana tomentosiformis
gb|EYU45868.1|  hypothetical protein MIMGU_mgv1a024058mg              48.1    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_009395779.1|  PREDICTED: uncharacterized protein LOC103980958  48.1    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP20384.1|  unnamed protein product                              47.8    1e-04   Coffea canephora [robusta coffee]
ref|XP_002886038.1|  hypothetical protein ARALYDRAFT_480527           48.1    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_006575776.1|  PREDICTED: uncharacterized protein LOC102665932  47.8    1e-04   
ref|XP_010415380.1|  PREDICTED: uncharacterized protein LOC104701397  48.1    1e-04   Camelina sativa [gold-of-pleasure]
gb|KHN43477.1|  hypothetical protein glysoja_002060                   47.4    1e-04   Glycine soja [wild soybean]
ref|XP_002458020.1|  hypothetical protein SORBIDRAFT_03g025590        48.1    1e-04   Sorghum bicolor [broomcorn]
gb|KJB68771.1|  hypothetical protein B456_011G063500                  48.1    1e-04   Gossypium raimondii
ref|XP_010489479.1|  PREDICTED: uncharacterized protein LOC104767140  48.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003544544.1|  PREDICTED: uncharacterized protein LOC100780149  48.1    1e-04   Glycine max [soybeans]
dbj|BAB63494.1|  hypothetical protein                                 49.3    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ACG47193.1|  hypothetical protein                                  47.0    1e-04   Zea mays [maize]
ref|XP_010512660.1|  PREDICTED: uncharacterized protein LOC104788595  48.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002277637.1|  PREDICTED: uncharacterized protein LOC100267009  48.1    1e-04   Vitis vinifera
ref|XP_010467892.1|  PREDICTED: uncharacterized protein LOC104747880  48.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002888889.1|  hypothetical protein ARALYDRAFT_895124           48.1    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_006465997.1|  PREDICTED: uncharacterized protein LOC102621718  47.8    1e-04   
ref|NP_001142901.1|  uncharacterized protein LOC100275329             47.8    1e-04   Zea mays [maize]
ref|XP_006604736.1|  PREDICTED: uncharacterized protein LOC100807345  47.4    1e-04   Glycine max [soybeans]
ref|XP_006451506.1|  hypothetical protein CICLE_v10009884mg           48.1    1e-04   Citrus clementina
ref|XP_003558099.1|  PREDICTED: uncharacterized protein LOC100839633  47.8    1e-04   Brachypodium distachyon [annual false brome]
ref|XP_009382510.1|  PREDICTED: uncharacterized protein LOC103970456  48.1    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_177416.1|  uncharacterized protein                             47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006426586.1|  hypothetical protein CICLE_v10026799mg           47.8    1e-04   Citrus clementina
gb|EMT32572.1|  hypothetical protein F775_29998                       47.8    2e-04   Aegilops tauschii
gb|AFW83054.1|  hypothetical protein ZEAMMB73_749542                  47.8    2e-04   Zea mays [maize]
emb|CDM82593.1|  unnamed protein product                              47.8    2e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006475485.1|  PREDICTED: uncharacterized protein LOC102618796  47.8    2e-04   
ref|XP_009334737.1|  PREDICTED: uncharacterized protein LOC103927523  47.8    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_006302957.1|  hypothetical protein CARUB_v10021141mg           47.8    2e-04   Capsella rubella
ref|XP_001772171.1|  predicted protein                                46.6    2e-04   Physcomitrella patens
ref|XP_009105933.1|  PREDICTED: uncharacterized protein LOC103831776  47.8    2e-04   Brassica rapa
ref|XP_004498869.1|  PREDICTED: uncharacterized protein LOC101498614  47.4    2e-04   
ref|XP_010548664.1|  PREDICTED: uncharacterized protein LOC104820019  47.4    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_010555044.1|  PREDICTED: uncharacterized protein LOC104824634  47.4    2e-04   Tarenaya hassleriana [spider flower]
gb|KJB54405.1|  hypothetical protein B456_009G032700                  47.4    2e-04   Gossypium raimondii
ref|XP_008338712.1|  PREDICTED: uncharacterized protein LOC103401770  47.4    2e-04   Malus domestica [apple tree]
ref|XP_010925470.1|  PREDICTED: uncharacterized protein LOC105047996  47.4    2e-04   Elaeis guineensis
ref|XP_010428169.1|  PREDICTED: uncharacterized protein LOC104712878  47.4    2e-04   Camelina sativa [gold-of-pleasure]
emb|CDO98797.1|  unnamed protein product                              47.4    2e-04   Coffea canephora [robusta coffee]
ref|XP_010262040.1|  PREDICTED: uncharacterized protein LOC104600664  47.4    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_006351591.1|  PREDICTED: uncharacterized protein LOC102597557  47.0    2e-04   Solanum tuberosum [potatoes]
ref|XP_010471303.1|  PREDICTED: uncharacterized protein LOC104751120  47.4    2e-04   Camelina sativa [gold-of-pleasure]
dbj|BAJ85795.1|  predicted protein                                    46.6    2e-04   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009604506.1|  PREDICTED: uncharacterized protein LOC104099...  47.0    3e-04   Nicotiana tomentosiformis
ref|XP_008391355.1|  PREDICTED: uncharacterized protein LOC103453586  47.4    3e-04   Malus domestica [apple tree]
ref|XP_010416035.1|  PREDICTED: uncharacterized protein LOC104701955  47.4    3e-04   Camelina sativa [gold-of-pleasure]
gb|KFK40307.1|  hypothetical protein AALP_AA3G358000                  47.0    3e-04   Arabis alpina [alpine rockcress]
ref|XP_009372399.1|  PREDICTED: uncharacterized protein LOC103961551  47.0    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_010685354.1|  PREDICTED: myosin-G heavy chain-like             47.4    3e-04   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009604502.1|  PREDICTED: uncharacterized protein LOC104099...  47.0    3e-04   Nicotiana tomentosiformis
ref|XP_009604505.1|  PREDICTED: uncharacterized protein LOC104099...  47.0    3e-04   Nicotiana tomentosiformis
ref|XP_006290018.1|  hypothetical protein CARUB_v10003648mg           47.0    3e-04   Capsella rubella
ref|XP_009785242.1|  PREDICTED: uncharacterized protein LOC104233535  46.6    3e-04   Nicotiana sylvestris
ref|XP_002514131.1|  conserved hypothetical protein                   47.0    3e-04   
ref|XP_010325025.1|  PREDICTED: uncharacterized protein LOC101255120  46.6    3e-04   Solanum lycopersicum
ref|XP_003569228.1|  PREDICTED: uncharacterized protein LOC100838787  47.0    3e-04   Brachypodium distachyon [annual false brome]
emb|CCM07289.1|  Chromosome chr9 scaffold_7, whole genome shotgun...  47.4    3e-04   Musa balbisiana [starchy banana]
dbj|BAJ86995.1|  predicted protein                                    46.6    3e-04   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006387696.1|  hypothetical protein POPTR_0667s00200g           47.0    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008807777.1|  PREDICTED: uncharacterized protein LOC103720035  47.8    3e-04   Phoenix dactylifera
ref|XP_006369261.1|  hypothetical protein POPTR_0001s20460g           46.6    4e-04   Populus trichocarpa [western balsam poplar]
gb|KHN32708.1|  hypothetical protein glysoja_022390                   46.6    4e-04   Glycine soja [wild soybean]
gb|EMT21863.1|  hypothetical protein F775_09219                       46.6    4e-04   Aegilops tauschii
ref|XP_003625948.1|  hypothetical protein MTR_7g109290                46.2    4e-04   Medicago truncatula
ref|XP_004962365.1|  PREDICTED: nucleosome-remodeling factor subu...  47.4    4e-04   Setaria italica
ref|XP_009147213.1|  PREDICTED: uncharacterized protein LOC103870800  46.6    4e-04   Brassica rapa
ref|XP_010915301.1|  PREDICTED: uncharacterized protein LOC105040464  46.6    4e-04   Elaeis guineensis
ref|XP_010268118.1|  PREDICTED: uncharacterized protein LOC104605179  46.6    4e-04   Nelumbo nucifera [Indian lotus]
gb|KGN52839.1|  hypothetical protein Csa_4G002560                     46.2    4e-04   Cucumis sativus [cucumbers]
dbj|BAJ95570.1|  predicted protein                                    47.8    4e-04   Hordeum vulgare subsp. vulgare [barley]
gb|KEH39921.1|  DUF3511 domain protein                                46.6    4e-04   
ref|XP_010049210.1|  PREDICTED: uncharacterized protein LOC104437857  46.6    5e-04   
ref|NP_001144166.1|  uncharacterized protein LOC100277021             47.4    5e-04   
gb|ACN28073.1|  unknown                                               47.4    5e-04   
ref|NP_001142511.1|  uncharacterized protein LOC100274747             47.4    5e-04   
ref|XP_002440938.1|  hypothetical protein SORBIDRAFT_09g017240        47.4    5e-04   
ref|XP_008347501.1|  PREDICTED: uncharacterized protein LOC103410594  46.6    5e-04   
ref|XP_011079982.1|  PREDICTED: uncharacterized protein LOC105163364  46.2    5e-04   
ref|XP_010087710.1|  hypothetical protein L484_013472                 46.2    5e-04   
emb|CDY68148.1|  BnaA07g38930D                                        48.9    5e-04   
ref|NP_001055294.1|  Os05g0356800                                     47.0    5e-04   
ref|XP_004157365.1|  PREDICTED: uncharacterized protein LOC101228...  46.2    5e-04   
ref|XP_006408036.1|  hypothetical protein EUTSA_v10021773mg           46.2    5e-04   
ref|XP_010924971.1|  PREDICTED: uncharacterized protein LOC105047646  46.2    5e-04   
ref|XP_006300157.1|  hypothetical protein CARUB_v10016388mg           46.2    6e-04   
gb|KHN30067.1|  hypothetical protein glysoja_010445                   46.2    6e-04   
ref|XP_006409054.1|  hypothetical protein EUTSA_v10022917mg           46.2    6e-04   
ref|NP_001235259.1|  uncharacterized protein LOC100305940             46.2    6e-04   
gb|AAF19806.1|  putative protein                                      46.2    6e-04   
ref|XP_010486048.1|  PREDICTED: uncharacterized protein LOC104764246  46.2    6e-04   
gb|ADE76925.1|  unknown                                               45.8    6e-04   
emb|CDY01400.1|  BnaA07g11730D                                        45.8    7e-04   
ref|XP_004252514.1|  PREDICTED: uncharacterized protein LOC101264299  45.8    7e-04   
gb|KDP28226.1|  hypothetical protein JCGZ_13997                       45.8    7e-04   
dbj|BAK04906.1|  predicted protein                                    45.8    7e-04   
emb|CDY65871.1|  BnaAnng21200D                                        48.1    7e-04   
ref|XP_007161038.1|  hypothetical protein PHAVU_001G037600g           45.8    7e-04   
ref|XP_009388679.1|  PREDICTED: uncharacterized protein LOC103975440  45.8    7e-04   
ref|NP_974231.2|  uncharacterized protein                             45.8    7e-04   
ref|XP_009383877.1|  PREDICTED: uncharacterized protein LOC103971526  45.8    7e-04   
emb|CDY70409.1|  BnaC07g48510D                                        45.8    7e-04   
gb|KJB74840.1|  hypothetical protein B456_012G010400                  47.0    8e-04   
ref|XP_009631543.1|  PREDICTED: uncharacterized protein LOC104121292  45.8    8e-04   
ref|XP_008228257.1|  PREDICTED: uncharacterized protein LOC103327672  45.8    8e-04   
ref|XP_007215163.1|  hypothetical protein PRUPE_ppa013537mg           45.8    8e-04   
ref|XP_008793204.1|  PREDICTED: uncharacterized protein LOC103709...  46.6    8e-04   
emb|CDX72939.1|  BnaC06g33870D                                        48.1    8e-04   
emb|CDY49860.1|  BnaA02g16090D                                        45.8    8e-04   
ref|XP_006853891.1|  hypothetical protein AMTR_s00036p00155950        45.8    8e-04   
ref|XP_008793205.1|  PREDICTED: uncharacterized protein LOC103709...  46.6    8e-04   
gb|AGV54821.1|  hypothetical protein                                  45.8    9e-04   
ref|XP_009127946.1|  PREDICTED: uncharacterized protein LOC103852796  45.8    9e-04   
ref|XP_009783266.1|  PREDICTED: uncharacterized protein LOC104231901  48.1    0.001   
gb|EYU27325.1|  hypothetical protein MIMGU_mgv1a015597mg              46.2    0.001   
ref|XP_007150492.1|  hypothetical protein PHAVU_005G157200g           45.4    0.001   
ref|XP_010491951.1|  PREDICTED: uncharacterized protein LOC104769433  45.4    0.001   
ref|XP_010419781.1|  PREDICTED: uncharacterized protein LOC104705466  45.4    0.001   
ref|XP_010453260.1|  PREDICTED: uncharacterized protein LOC104735212  45.4    0.001   



>emb|CDP11432.1| unnamed protein product [Coffea canephora]
Length=87

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIA+YN FTTEGK+K+TVRESFKWIKTKL+D+RYG
Sbjct  46   ELKRKKRIAAYNMFTTEGKLKATVRESFKWIKTKLSDVRYG  86



>ref|XP_009627813.1| PREDICTED: uncharacterized protein LOC104118301 [Nicotiana tomentosiformis]
Length=85

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KRKKRIA+YN FTTEGKVK+TVRESFKWIKTKL DIRY
Sbjct  44   EIKRKKRIAAYNMFTTEGKVKATVRESFKWIKTKLTDIRY  83



>ref|XP_009764165.1| PREDICTED: uncharacterized protein LOC104215926 [Nicotiana sylvestris]
Length=101

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KRKKRIA+YN FTTEGKVK+TVRESFKWIKTKL DIRY
Sbjct  60   EIKRKKRIAAYNMFTTEGKVKATVRESFKWIKTKLTDIRY  99



>ref|XP_006359046.1| PREDICTED: uncharacterized protein LOC102585655 [Solanum tuberosum]
Length=88

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KRKKRIA+YN FTTEGKVK+TVRESFKWIKTK++DIRY
Sbjct  47   EIKRKKRIAAYNMFTTEGKVKATVRESFKWIKTKISDIRY  86



>ref|XP_010097663.1| hypothetical protein L484_023803 [Morus notabilis]
 gb|EXB70618.1| hypothetical protein L484_023803 [Morus notabilis]
Length=87

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKRIASYN FTTEGKVKS+VR SFKWIK+K +DIRYG
Sbjct  46   ELQRKKRIASYNVFTTEGKVKSSVRNSFKWIKSKFSDIRYG  86



>ref|XP_010320114.1| PREDICTED: uncharacterized protein LOC104647137 [Solanum lycopersicum]
Length=97

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KRKKRIA+YN FTTEGKVK+TVRESFKWIKTK++DIRY
Sbjct  56   EIKRKKRIAAYNMFTTEGKVKATVRESFKWIKTKISDIRY  95



>ref|XP_003634523.1| PREDICTED: uncharacterized protein LOC100854843 [Vitis vinifera]
Length=87

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIASYN FT EGK+K++VR SFKWIKTKL+DIRYG
Sbjct  46   ELKRKKRIASYNVFTMEGKLKTSVRSSFKWIKTKLSDIRYG  86



>ref|XP_007019583.1| Mediator of RNA polymerase II transcription subunit 8 [Theobroma 
cacao]
 gb|EOY16808.1| Mediator of RNA polymerase II transcription subunit 8 [Theobroma 
cacao]
Length=87

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIASYN FT EGKVKS+VR SFKWIK+K +D+RYG
Sbjct  46   ELKRKKRIASYNVFTMEGKVKSSVRSSFKWIKSKFSDVRYG  86



>ref|XP_011101196.1| PREDICTED: uncharacterized protein LOC105179276 [Sesamum indicum]
Length=77

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            EMKRKKR+A+YN   TEGKVK++V+ESFKWIKTK ND+RY
Sbjct  36   EMKRKKRVAAYNMLATEGKVKASVKESFKWIKTKFNDVRY  75



>ref|XP_002306717.1| hypothetical protein POPTR_0005s21760g [Populus trichocarpa]
 gb|EEE93713.1| hypothetical protein POPTR_0005s21760g [Populus trichocarpa]
Length=87

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIASYN FT EGK+KS VR SFKWIK+K +D+RYG
Sbjct  46   ELKRKKRIASYNVFTMEGKLKSNVRNSFKWIKSKFSDVRYG  86



>emb|CBI18237.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KRKKRIASYN FT EGK+K++VR SFKWIKTKL+DIRY
Sbjct  46   ELKRKKRIASYNVFTMEGKLKTSVRSSFKWIKTKLSDIRY  85



>ref|XP_010268571.1| PREDICTED: uncharacterized protein LOC104605490 [Nelumbo nucifera]
Length=83

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRK+R+A+YN FTTEGK+KS+VR SFKWIK K  D+RYG
Sbjct  42   ELKRKRRVAAYNVFTTEGKIKSSVRNSFKWIKNKFTDVRYG  82



>ref|XP_002302161.1| hypothetical protein POPTR_0002s06580g [Populus trichocarpa]
 gb|ABK92947.1| unknown [Populus trichocarpa]
 gb|EEE81434.1| hypothetical protein POPTR_0002s06580g [Populus trichocarpa]
Length=87

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIASYN FT EGK+KS+ R SFKWIK+K +D RYG
Sbjct  46   ELKRKKRIASYNVFTVEGKLKSSARNSFKWIKSKFSDARYG  86



>gb|KJB28970.1| hypothetical protein B456_005G077700 [Gossypium raimondii]
Length=88

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIASYN FT EGK+KS+VR SFKWIK+K  D+ YG
Sbjct  47   ELKRKKRIASYNVFTMEGKLKSSVRNSFKWIKSKFTDVGYG  87



>gb|KDP36568.1| hypothetical protein JCGZ_08335 [Jatropha curcas]
Length=84

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLN-DIRYG  123
            E+KRKKRIASYN FT EGK+KS+VR SFKWIK K N D+RYG
Sbjct  42   ELKRKKRIASYNVFTVEGKLKSSVRSSFKWIKNKFNTDVRYG  83



>gb|EYU36830.1| hypothetical protein MIMGU_mgv1a017284mg [Erythranthe guttata]
Length=84

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIR  117
            EMKRKKRIA+YN FT EGKVK++VR+SFKWIKTK+N +R
Sbjct  43   EMKRKKRIAAYNLFTKEGKVKASVRDSFKWIKTKINHVR  81



>gb|KDO83797.1| hypothetical protein CISIN_1g034641mg [Citrus sinensis]
Length=88

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIASYN FT E K+KS+VR SFKWIK K +D+RYG
Sbjct  46   EIKRKKRIASYNVFTVENKLKSSVRNSFKWIKGKFSDVRYG  86



>ref|XP_006434510.1| hypothetical protein CICLE_v10003573mg [Citrus clementina]
 gb|ESR47750.1| hypothetical protein CICLE_v10003573mg [Citrus clementina]
Length=88

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRIASYN FT E K+KS+VR SFKWIK K +D+RYG
Sbjct  46   EIKRKKRIASYNVFTVENKLKSSVRNSFKWIKGKFSDVRYG  86



>ref|NP_001058402.1| Os06g0686600 [Oryza sativa Japonica Group]
 dbj|BAD46046.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20316.1| Os06g0686600 [Oryza sativa Japonica Group]
 gb|EAZ02142.1| hypothetical protein OsI_24232 [Oryza sativa Indica Group]
 gb|EAZ38069.1| hypothetical protein OsJ_22415 [Oryza sativa Japonica Group]
Length=93

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+A+YN F T+G++KSTVR SFKWIK+K +DIRYG
Sbjct  51   EAKRRRRVAAYNVFATQGRLKSTVRSSFKWIKSKFSDIRYG  91



>gb|KGN45893.1| hypothetical protein Csa_6G017090 [Cucumis sativus]
Length=87

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RK+RIASYN F  E KVKS+V+ SFKWIKTK +DIRYG
Sbjct  46   ELQRKRRIASYNVFNMENKVKSSVKNSFKWIKTKFSDIRYG  86



>gb|AFK41103.1| unknown [Lotus japonicus]
Length=87

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI SYN  T EGKVK++VR SFKWIK K  DIRYG
Sbjct  46   ELKRKKRIKSYNVLTVEGKVKTSVRNSFKWIKNKFTDIRYG  86



>ref|XP_010062094.1| PREDICTED: uncharacterized protein LOC104449583 [Eucalyptus grandis]
 gb|KCW69157.1| hypothetical protein EUGRSUZ_F02688 [Eucalyptus grandis]
Length=89

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KRKKRIA+YN F  EGK+KS++R SFKWIK K N++RY
Sbjct  46   ELKRKKRIAAYNVFAAEGKLKSSLRNSFKWIKGKANEVRY  85



>ref|XP_010932053.1| PREDICTED: uncharacterized protein LOC105052817 [Elaeis guineensis]
Length=122

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRK+R+A+YN FTTE K+KS+VR S KWIKTK  +IRYG
Sbjct  81   ELKRKRRVAAYNVFTTEAKLKSSVRNSVKWIKTKFTNIRYG  121



>ref|XP_003592063.1| hypothetical protein MTR_1g098310 [Medicago truncatula]
 gb|AES62314.1| DUF3511 domain protein [Medicago truncatula]
 gb|AFK44497.1| unknown [Medicago truncatula]
Length=86

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI SYN    EGK+KS+VR SFKWIK K +D+RYG
Sbjct  45   ELKRKKRIKSYNVLAVEGKLKSSVRNSFKWIKNKFSDVRYG  85



>ref|XP_003556161.1| PREDICTED: uncharacterized protein LOC100776380 [Glycine max]
 gb|KHN46396.1| hypothetical protein glysoja_031714 [Glycine soja]
Length=86

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI +YN  T EGK+K++VR SFKWIK K +DIRYG
Sbjct  45   ELKRKKRIKAYNVLTVEGKLKTSVRNSFKWIKNKFSDIRYG  85



>ref|XP_003563451.1| PREDICTED: uncharacterized protein LOC100826521 [Brachypodium 
distachyon]
Length=95

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+ASYN F ++ ++KS+VR SFKW+K+KL+D+RYG
Sbjct  53   EAKRRRRVASYNVFASQARLKSSVRGSFKWLKSKLSDVRYG  93



>ref|XP_002976822.1| hypothetical protein SELMODRAFT_105899 [Selaginella moellendorffii]
 ref|XP_002980551.1| hypothetical protein SELMODRAFT_112741 [Selaginella moellendorffii]
 gb|EFJ18202.1| hypothetical protein SELMODRAFT_112741 [Selaginella moellendorffii]
 gb|EFJ21932.1| hypothetical protein SELMODRAFT_105899 [Selaginella moellendorffii]
Length=95

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKR+ASY  FT EGKVKS+VR SF+WIK K  ++RYG
Sbjct  53   EMKRKKRVASYKVFTVEGKVKSSVRNSFRWIKNKYLEMRYG  93



>ref|XP_007143570.1| hypothetical protein PHAVU_007G082800g [Phaseolus vulgaris]
 gb|ESW15564.1| hypothetical protein PHAVU_007G082800g [Phaseolus vulgaris]
Length=86

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI +YN  T EGK+K++VR SFKWIK K +DIRYG
Sbjct  45   ELKRKKRIKAYNVLTAEGKLKTSVRNSFKWIKNKFSDIRYG  85



>ref|XP_007151977.1| hypothetical protein PHAVU_004G091400g [Phaseolus vulgaris]
 gb|ESW23971.1| hypothetical protein PHAVU_004G091400g [Phaseolus vulgaris]
Length=86

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI SYN FT EGK+K+TVR  FKWIK K  DIR G
Sbjct  45   ELKRKKRIKSYNVFTMEGKLKTTVRNGFKWIKNKFGDIRSG  85



>ref|XP_006656402.1| PREDICTED: uncharacterized protein LOC102718280 [Oryza brachyantha]
Length=89

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+A+YN F T+G++KSTVR SFKWIK+K + +RYG
Sbjct  47   EAKRRRRVAAYNVFATQGRLKSTVRSSFKWIKSKFSTVRYG  87



>ref|XP_002524325.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38065.1| conserved hypothetical protein [Ricinus communis]
Length=92

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLN--DIRY  120
            EMKR+KRIASYN FT EGK+KS+VR SFKWIK K +  D+RY
Sbjct  42   EMKRRKRIASYNVFTMEGKLKSSVRNSFKWIKNKFSSTDVRY  83



>gb|EMT21739.1| hypothetical protein F775_30902 [Aegilops tauschii]
Length=92

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+ASYN F ++ ++KS+VR SFKW+K+KL+D+RYG
Sbjct  50   EAKRRRRVASYNVFASQARLKSSVRGSFKWLKSKLSDVRYG  90



>gb|ACU16913.1| unknown [Glycine max]
 gb|KHN17032.1| hypothetical protein glysoja_011506 [Glycine soja]
Length=86

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI +YN  T EGK+K+ VR SFKWIK K +DIRYG
Sbjct  45   EIKRKKRIKAYNVLTVEGKLKTNVRNSFKWIKNKFSDIRYG  85



>dbj|BAK02428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=93

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+ASYN F ++ ++KS+VR SFKW+K+KL+D+RYG
Sbjct  51   EAKRRRRVASYNVFASQARLKSSVRGSFKWLKSKLSDVRYG  91



>ref|XP_008793904.1| PREDICTED: uncharacterized protein LOC103710078 [Phoenix dactylifera]
Length=88

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRK+R+A+YN FT E K+KS+VR SFKWIK K  D+R G
Sbjct  47   ELKRKRRVAAYNVFTVEAKLKSSVRSSFKWIKAKFADVRSG  87



>ref|XP_002438896.1| hypothetical protein SORBIDRAFT_10g027850 [Sorghum bicolor]
 gb|EER90263.1| hypothetical protein SORBIDRAFT_10g027850 [Sorghum bicolor]
Length=92

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+A+YN F T+G++K+TVR S KW+K+K +DIRYG
Sbjct  50   EAKRRRRVAAYNVFATQGRIKTTVRSSVKWLKSKFSDIRYG  90



>ref|XP_004966250.1| PREDICTED: uncharacterized protein LOC101782426 [Setaria italica]
Length=93

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+A+YN F T+G++K+TVR S KW+K+K +DIRYG
Sbjct  51   EAKRRRRVAAYNVFATQGRIKTTVRSSVKWLKSKFSDIRYG  91



>ref|NP_001152913.1| uncharacterized protein LOC100276361 [Zea mays]
 gb|ACF85070.1| unknown [Zea mays]
 gb|ACG33722.1| hypothetical protein [Zea mays]
 gb|AFW69165.1| hypothetical protein ZEAMMB73_443271 [Zea mays]
Length=92

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+A+YN F T+G++K+TVR S KW+K+K +D+RYG
Sbjct  50   EAKRRRRVAAYNVFATQGRIKTTVRSSVKWLKSKFSDVRYG  90



>gb|KHN41303.1| hypothetical protein glysoja_030141 [Glycine soja]
Length=86

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI +YN FT EGK+K++VR  FKWIK K  DIR G
Sbjct  45   ELKRKKRIKAYNVFTVEGKLKTSVRNGFKWIKNKFGDIRNG  85



>ref|NP_001143448.1| uncharacterized protein LOC100276103 [Zea mays]
 gb|ACG32165.1| hypothetical protein [Zea mays]
Length=92

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR+ R+A+YN F T+G++K+TVR S KW+K+K +D+RYG
Sbjct  50   EAKRRXRVAAYNVFATQGRIKTTVRSSVKWLKSKFSDVRYG  90



>ref|XP_004290488.1| PREDICTED: uncharacterized protein LOC101310479 [Fragaria vesca 
subsp. vesca]
Length=87

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E++RKKR+ASYN FT EGK+K++++ SFKWIK +  D+RY
Sbjct  46   ELQRKKRVASYNVFTMEGKLKTSLKNSFKWIKNRFTDVRY  85



>gb|ABK22684.1| unknown [Picea sitchensis]
 gb|ACN40692.1| unknown [Picea sitchensis]
Length=105

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +MKRKKR+ASY     EGK+K++VR SFKW+KTK  +IRYG
Sbjct  64   DMKRKKRVASYKVLAVEGKMKNSVRSSFKWLKTKYTEIRYG  104



>ref|XP_009401372.1| PREDICTED: uncharacterized protein LOC103985414 [Musa acuminata 
subsp. malaccensis]
Length=87

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRK+R+ASYN+F  E K+KS+VR SFKWIK K  D  YG
Sbjct  46   ELKRKRRVASYNSFAMERKLKSSVRNSFKWIKNKFTDAVYG  86



>ref|XP_010652886.1| PREDICTED: uncharacterized protein LOC104879927 [Vitis vinifera]
Length=89

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            EMKR+KR+ASYN ++ EGK+KS++R SFKWIK K  D  Y
Sbjct  47   EMKRRKRVASYNMYSMEGKLKSSLRNSFKWIKNKFTDDYY  86



>ref|XP_009403203.1| PREDICTED: uncharacterized protein LOC103986822 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRK+R+ASYN+FT E K++S+VR SFKWIK K  D  +G
Sbjct  102  ELKRKRRVASYNSFTMERKLRSSVRNSFKWIKNKFTDALHG  142



>ref|XP_006288984.1| hypothetical protein CARUB_v10002358mg [Capsella rubella]
 gb|EOA21882.1| hypothetical protein CARUB_v10002358mg [Capsella rubella]
Length=87

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL----NDIRY  120
            EMKRKKR+ASYN F TE K+KST++ SFKWIK K     N IRY
Sbjct  42   EMKRKKRVASYNLFATEEKLKSTLKNSFKWIKNKFSGDDNSIRY  85



>ref|NP_192727.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB39613.1| putative protein [Arabidopsis thaliana]
 emb|CAB78112.1| putative protein [Arabidopsis thaliana]
 gb|AAR24181.1| At4g09890 [Arabidopsis thaliana]
 gb|AAR92324.1| At4g09890 [Arabidopsis thaliana]
 gb|AEE82810.1| uncharacterized protein AT4G09890 [Arabidopsis thaliana]
Length=87

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL----NDIRY  120
            EMKRKKR+ASYN F TE K+KST++ SFKWIK K     N IRY
Sbjct  42   EMKRKKRVASYNLFATEEKLKSTLKNSFKWIKNKFSGDDNSIRY  85



>ref|XP_008237494.1| PREDICTED: uncharacterized protein LOC103336230 [Prunus mume]
Length=88

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL-NDIRY  120
            E++RKKR+ASYN FT EGKVK++++ SFKWIK +   D+RY
Sbjct  46   ELQRKKRVASYNVFTMEGKVKTSLKNSFKWIKNRFATDVRY  86



>emb|CDP12860.1| unnamed protein product [Coffea canephora]
Length=79

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KR+KR+A+YN +T EGK+KS++R SFKWIK+K  D  Y
Sbjct  38   EVKRRKRVAAYNMYTMEGKLKSSLRNSFKWIKSKFTDTYY  77



>ref|XP_002310621.1| hypothetical protein POPTR_0007s06990g [Populus trichocarpa]
 gb|EEE91071.1| hypothetical protein POPTR_0007s06990g [Populus trichocarpa]
Length=90

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLND  111
            E+KR+KR+A YN +T EGK+KS++R SFKWIK+KL D
Sbjct  49   ELKRRKRVAQYNMYTMEGKIKSSLRNSFKWIKSKLVD  85



>ref|XP_007201433.1| hypothetical protein PRUPE_ppa013713mg [Prunus persica]
 gb|EMJ02632.1| hypothetical protein PRUPE_ppa013713mg [Prunus persica]
Length=107

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTK-LNDIRY  120
            E++RKKR+ASYN FT EGKVK++++ SFKWIK + + D+RY
Sbjct  65   ELQRKKRVASYNVFTMEGKVKTSLKNSFKWIKNRFVTDVRY  105



>ref|XP_002872475.1| hypothetical protein ARALYDRAFT_489838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48734.1| hypothetical protein ARALYDRAFT_489838 [Arabidopsis lyrata subsp. 
lyrata]
Length=87

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL----NDIRY  120
            EMKRK+R+ASYN F TE K+KST++ SFKWIK K     N IRY
Sbjct  42   EMKRKRRVASYNLFATEEKLKSTLKNSFKWIKNKFSGDDNSIRY  85



>ref|XP_010096474.1| hypothetical protein L484_006721 [Morus notabilis]
 gb|EXB64484.1| hypothetical protein L484_006721 [Morus notabilis]
Length=91

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            EMKR+KR+A+YN +  EGK+KS++R SFKWIK+K  D  Y
Sbjct  50   EMKRRKRVANYNMYAMEGKLKSSLRNSFKWIKSKFVDTYY  89



>gb|KFK32039.1| hypothetical protein AALP_AA6G192400 [Arabis alpina]
Length=87

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL----NDIRY  120
            EMKRKKR+ASYN F TE K+K+T++ SFKWIK K     N IRY
Sbjct  42   EMKRKKRVASYNLFATEEKLKNTLKNSFKWIKNKFSGDDNSIRY  85



>emb|CAN64856.1| hypothetical protein VITISV_030491 [Vitis vinifera]
Length=210

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            EMKR+KR+ASYN ++ EGK+KS++R SFKWIK K  D  Y
Sbjct  168  EMKRRKRVASYNMYSMEGKLKSSLRNSFKWIKNKFTDDYY  207



>ref|XP_003518540.1| PREDICTED: uncharacterized protein LOC100306191 [Glycine max]
 gb|ACU14256.1| unknown [Glycine max]
 gb|KHN00742.1| hypothetical protein glysoja_000410 [Glycine soja]
Length=86

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKRI +YN FT E K+K++VR  FKWIK K  DI  G
Sbjct  45   ELKRKKRIKAYNVFTVEEKLKTSVRNGFKWIKDKFGDIHSG  85



>ref|XP_004496440.1| PREDICTED: uncharacterized protein LOC101513366 isoform X1 [Cicer 
arietinum]
 ref|XP_004496441.1| PREDICTED: uncharacterized protein LOC101513366 isoform X2 [Cicer 
arietinum]
Length=85

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            E+KRKKRI SYN    EGK+K++VR SFKWIK K +D+
Sbjct  45   ELKRKKRIKSYNVLAVEGKLKTSVRNSFKWIKNKFSDV  82



>ref|XP_009113577.1| PREDICTED: uncharacterized protein LOC103838879 [Brassica rapa]
Length=87

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL----NDIRY  120
            E+KRKKR+ASYN F TE K+KST++ SFKWIK K     N IRY
Sbjct  42   EIKRKKRVASYNLFATEEKLKSTLKNSFKWIKNKFSGDDNSIRY  85



>ref|XP_007048178.1| Uncharacterized protein TCM_001296 [Theobroma cacao]
 gb|EOX92335.1| Uncharacterized protein TCM_001296 [Theobroma cacao]
Length=86

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E+KR+KR+ASYN ++ EGK+KS++R SFKWIKTK 
Sbjct  45   ELKRRKRVASYNMYSMEGKLKSSLRNSFKWIKTKF  79



>ref|XP_006427923.1| hypothetical protein CICLE_v10026866mg [Citrus clementina]
 gb|ESR41163.1| hypothetical protein CICLE_v10026866mg [Citrus clementina]
Length=84

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLND  111
            E KR+KR+A+YN +T EGK+KS++R SFKWIK K +D
Sbjct  47   ESKRRKRVAAYNMYTMEGKLKSSLRNSFKWIKNKFSD  83



>ref|XP_001766440.1| predicted protein [Physcomitrella patens]
 gb|EDQ68768.1| predicted protein [Physcomitrella patens]
Length=82

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EM+RKKR+A Y  FT EGK+K TVR   +WIK K  ++RYG
Sbjct  40   EMRRKKRVAKYKVFTVEGKMKETVRNGCRWIKNKYLEVRYG  80



>gb|KDO57123.1| hypothetical protein CISIN_1g034773mg [Citrus sinensis]
Length=84

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLND  111
            E KR+KR+A+YN +T EGK+KS++R SFKWIK K  D
Sbjct  47   ESKRRKRVAAYNMYTMEGKLKSSLRNSFKWIKNKFTD  83



>gb|EPS71133.1| hypothetical protein M569_03627, partial [Genlisea aurea]
Length=76

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            EMKRKKR+ASYN +  EG++ S++R SFKWIK K  D ++
Sbjct  37   EMKRKKRVASYNKYAVEGRLVSSLRNSFKWIKGKFADKKF  76



>ref|XP_001766447.1| predicted protein [Physcomitrella patens]
 gb|EDQ68775.1| predicted protein [Physcomitrella patens]
Length=80

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKR+A Y  FT EGKVK TVR S +WIK K   +RYG
Sbjct  38   EIKRKKRVAKYKVFTLEGKVKDTVRSSCRWIKNKYLVVRYG  78



>emb|CDX99512.1| BnaC09g24800D [Brassica napus]
Length=87

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 4/44 (9%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL----NDIRY  120
            E+KRKKR+ASYN F TE K+KST++  FKWIK K     N IRY
Sbjct  42   EIKRKKRVASYNLFATEEKLKSTLKNGFKWIKNKFSGDDNSIRY  85



>ref|NP_001049870.1| Os03g0302500 [Oryza sativa Japonica Group]
 gb|ABF95498.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11784.1| Os03g0302500 [Oryza sativa Japonica Group]
 dbj|BAG97671.1| unnamed protein product [Oryza sativa Japonica Group]
Length=120

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVKS++R  F+WIK K +++ +G
Sbjct  80   EMKRRRRVASYKAYSVEGKVKSSLRRGFRWIKAKCSELIHG  120



>gb|EYU24060.1| hypothetical protein MIMGU_mgv1a017325mg [Erythranthe guttata]
Length=81

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E+KR+KR+A YN F  EGK KS+++ SFKWIK K +D  Y
Sbjct  39   EVKRRKRVAGYNMFAVEGKFKSSLKNSFKWIKNKFSDKYY  78



>ref|XP_009768396.1| PREDICTED: uncharacterized protein LOC104219405 [Nicotiana sylvestris]
Length=114

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            E KRKKR+ASY ++T EGK+KS++R+SF+WIK K + I
Sbjct  73   EAKRKKRVASYKSYTIEGKLKSSIRDSFRWIKNKYSSI  110



>gb|AFG44226.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44228.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44229.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44230.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
Length=111

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KR+KR+ASY  +T EGKVK + R+SF+W+K K  +I YG
Sbjct  69   EVKRRKRVASYKVYTVEGKVKGSFRKSFRWLKDKYTEIVYG  109



>gb|AEW08166.1| hypothetical protein 2_1728_01, partial [Pinus radiata]
 gb|AFG44222.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44223.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44224.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44225.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44227.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44231.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44232.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44233.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44234.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44235.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44236.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44237.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
 gb|AFG44238.1| hypothetical protein 2_1728_01, partial [Pinus taeda]
Length=111

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KR+KR+ASY  +T EGKVK + R+SF+W+K K  +I YG
Sbjct  69   EVKRRKRVASYKVYTVEGKVKGSFRKSFRWLKDKYTEIVYG  109



>gb|KHN09564.1| hypothetical protein glysoja_011838 [Glycine soja]
Length=93

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E+KR+KR+ASYN +T E K+KS+ R SFKWIK KL
Sbjct  52   ELKRRKRVASYNMYTMEAKLKSSFRSSFKWIKNKL  86



>ref|XP_006856469.1| hypothetical protein AMTR_s00046p00044470 [Amborella trichopoda]
 gb|ERN17936.1| hypothetical protein AMTR_s00046p00044470 [Amborella trichopoda]
Length=81

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTK  102
            E+KRKKR+ASY  F  EGK KS++R SFKWIK+K
Sbjct  45   ELKRKKRVASYKVFAAEGKFKSSLRSSFKWIKSK  78



>gb|ABK21328.1| unknown [Picea sitchensis]
Length=122

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KR+KR+ASY  +T EGKVK + R+SF+W+K K  +I YG
Sbjct  80   EVKRRKRVASYKVYTVEGKVKGSFRKSFRWLKDKYTEIVYG  120



>emb|CDY57721.1| BnaC04g51930D [Brassica napus]
Length=116

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EGKVKST +  F+WIK K   I +G
Sbjct  75   EMKRKKRIARYKAYTVEGKVKSTFKNGFRWIKNKCRQIVHG  115



>ref|XP_003528030.2| PREDICTED: uncharacterized protein LOC100795724 [Glycine max]
Length=93

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E+KR+KR+ASYN +T E K+KS+ R SFKWIK KL
Sbjct  52   ELKRRKRVASYNMYTIEAKLKSSFRSSFKWIKNKL  86



>gb|EAY89670.1| hypothetical protein OsI_11203 [Oryza sativa Indica Group]
Length=146

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVKS++R  F+WIK K +++ +G
Sbjct  81   EMKRRRRVASYKAYSVEGKVKSSLRRGFRWIKAKCSELIHG  121



>ref|XP_002530262.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32132.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLND  111
            E+KR++R+A YN +T EGK+KS++R SFKWIK+K  D
Sbjct  48   EVKRRRRVAQYNMYTMEGKLKSSLRNSFKWIKSKFVD  84



>gb|EAY89674.1| hypothetical protein OsI_11208 [Oryza sativa Indica Group]
Length=145

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVKS++R  F+WIK K +++ +G
Sbjct  80   EMKRRRRVASYKAYSVEGKVKSSLRRGFRWIKAKCSELIHG  120



>gb|KDP35289.1| hypothetical protein JCGZ_09448 [Jatropha curcas]
Length=89

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E+KR+KR+A YN ++ EGK+KS++R SFKWIK+K 
Sbjct  48   ELKRRKRVAQYNMYSVEGKLKSSLRSSFKWIKSKF  82



>ref|XP_009349933.1| PREDICTED: uncharacterized protein LOC103941464 [Pyrus x bretschneideri]
Length=89

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E++RKKR+ASYN FT EGKVK+++R + KWIK  L
Sbjct  46   ELQRKKRVASYNVFTMEGKVKTSLRNNLKWIKNSL  80



>ref|XP_008660225.1| PREDICTED: uncharacterized protein LOC103639235 [Zea mays]
 gb|AFW88629.1| hypothetical protein ZEAMMB73_822579, partial [Zea mays]
Length=112

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVK++ R  F+WIK K +++ +G
Sbjct  72   EMKRRRRVASYKAYSAEGKVKASFRRGFRWIKAKCSELIHG  112



>ref|XP_003603170.1| hypothetical protein MTR_3g104640 [Medicago truncatula]
 gb|AES73421.1| DUF3511 domain protein [Medicago truncatula]
 gb|AFK38313.1| unknown [Medicago truncatula]
Length=110

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K K + + YG
Sbjct  69   ELQRKKRVASYKMYSVEGKVKGSFRKSFRWLKNKYSQVVYG  109



>ref|XP_008795587.1| PREDICTED: uncharacterized protein LOC103711279 [Phoenix dactylifera]
Length=199

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVK ++R+SF+WIK K +++ +G
Sbjct  159  EMKRRRRVASYKMYSVEGKVKQSIRKSFRWIKGKCSEMVHG  199



>gb|KHN17682.1| hypothetical protein glysoja_005879 [Glycine soja]
Length=123

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SFKW+K + N + YG
Sbjct  83   ELQRKKRVASYKVYAVEGKLKGSLRKSFKWLKDRCNRVVYG  123



>ref|NP_001236822.1| uncharacterized protein LOC100527749 [Glycine max]
 gb|ACU16908.1| unknown [Glycine max]
Length=122

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SFKW+K + N + YG
Sbjct  82   ELQRKKRVASYKVYAVEGKLKGSLRKSFKWLKDRCNRVVYG  122



>ref|XP_007204834.1| hypothetical protein PRUPE_ppa026980mg [Prunus persica]
 gb|EMJ06033.1| hypothetical protein PRUPE_ppa026980mg [Prunus persica]
Length=125

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+SF+W+K   N + YG
Sbjct  84   ELQRKKRVASYKVYTVEGKLKGSLRKSFRWVKETCNRVVYG  124



>ref|XP_009349378.1| PREDICTED: uncharacterized protein LOC103940922 [Pyrus x bretschneideri]
Length=127

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+SF+W+K   N + YG
Sbjct  86   ELQRKKRVASYKVYTVEGKLKGSLRKSFRWLKETCNRVVYG  126



>ref|NP_182270.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC62862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAN08435.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT69143.1| hypothetical protein At2g47480 [Arabidopsis thaliana]
 dbj|BAD95393.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02211.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10848.1| uncharacterized protein AT2G47480 [Arabidopsis thaliana]
Length=110

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            EMKRKKRIA Y  +T EGKVKST++  F+WIK K   I
Sbjct  69   EMKRKKRIARYKAYTVEGKVKSTLKNGFRWIKNKCCQI  106



>ref|XP_008337723.1| PREDICTED: uncharacterized protein LOC103400824 [Malus domestica]
 ref|XP_008352373.1| PREDICTED: uncharacterized protein LOC103415871 [Malus domestica]
Length=128

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+SF+W+K   N + YG
Sbjct  87   ELQRKKRVASYKVYTVEGKLKGSLRKSFRWLKETCNRVVYG  127



>ref|XP_007154634.1| hypothetical protein PHAVU_003G135000g [Phaseolus vulgaris]
 gb|ESW26628.1| hypothetical protein PHAVU_003G135000g [Phaseolus vulgaris]
Length=116

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SFKW+K + N + YG
Sbjct  75   ELQRKKRVASYKVYAVEGKLKGSLRKSFKWLKDRCNRVVYG  115



>gb|AFK46816.1| unknown [Medicago truncatula]
Length=123

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K ++R+SFKWIK + N + +G
Sbjct  82   ELQRKKRVASYKVYSVEGKLKGSLRKSFKWIKDRCNRVVHG  122



>ref|XP_009142529.1| PREDICTED: uncharacterized protein LOC103866376 [Brassica rapa]
 emb|CDX80107.1| BnaA05g00490D [Brassica napus]
Length=116

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EGKVKST +  F+WIK K   I +G
Sbjct  75   EMKRKKRIARYKAYTVEGKVKSTFKNGFRWIKNKCYQIVHG  115



>gb|AFK37685.1| unknown [Medicago truncatula]
 gb|KEH32499.1| DUF3511 domain protein [Medicago truncatula]
Length=123

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K ++R+SFKWIK + N + +G
Sbjct  82   ELQRKKRVASYKVYSVEGKLKGSLRKSFKWIKDRCNRVVHG  122



>ref|XP_004984650.1| PREDICTED: histone acetyltransferase KAT2A-like [Setaria italica]
Length=129

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVK+++R  F+WIK K +++ +G
Sbjct  89   EMKRRRRVASYKAYSVEGKVKASLRRGFRWIKAKCSELIHG  129



>ref|XP_010069874.1| PREDICTED: uncharacterized protein LOC104456719 [Eucalyptus grandis]
 gb|KCW58382.1| hypothetical protein EUGRSUZ_H01070 [Eucalyptus grandis]
Length=111

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EG+VK+++R  F+WIK + + I +G
Sbjct  70   EMKRKKRIARYKAYTVEGRVKASLRRGFQWIKNRCSQIVHG  110



>ref|XP_008242377.1| PREDICTED: uncharacterized protein LOC103340711 [Prunus mume]
Length=157

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+SF+W+K   N + YG
Sbjct  116  ELQRKKRVASYKVYTVEGKLKGSLRKSFRWVKETCNRVVYG  156



>ref|XP_007136845.1| hypothetical protein PHAVU_009G079000g [Phaseolus vulgaris]
 gb|ESW08839.1| hypothetical protein PHAVU_009G079000g [Phaseolus vulgaris]
Length=113

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K + + YG
Sbjct  72   ELQRKKRVASYKMYSVEGKIKGSFRKSFRWLKNKYSQVVYG  112



>ref|XP_007207520.1| hypothetical protein PRUPE_ppa013987mg [Prunus persica]
 gb|EMJ08719.1| hypothetical protein PRUPE_ppa013987mg [Prunus persica]
Length=92

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E++R+KR+ASYN +  EGK KS++R SFKWIK K  D  Y
Sbjct  51   ELERRKRVASYNMYAVEGKFKSSLRNSFKWIKGKFVDNFY  90



>ref|XP_002882120.1| hypothetical protein ARALYDRAFT_904223 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58379.1| hypothetical protein ARALYDRAFT_904223 [Arabidopsis lyrata subsp. 
lyrata]
Length=110

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLN  108
            EMKRKKRIA Y  +T EGKVKSTV+  F+WIK K +
Sbjct  72   EMKRKKRIARYKAYTVEGKVKSTVKNGFRWIKNKCS  107



>ref|XP_006842334.1| hypothetical protein AMTR_s00079p00164570 [Amborella trichopoda]
 gb|ERN04009.1| hypothetical protein AMTR_s00079p00164570 [Amborella trichopoda]
Length=87

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KR+KR+A Y  +  EG+VK++ R+SF+WIK K +DI +G
Sbjct  46   EVKRRKRVAGYKVYAVEGRVKASFRKSFRWIKDKCSDIIHG  86



>ref|XP_006480043.1| PREDICTED: uncharacterized protein LOC102625735 [Citrus sinensis]
 gb|KDO87070.1| hypothetical protein CISIN_1g045042mg [Citrus sinensis]
Length=111

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR+KRIA Y  +T EGKVK+++R+  +WIK K + I +G
Sbjct  70   EMKRRKRIAKYKVYTVEGKVKASLRKGLRWIKNKCSQIVHG  110



>ref|XP_002308546.1| hypothetical protein POPTR_0006s24240g [Populus trichocarpa]
 gb|EEE92069.1| hypothetical protein POPTR_0006s24240g [Populus trichocarpa]
Length=130

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK T R+SF+WIK +   + YG
Sbjct  88   EFQRKKRVASYKMYSVEGKVKGTFRKSFRWIKDRCTQVMYG  128



>gb|AFK48123.1| unknown [Lotus japonicus]
Length=121

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K + + YG
Sbjct  80   ELQRKKRVASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVYG  120



>ref|XP_010544986.1| PREDICTED: uncharacterized protein LOC104817471 [Tarenaya hassleriana]
Length=109

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EM+RKKRIA Y  +T EGKVK+++R+  +WIK K + I +G
Sbjct  68   EMRRKKRIARYKAYTVEGKVKASLRKGLRWIKDKCSQIVHG  108



>gb|KJB65518.1| hypothetical protein B456_010G098600 [Gossypium raimondii]
Length=115

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK ++R SF+W+K K   + YG
Sbjct  73   EFQRKKRVASYKMYSVEGKVKGSLRRSFRWLKVKYTQVVYG  113



>dbj|BAJ91043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVKS++R   +W K K +DI +G
Sbjct  112  EMKRRRRVASYKAYSVEGKVKSSLRRGLRWFKGKCSDIFHG  152



>ref|XP_004243747.1| PREDICTED: uncharacterized protein LOC101265147 [Solanum lycopersicum]
Length=125

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK ++++SF+WIK +   + YG
Sbjct  83   ELQRKKRVASYKVYTVEGKVKGSIKKSFRWIKERCTKVVYG  123



>ref|XP_006357712.1| PREDICTED: uncharacterized protein LOC102593175 [Solanum tuberosum]
Length=140

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK ++++SF+WIK +   + YG
Sbjct  98   ELQRKKRVASYKVYTVEGKVKGSIKKSFRWIKERCTKVVYG  138



>ref|NP_001235166.1| uncharacterized protein LOC100305934 [Glycine max]
 gb|ACU13857.1| unknown [Glycine max]
 gb|KHN32197.1| hypothetical protein glysoja_035290 [Glycine soja]
Length=115

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKRIASY  ++ EGK+K + R+SF+W+K K + + YG
Sbjct  74   EIRRKKRIASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVYG  114



>gb|KHN29707.1| hypothetical protein glysoja_016329 [Glycine soja]
Length=115

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K + + YG
Sbjct  74   ELQRKKRVASYKMYSVEGKIKGSFRKSFRWLKNKYSHVVYG  114



>ref|XP_001772172.1| predicted protein [Physcomitrella patens]
 gb|EDQ62985.1| predicted protein [Physcomitrella patens]
Length=63

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +R+KR+A Y   T EGK K TVR SF+W+K K   +RYG
Sbjct  21   EAQRRKRVAKYKIITMEGKAKQTVRSSFRWLKAKYIAVRYG  61



>ref|NP_001236849.1| uncharacterized protein LOC100306567 [Glycine max]
 gb|ACU14797.1| unknown [Glycine max]
Length=116

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SFKW K + N + YG
Sbjct  75   ELQRKKRVASYKVYAVEGKLKGSLRKSFKWFKDRCNRVVYG  115



>gb|KHN06628.1| hypothetical protein glysoja_040133 [Glycine soja]
Length=116

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SFKW K + N + YG
Sbjct  75   ELQRKKRVASYKVYAVEGKLKGSLRKSFKWFKDRCNRVVYG  115



>ref|XP_002878468.1| hypothetical protein ARALYDRAFT_907837 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54727.1| hypothetical protein ARALYDRAFT_907837 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA+Y T+  EGKVK+TV++ F+WIK + + I +G
Sbjct  64   ETKRKKRIATYKTYALEGKVKTTVKKGFRWIKNRYSQIIHG  104



>ref|NP_001144614.1| hypothetical protein [Zea mays]
 gb|ACG41802.1| hypothetical protein [Zea mays]
 tpg|DAA44969.1| TPA: hypothetical protein ZEAMMB73_370377, partial [Zea mays]
Length=114

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EM+R++R+ASY  ++ EGKVK++ R  F+WIK K +++ +G
Sbjct  74   EMRRRRRVASYKAYSVEGKVKASFRRGFRWIKAKCSELIHG  114



>gb|AAM63039.1| unknown [Arabidopsis thaliana]
Length=110

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA+Y T+  EGKVKSTV++ F WIK + + I +G
Sbjct  70   ETKRKKRIATYKTYALEGKVKSTVKKGFHWIKNRYSHIIHG  110



>ref|XP_006397942.1| hypothetical protein EUTSA_v10001686mg [Eutrema salsugineum]
 gb|ESQ39395.1| hypothetical protein EUTSA_v10001686mg [Eutrema salsugineum]
Length=114

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EGKVKST++   +WI+ K + I +G
Sbjct  73   EMKRKKRIARYKAYTVEGKVKSTLKNGLRWIRNKCSQIVHG  113



>ref|XP_009615642.1| PREDICTED: uncharacterized protein LOC104108337 [Nicotiana tomentosiformis]
Length=107

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            E KR+KR+ASY ++T EGK+K ++R+SF+WIK K + I
Sbjct  66   EAKRRKRVASYKSYTIEGKLKDSIRDSFRWIKNKYSSI  103



>ref|XP_010242270.1| PREDICTED: uncharacterized protein LOC104586667 [Nelumbo nucifera]
Length=124

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+SF+W+K +   + YG
Sbjct  82   ELQRKKRVASYKVYTVEGKMKGSLRKSFRWLKDRYTQVVYG  122



>gb|EPS65655.1| hypothetical protein M569_09126, partial [Genlisea aurea]
Length=71

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLND  111
            EMKRKKR+ASYN +  EGK  S+ R  F+WIK K  D
Sbjct  35   EMKRKKRVASYNKYAVEGKFISSFRSKFRWIKAKFAD  71



>ref|XP_006397132.1| hypothetical protein EUTSA_v10029196mg [Eutrema salsugineum]
 gb|ESQ38585.1| hypothetical protein EUTSA_v10029196mg [Eutrema salsugineum]
Length=87

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 4/44 (9%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLN----DIRY  120
            E+KRKKR+ASYN F TE K+K++++ SFKWIK K +    +IRY
Sbjct  42   EIKRKKRVASYNLFATEEKLKNSLKSSFKWIKNKFSGDDTNIRY  85



>ref|XP_002467994.1| hypothetical protein SORBIDRAFT_01g037750 [Sorghum bicolor]
 gb|EER94992.1| hypothetical protein SORBIDRAFT_01g037750 [Sorghum bicolor]
Length=179

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVK++ R  F+WIK K +++ +G
Sbjct  77   EMKRRRRVASYKAYSVEGKVKASFRRGFRWIKAKCSELIHG  117



>ref|NP_191823.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB83114.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43198.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42938.1| At3g62640 [Arabidopsis thaliana]
 gb|AEE80374.1| uncharacterized protein AT3G62640 [Arabidopsis thaliana]
Length=110

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA+Y T+  EGKVKSTV++ F WIK + + I +G
Sbjct  70   ETKRKKRIATYKTYALEGKVKSTVKKGFHWIKDRYSHIIHG  110



>ref|XP_007051058.1| Uncharacterized protein TCM_004766 [Theobroma cacao]
 gb|EOX95215.1| Uncharacterized protein TCM_004766 [Theobroma cacao]
Length=107

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EGKVK+++R+   WIK K + I +G
Sbjct  66   EMKRKKRIAKYKVYTVEGKVKASLRKGLCWIKNKCSQIVHG  106



>ref|XP_007012782.1| Uncharacterized protein TCM_037625 [Theobroma cacao]
 gb|EOY30401.1| Uncharacterized protein TCM_037625 [Theobroma cacao]
Length=123

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKR+ASY  +T EGKVK ++++SF+W+K + + + YG
Sbjct  82   ELKRKKRVASYKVYTVEGKVKGSLKKSFRWLKDRYSRVVYG  122



>ref|XP_009606358.1| PREDICTED: uncharacterized protein LOC104100753 [Nicotiana tomentosiformis]
Length=141

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK ++++SF+WIK +   + YG
Sbjct  99   ELQRKKRVASYKVYTVEGKVKGSIKKSFRWIKERCTKVVYG  139



>ref|XP_010648337.1| PREDICTED: uncharacterized protein LOC104878982 [Vitis vinifera]
Length=115

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK ++R SF+W+K + + I YG
Sbjct  73   EFQRKKRVASYKAYSVEGKVKGSLRNSFRWLKARYHRIVYG  113



>gb|KJB54658.1| hypothetical protein B456_009G043500 [Gossypium raimondii]
Length=122

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK ++R SF+W+K K   + YG
Sbjct  80   EFQRKKRVASYKMYSVEGKVKGSLRRSFRWLKDKYTQVVYG  120



>gb|AFW88628.1| hypothetical protein ZEAMMB73_822579 [Zea mays]
Length=190

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+ASY  ++ EGKVK++ R  F+WIK K +++ +G
Sbjct  72   EMKRRRRVASYKAYSAEGKVKASFRRGFRWIKAKCSELIHG  112



>ref|XP_009757028.1| PREDICTED: uncharacterized protein LOC104209953 [Nicotiana sylvestris]
Length=138

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK ++++SF+WIK +   + YG
Sbjct  96   ELQRKKRVASYKVYTVEGKVKGSIKKSFRWIKERCTKVVYG  136



>emb|CDP03142.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK ++++SF+W+K +   + YG
Sbjct  82   ELQRKKRVASYKVYTVEGKVKGSLKKSFRWLKDRCTQVVYG  122



>ref|XP_009411641.1| PREDICTED: uncharacterized protein LOC103993342 [Musa acuminata 
subsp. malaccensis]
Length=129

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+A Y  +  EGKVKS++R+ F+WIK K +++ +G
Sbjct  88   EMKRRRRVAKYKAYAVEGKVKSSIRKGFRWIKIKCSELIHG  128



>ref|XP_011100119.1| PREDICTED: uncharacterized protein LOC105178320 [Sesamum indicum]
Length=122

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK T R+SF+W+K +   + YG
Sbjct  80   EFQRKKRVASYKVYSVEGKVKGTFRKSFRWLKDRYTQVVYG  120



>ref|XP_008450877.1| PREDICTED: uncharacterized protein LOC103492339 [Cucumis melo]
Length=126

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EM+RK+R+ASY  +T EGKVK ++R+SF+W+K + + + +G
Sbjct  85   EMQRKRRVASYKVYTVEGKVKGSLRKSFRWLKERCSRVVFG  125



>ref|XP_009121895.1| PREDICTED: uncharacterized protein LOC103846677 [Brassica rapa]
Length=105

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  63   ELKRKKRVASYKMYSVEGKVKGSFRKSFRWLKHRYTQVVYG  103



>emb|CDX69715.1| BnaA10g20640D [Brassica napus]
Length=105

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  63   ELKRKKRVASYKMYSVEGKVKGSFRKSFRWLKHRYTQVVYG  103



>ref|XP_011100834.1| PREDICTED: uncharacterized protein LOC105178940 [Sesamum indicum]
Length=127

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RK+RI SYN +  EGK+K+++R SF+W+K K + I +G
Sbjct  86   EVRRKQRIMSYNAYAVEGKLKASIRSSFRWMKNKCSTIVHG  126



>ref|XP_006855324.1| hypothetical protein AMTR_s00057p00084630 [Amborella trichopoda]
 gb|ERN16791.1| hypothetical protein AMTR_s00057p00084630 [Amborella trichopoda]
Length=103

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR+KR+A Y  +  EG+VK++ R SF+WIK K +++ +G
Sbjct  62   EMKRRKRVAGYKVYAVEGRVKASFRRSFRWIKDKCSELIHG  102



>ref|XP_008393620.1| PREDICTED: uncharacterized protein LOC103455808 [Malus domestica]
Length=126

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K   + YG
Sbjct  84   ELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQVLYG  124



>ref|XP_006399717.1| hypothetical protein EUTSA_v10015080mg [Eutrema salsugineum]
 gb|ESQ41170.1| hypothetical protein EUTSA_v10015080mg [Eutrema salsugineum]
Length=107

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  65   ELQRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVVYG  105



>gb|KFK35432.1| hypothetical protein AALP_AA5G283700 [Arabis alpina]
Length=108

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRK+RIA+Y  +  EGKVKSTV++ F+WIK + + I +G
Sbjct  68   ETKRKRRIATYKAYAMEGKVKSTVKKGFRWIKIRCSQIIHG  108



>gb|KCW69787.1| hypothetical protein EUGRSUZ_F03151 [Eucalyptus grandis]
Length=111

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++++SF+WIK     + YG
Sbjct  69   ELQRKKRVASYKAYTVEGKMKGSLKKSFRWIKNTCTQVVYG  109



>ref|XP_007163161.1| hypothetical protein PHAVU_001G211500g [Phaseolus vulgaris]
 gb|ESW35155.1| hypothetical protein PHAVU_001G211500g [Phaseolus vulgaris]
Length=94

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA Y  +  EGKVK+T++E  +WIK K + I +G
Sbjct  53   EAKRKKRIAKYKVYGVEGKVKATLKEGLRWIKKKCSQIAHG  93



>ref|XP_006444450.1| hypothetical protein CICLE_v10022952mg [Citrus clementina]
 gb|ESR57690.1| hypothetical protein CICLE_v10022952mg [Citrus clementina]
Length=111

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR+KRIA Y  +T EGKVK+++R+  +WIK K   I +G
Sbjct  70   EMKRRKRIAKYKVYTVEGKVKASLRKGLRWIKNKCFQIVHG  110



>ref|XP_009361636.1| PREDICTED: uncharacterized protein LOC103951883 [Pyrus x bretschneideri]
Length=124

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+SF+W+K   + + YG
Sbjct  83   ELQRKKRVASYKVYTVEGKLKGSLRKSFRWLKETCDRVVYG  123



>gb|KFK25455.1| hypothetical protein AALP_AA8G117500 [Arabis alpina]
Length=104

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  62   ELQRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVVYG  102



>ref|XP_009124308.1| PREDICTED: uncharacterized protein LOC103849252 [Brassica rapa]
Length=103

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K ++R+SFKWIK K N I
Sbjct  64   DLQRKKRVVSYRVYTAEGKLKGSLRKSFKWIKDKCNKI  101



>emb|CDX70437.1| BnaC03g05210D [Brassica napus]
Length=106

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  64   ELQRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVVYG  104



>ref|XP_011460334.1| PREDICTED: uncharacterized protein LOC101305515 [Fragaria vesca 
subsp. vesca]
Length=126

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+SF+W+K   + + YG
Sbjct  85   ELQRKKRVASYKVYTVEGKLKGSLRKSFRWLKETCDRVVYG  125



>ref|XP_009362205.1| PREDICTED: uncharacterized protein LOC103952357 [Pyrus x bretschneideri]
Length=129

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K   + YG
Sbjct  87   ELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQVLYG  127



>ref|XP_010062657.1| PREDICTED: uncharacterized protein LOC104449994 [Eucalyptus grandis]
Length=124

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++++SF+WIK     + YG
Sbjct  82   ELQRKKRVASYKAYTVEGKMKGSLKKSFRWIKNTCTQVVYG  122



>ref|XP_010090075.1| hypothetical protein L484_027306 [Morus notabilis]
 gb|EXB38872.1| hypothetical protein L484_027306 [Morus notabilis]
Length=133

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGKVK ++R+SF+W+K +   + YG
Sbjct  92   ELQRKKRVASYKVYAVEGKVKGSLRKSFRWLKERCTRVVYG  132



>ref|XP_009131248.1| PREDICTED: uncharacterized protein LOC103855949 [Brassica rapa]
 emb|CDX78460.1| BnaA03g03720D [Brassica napus]
Length=106

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  64   ELQRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVVYG  104



>emb|CDY60739.1| BnaA07g35980D [Brassica napus]
Length=112

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K ++R+SFKWIK K N I
Sbjct  73   DLQRKKRVVSYRVYTAEGKLKGSLRKSFKWIKDKCNKI  110



>ref|XP_007223475.1| hypothetical protein PRUPE_ppa013495mg [Prunus persica]
 gb|EMJ24674.1| hypothetical protein PRUPE_ppa013495mg [Prunus persica]
Length=119

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K   + YG
Sbjct  77   ELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKCTQVVYG  117



>ref|XP_008220505.1| PREDICTED: uncharacterized protein LOC103320582 [Prunus mume]
Length=119

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K   + YG
Sbjct  77   ELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKCTQVVYG  117



>ref|XP_010468934.1| PREDICTED: uncharacterized protein LOC104749060 [Camelina sativa]
Length=109

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA+Y  +  EGKVK+TV++ F+WIK + + I +G
Sbjct  69   ETKRKKRIATYKAYAMEGKVKATVKKGFRWIKNRYSQIIHG  109



>ref|XP_010094301.1| hypothetical protein L484_000591 [Morus notabilis]
 gb|EXB55657.1| hypothetical protein L484_000591 [Morus notabilis]
Length=113

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK + R+SF+W+K K   + YG
Sbjct  71   EFQRKKRVASYKMYSVEGKVKGSFRKSFRWLKDKYTQVVYG  111



>ref|XP_009606571.1| PREDICTED: uncharacterized protein LOC104100905 [Nicotiana tomentosiformis]
Length=76

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLND  111
            E+KRKKR+  YN ++ EGKVK++++ SFKW+K+K  D
Sbjct  40   EVKRKKRVVGYNMYSMEGKVKTSLKNSFKWLKSKFTD  76



>ref|XP_010413260.1| PREDICTED: uncharacterized protein LOC104699622 [Camelina sativa]
Length=112

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA+Y  +  EGKVK+TV++ F+WIK + + I +G
Sbjct  72   ETKRKKRIATYKAYAMEGKVKATVKKGFRWIKNRYSQIIHG  112



>emb|CDP08289.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK + R SF+W+K K   + YG
Sbjct  108  EFQRKKRVASYKVYSVEGKVKGSFRRSFRWLKDKYTQVLYG  148



>ref|XP_008440092.1| PREDICTED: uncharacterized protein LOC103484674 [Cucumis melo]
Length=86

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E+KR++R+A+YN ++ EGK+K ++R SFKWIK K+
Sbjct  45   ELKRRQRVATYNMYSMEGKLKKSLRNSFKWIKNKI  79



>gb|KGN48410.1| hypothetical protein Csa_6G486830 [Cucumis sativus]
Length=86

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E+KR++R+A+YN ++ EGK+K ++R SFKWIK K+
Sbjct  45   ELKRRQRVATYNMYSMEGKLKKSLRNSFKWIKNKI  79



>emb|CDX97159.1| BnaC09g44660D [Brassica napus]
Length=105

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRKKR+ASY  ++ EG+VK + R+SF+W+K +   + YG
Sbjct  63   ELKRKKRVASYKMYSVEGQVKGSFRKSFRWLKHRYTQVVYG  103



>gb|KDP33854.1| hypothetical protein JCGZ_07425 [Jatropha curcas]
Length=128

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK ++++SF+W+K + + + YG
Sbjct  86   ELQRKKRVASYKVYTVEGKVKGSLKKSFRWLKDRYSRVVYG  126



>ref|XP_004144117.1| PREDICTED: uncharacterized protein LOC101207995 [Cucumis sativus]
 ref|XP_004158469.1| PREDICTED: uncharacterized LOC101207995 [Cucumis sativus]
 gb|KGN66259.1| hypothetical protein Csa_1G589660 [Cucumis sativus]
Length=123

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EM+RK+R+ASY  ++ EGKVK ++R+SF+W+K + + + +G
Sbjct  82   EMQRKRRVASYKVYSVEGKVKGSLRKSFRWLKERCSRVVFG  122



>ref|XP_004501457.1| PREDICTED: uncharacterized protein LOC101508769 [Cicer arietinum]
Length=112

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EG+VK + R+SF+W+K K + + +G
Sbjct  71   ELQRKKRVASYKMYSVEGRVKGSFRKSFRWLKNKYSQVVHG  111



>ref|NP_001143497.1| uncharacterized protein LOC100276175 [Zea mays]
 gb|ACG32580.1| hypothetical protein [Zea mays]
Length=120

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M RK+R+A+Y  +  EG+VK ++R+SF+W+K +  D+ YG
Sbjct  78   DMDRKRRVAAYKAYGVEGRVKGSLRKSFRWVKDRYLDLVYG  118



>tpg|DAA58612.1| TPA: hypothetical protein ZEAMMB73_794061 [Zea mays]
Length=120

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M RK+R+A+Y  +  EG+VK ++R+SF+W+K +  D+ YG
Sbjct  78   DMDRKRRVAAYKAYGVEGRVKGSLRKSFRWVKDRYLDLVYG  118



>gb|KFK41693.1| hypothetical protein AALP_AA2G160700 [Arabis alpina]
Length=123

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +++RKKR+A YN +  EGKVK ++R+SFKW K   +++ YG
Sbjct  81   DIQRKKRVAGYNVYGVEGKVKGSMRKSFKWFKETCSNVVYG  121



>gb|KGN47609.1| hypothetical protein Csa_6G364115 [Cucumis sativus]
Length=80

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGK+K + R+SF+W+K K   + YG
Sbjct  38   EFQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQMLYG  78



>ref|XP_010536185.1| PREDICTED: uncharacterized protein LOC104811234 [Tarenaya hassleriana]
Length=111

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  69   EFQRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVVYG  109



>ref|XP_008670679.1| PREDICTED: uncharacterized protein LOC100277467 [Zea mays]
 gb|ACG40868.1| hypothetical protein [Zea mays]
 tpg|DAA41818.1| TPA: hypothetical protein ZEAMMB73_173011 [Zea mays]
Length=82

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            EMKR++R+ASY  +  EGKVK+++R   +W+K K + I
Sbjct  40   EMKRRRRVASYKAYAVEGKVKASIRRGIRWVKAKCDRI  77



>ref|XP_006644258.1| PREDICTED: secretory carrier-associated membrane protein 5-like 
[Oryza brachyantha]
Length=138

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+ASY  ++ EGKVK + R+SFKWIK +   + YG
Sbjct  96   DMERKRRVASYKAYSVEGKVKGSFRKSFKWIKDRYLHLVYG  136



>ref|XP_011093755.1| PREDICTED: uncharacterized protein LOC105173634 [Sesamum indicum]
Length=145

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK ++++SF+W+K + + + YG
Sbjct  103  ELQRKKRVASYKAYTVEGKVKGSIKKSFRWLKERYSLMVYG  143



>ref|XP_006359891.1| PREDICTED: uncharacterized protein LOC102586099 [Solanum tuberosum]
Length=107

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR+KRIA Y  +T EGKVK+++R   +W K K ++I +G
Sbjct  66   EMKRRKRIAKYKVYTIEGKVKTSIRNGLRWFKNKCSEIIHG  106



>ref|XP_004247381.1| PREDICTED: uncharacterized protein LOC101261064 [Solanum lycopersicum]
Length=168

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR+KRIA Y  +T EGKVK+++R   +W K K ++I +G
Sbjct  127  EMKRRKRIAKYKVYTIEGKVKTSIRNGLRWFKNKCSEIIHG  167



>ref|XP_009125840.1| PREDICTED: uncharacterized protein LOC103850805 [Brassica rapa]
Length=105

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+ RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  65   ELLRKKRVASYKMYSVEGKVKGSFRKSFRWLKQRYTQVLYG  105



>gb|KDP34075.1| hypothetical protein JCGZ_07646 [Jatropha curcas]
Length=131

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK + R SF+W+K +   + YG
Sbjct  89   EFQRKKRVASYKMYSAEGKVKGSFRRSFRWLKDRYTQVVYG  129



>ref|XP_002873541.1| hypothetical protein ARALYDRAFT_488039 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49800.1| hypothetical protein ARALYDRAFT_488039 [Arabidopsis lyrata subsp. 
lyrata]
Length=107

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGKVK + R SF+W+K +   + YG
Sbjct  65   ELQRKKRVASYKMYGVEGKVKGSFRNSFRWLKQRYTQVVYG  105



>ref|NP_001060710.1| Os07g0690200 [Oryza sativa Japonica Group]
 dbj|BAC16037.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22624.1| Os07g0690200 [Oryza sativa Japonica Group]
 gb|EAZ05223.1| hypothetical protein OsI_27421 [Oryza sativa Indica Group]
 gb|EAZ41168.1| hypothetical protein OsJ_25664 [Oryza sativa Japonica Group]
 dbj|BAG98353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=88

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            EMKR++R+A Y ++  EGKVK+++R   +WIK K + I
Sbjct  48   EMKRRRRVAGYKSYAVEGKVKASIRRGLRWIKAKCSHI  85



>ref|XP_007024534.1| Uncharacterized protein TCM_029075 [Theobroma cacao]
 gb|EOY27156.1| Uncharacterized protein TCM_029075 [Theobroma cacao]
Length=131

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SF+WIK     + YG
Sbjct  89   ELQRKKRVASYKVYAVEGKMKGSLRKSFRWIKDTYTQVVYG  129



>ref|XP_002515317.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47301.1| conserved hypothetical protein [Ricinus communis]
Length=113

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            EMKRKKRIA Y  +T EGKVK+++R    WIK K + I
Sbjct  72   EMKRKKRIAKYKVYTVEGKVKTSLRNGLHWIKNKCSQI  109



>ref|NP_196758.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87670.1| putative protein [Arabidopsis thaliana]
 gb|AAL49887.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20368.1| unknown protein [Arabidopsis thaliana]
 gb|AAM61733.1| unknown [Arabidopsis thaliana]
 gb|AED91746.1| uncharacterized protein AT5G11970 [Arabidopsis thaliana]
Length=105

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGKVK + R SF+W+K +   + YG
Sbjct  63   ELQRKKRVASYKMYGVEGKVKGSFRNSFRWLKQRYTQVVYG  103



>ref|NP_001043368.1| Os01g0567400 [Oryza sativa Japonica Group]
 dbj|BAF05282.1| Os01g0567400 [Oryza sativa Japonica Group]
 gb|EAY74590.1| hypothetical protein OsI_02480 [Oryza sativa Indica Group]
 gb|EAZ12376.1| hypothetical protein OsJ_02265 [Oryza sativa Japonica Group]
Length=149

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+ASY  ++ EGKVK + R+SFKWIK +   + YG
Sbjct  107  DMERKRRVASYKAYSVEGKVKGSFRKSFKWIKDRYLHLVYG  147



>ref|XP_006390627.1| hypothetical protein EUTSA_v10019700mg [Eutrema salsugineum]
 gb|ESQ27913.1| hypothetical protein EUTSA_v10019700mg [Eutrema salsugineum]
Length=129

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+A+YN +  EG+VK ++R+SFKW K   ++  YG
Sbjct  87   EIQRKKRVAAYNVYGVEGRVKGSMRKSFKWFKETCSNAVYG  127



>gb|KJB49853.1| hypothetical protein B456_008G141600 [Gossypium raimondii]
Length=105

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EGK+K+++ +  +WIK K + I +G
Sbjct  64   EMKRKKRIAKYKVYTVEGKMKASLSKGLRWIKNKCSQIAHG  104



>gb|KCW81706.1| hypothetical protein EUGRSUZ_C03059 [Eucalyptus grandis]
Length=132

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGKVK + R+SF+W+K +   + YG
Sbjct  84   ELQRKKRVASYKMYAVEGKVKGSFRKSFRWLKDRYTRVFYG  124



>gb|EYU29346.1| hypothetical protein MIMGU_mgv1a024776mg [Erythranthe guttata]
Length=116

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  73   EVQRKKRVASYKVYSVEGKVKGSFRKSFRWLKDRYTQVVYG  113



>ref|XP_010652227.1| PREDICTED: uncharacterized protein LOC104879791 [Vitis vinifera]
Length=107

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+R+KRIA Y  +T EGKVKS++R+  +W K K ++I +G
Sbjct  66   DMRRRKRIAKYKVYTVEGKVKSSLRKGLRWFKNKCHEIIHG  106



>ref|XP_011041610.1| PREDICTED: uncharacterized protein LOC105137530 [Populus euphratica]
Length=106

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EGKVK+++R    WIK K + I +G
Sbjct  65   EMKRKKRIAKYKVYTVEGKVKASLRRGICWIKNKCSKIIHG  105



>ref|XP_002320985.1| hypothetical protein POPTR_0014s11870g [Populus trichocarpa]
 gb|EEE99300.1| hypothetical protein POPTR_0014s11870g [Populus trichocarpa]
Length=106

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKRKKRIA Y  +T EGKVK+++R    WIK K + I +G
Sbjct  65   EMKRKKRIAKYKVYTVEGKVKASLRRGICWIKNKCSKIIHG  105



>gb|KDP40744.1| hypothetical protein JCGZ_24743 [Jatropha curcas]
Length=123

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SF+WIK     + YG
Sbjct  81   ELQRKKRVASYKVYAVEGKMKGSLRKSFRWIKDTYTQVVYG  121



>ref|XP_009790773.1| PREDICTED: uncharacterized protein LOC104238174 [Nicotiana sylvestris]
Length=115

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RK+R+ASY  ++ EGKVK ++R SF+W K K   + YG
Sbjct  73   EFQRKRRVASYKVYSVEGKVKGSLRRSFRWFKDKCTQVVYG  113



>ref|XP_008463430.1| PREDICTED: uncharacterized protein LOC103501594 [Cucumis melo]
Length=107

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR++R+A Y  +  EGKVKS++++ F+WIKTK + I  G
Sbjct  66   EMKRRQRVAKYKLYAVEGKVKSSIKKGFRWIKTKCSRIISG  106



>ref|XP_006346016.1| PREDICTED: uncharacterized protein LOC102600018 [Solanum tuberosum]
Length=85

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            E KR+KR+ASY ++T EGK+K+++R+S +WIK K + I
Sbjct  44   EDKRRKRVASYKSYTIEGKIKNSIRDSLRWIKNKYSSI  81



>ref|XP_002521377.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41045.1| conserved hypothetical protein [Ricinus communis]
Length=119

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SF+WIK     + YG
Sbjct  77   ELQRKKRVASYKVYAMEGKMKGSLRKSFRWIKDTYTQVVYG  117



>ref|XP_009397468.1| PREDICTED: uncharacterized protein LOC103982302 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397470.1| PREDICTED: uncharacterized protein LOC103982302 [Musa acuminata 
subsp. malaccensis]
Length=119

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+A Y  +  EGK+K ++R SF+W+K +   + YG
Sbjct  77   ELQRKKRVAGYKAYAVEGKMKGSLRRSFRWLKDRCTQVVYG  117



>ref|NP_001237797.1| uncharacterized protein LOC100527044 [Glycine max]
 gb|ACU16083.1| unknown [Glycine max]
Length=115

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGK+K +  +SF+W+K K + + YG
Sbjct  74   ELRRKKRVASYKMYSVEGKIKGSFMKSFRWLKNKYSHVVYG  114



>ref|XP_002516091.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46093.1| conserved hypothetical protein [Ricinus communis]
Length=130

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK + R SF+W+K +   + YG
Sbjct  88   EFQRKKRVASYKMYSVEGKVKGSFRRSFRWLKDRYTQVVYG  128



>ref|NP_001235468.1| uncharacterized protein LOC100500259 [Glycine max]
 gb|ACU15281.1| unknown [Glycine max]
 gb|KHN37048.1| hypothetical protein glysoja_009076 [Glycine soja]
Length=129

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  87   EIQRKKRVASYKMYSVEGKVKGSFRKSFRWVKDRYCQVVYG  127



>ref|XP_004507952.1| PREDICTED: uncharacterized protein LOC101497454 [Cicer arietinum]
Length=131

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SFKWIK +   + +G
Sbjct  90   ELQRKKRVASYKVYAVEGKLKGSLRKSFKWIKDRCTRVVHG  130



>ref|XP_004968999.1| PREDICTED: uncharacterized protein LOC101766251 [Setaria italica]
Length=122

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+A+Y  +  EGKVK + R+SFKWIK +   + YG
Sbjct  80   DMERKRRVAAYKAYAVEGKVKGSFRKSFKWIKDRYLHLVYG  120



>ref|XP_006293045.1| hypothetical protein CARUB_v10019325mg [Capsella rubella]
 gb|EOA25943.1| hypothetical protein CARUB_v10019325mg [Capsella rubella]
Length=112

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA+Y  +  EGKVK+TV++ F+WIK + + I +G
Sbjct  72   ETKRKKRIATYKAYAMEGKVKATVKKGFRWIKNRYSLIIHG  112



>ref|NP_565454.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD10145.1| expressed protein [Arabidopsis thaliana]
 gb|AAK59495.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14873.1| expressed protein [Arabidopsis thaliana]
 gb|AAT71984.1| At2g19460 [Arabidopsis thaliana]
 gb|AEC06883.1| uncharacterized protein AT2G19460 [Arabidopsis thaliana]
Length=116

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K + R+SFKWIK K N +
Sbjct  77   DLQRKKRVVSYRAYTVEGKLKGSFRKSFKWIKDKCNKL  114



>ref|XP_006298832.1| hypothetical protein CARUB_v10014938mg [Capsella rubella]
 gb|EOA31730.1| hypothetical protein CARUB_v10014938mg [Capsella rubella]
Length=122

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K + R+SFKWIK K N +
Sbjct  83   DLQRKKRVVSYRAYTVEGKLKGSFRKSFKWIKDKCNKL  120



>ref|XP_009604760.1| PREDICTED: uncharacterized protein LOC104099460 [Nicotiana tomentosiformis]
Length=118

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RK+R+ASY  ++ EGKVK ++R SF+W K K   + YG
Sbjct  76   EFQRKRRVASYKVYSVEGKVKGSLRRSFRWFKDKCTQVVYG  116



>gb|EYU45868.1| hypothetical protein MIMGU_mgv1a024058mg [Erythranthe guttata]
Length=121

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+A Y  +  EGK+KS+ R SFKWIK   N + +G
Sbjct  79   ELQRKKRVAGYKAYGVEGKMKSSFRTSFKWIKDTCNHVVHG  119



>ref|XP_009395779.1| PREDICTED: uncharacterized protein LOC103980958 [Musa acuminata 
subsp. malaccensis]
Length=109

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            + +R+KR+ASY  +  EG+VK +VR  F+W+K K   I YG
Sbjct  67   DFQRRKRVASYKAYAVEGRVKGSVRRGFRWLKDKYTQIVYG  107



>emb|CDP20384.1| unnamed protein product [Coffea canephora]
Length=97

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            EMKR+KRIA Y  ++ EG+VK+++++  +W+K K ++I +G
Sbjct  56   EMKRRKRIAKYKVYSLEGRVKASIKDGLRWLKNKCSEIIHG  96



>ref|XP_002886038.1| hypothetical protein ARALYDRAFT_480527 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62297.1| hypothetical protein ARALYDRAFT_480527 [Arabidopsis lyrata subsp. 
lyrata]
Length=116

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K + R+SFKWIK K N +
Sbjct  77   DLQRKKRVVSYRAYTVEGKLKGSFRKSFKWIKDKCNKL  114



>ref|XP_006575776.1| PREDICTED: uncharacterized protein LOC102665932 [Glycine max]
Length=94

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR+KRIA YN +  EGKVK+T+R+  +WIK   + I +G
Sbjct  53   ESKRRKRIAKYNVYAVEGKVKATLRDGIRWIKHTCSRIVHG  93



>ref|XP_010415380.1| PREDICTED: uncharacterized protein LOC104701397 [Camelina sativa]
Length=124

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K + R+SFKWIK K N +
Sbjct  85   DLQRKKRVVSYRAYTVEGKLKGSFRKSFKWIKDKCNKL  122



>gb|KHN43477.1| hypothetical protein glysoja_002060 [Glycine soja]
Length=74

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA Y  +  EGKVK+T+++  +WIK K + I +G
Sbjct  33   EAKRKKRIAKYKVYGVEGKVKATLKKGLRWIKKKCSQIAHG  73



>ref|XP_002458020.1| hypothetical protein SORBIDRAFT_03g025590 [Sorghum bicolor]
 gb|EES03140.1| hypothetical protein SORBIDRAFT_03g025590 [Sorghum bicolor]
Length=126

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M RK+R+A+Y  +  EGKVK + R+SFKWIK +  ++ YG
Sbjct  84   DMDRKRRVAAYKAYGVEGKVKGSFRKSFKWIKDRYLNLVYG  124



>gb|KJB68771.1| hypothetical protein B456_011G063500 [Gossypium raimondii]
Length=132

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K + R+SF+WIK     + YG
Sbjct  70   ELQRKKRVASYKVYAVEGKMKGSFRKSFRWIKDTATQVVYG  110



>ref|XP_010489479.1| PREDICTED: uncharacterized protein LOC104767140 [Camelina sativa]
Length=124

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K + R+SFKWIK K N +
Sbjct  85   DLQRKKRVVSYRAYTVEGKLKGSFRKSFKWIKDKCNKL  122



>ref|XP_003544544.1| PREDICTED: uncharacterized protein LOC100780149 [Glycine max]
 gb|KHN17252.1| hypothetical protein glysoja_010711 [Glycine soja]
Length=127

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  ++ EGKVK + R+SF+W+K +   + YG
Sbjct  85   EIQRKKRVASYKMYSVEGKVKGSFRKSFRWLKDRYWQVVYG  125



>dbj|BAB63494.1| hypothetical protein [Oryza sativa Japonica Group]
Length=195

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+ASY  ++ EGKVK + R+SFKWIK +   + YG
Sbjct  153  DMERKRRVASYKAYSVEGKVKGSFRKSFKWIKDRYLHLVYG  193



>gb|ACG47193.1| hypothetical protein [Zea mays]
Length=57

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+A+Y  +  EGK+K + R+SFKWIK +  ++ YG
Sbjct  15   DMERKRRVAAYKAYGVEGKMKGSFRKSFKWIKDRYLNLVYG  55



>ref|XP_010512660.1| PREDICTED: uncharacterized protein LOC104788595 [Camelina sativa]
Length=117

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA+Y  +  EGKVK+TV++ F+WIK + +   +G
Sbjct  77   ETKRKKRIATYKAYAMEGKVKATVKKGFRWIKNRYSQFIHG  117



>ref|XP_002277637.1| PREDICTED: uncharacterized protein LOC100267009 [Vitis vinifera]
Length=117

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K + R+SF+WIK     + YG
Sbjct  75   ELQRKKRVASYKVYAVEGKMKGSFRKSFRWIKDTYTQVVYG  115



>ref|XP_010467892.1| PREDICTED: uncharacterized protein LOC104747880 [Camelina sativa]
Length=124

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDI  114
            +++RKKR+ SY  +T EGK+K + R+SFKWIK K N +
Sbjct  85   DLQRKKRVVSYRAYTVEGKLKGSFRKSFKWIKDKCNKL  122



>ref|XP_002888889.1| hypothetical protein ARALYDRAFT_895124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65148.1| hypothetical protein ARALYDRAFT_895124 [Arabidopsis lyrata subsp. 
lyrata]
Length=130

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASYN +  EG+VK ++++SFKW K   ++  YG
Sbjct  88   EIQRKKRVASYNVYGVEGRVKGSMKKSFKWFKETCSNAVYG  128



>ref|XP_006465997.1| PREDICTED: uncharacterized protein LOC102621718 [Citrus sinensis]
Length=114

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+S KW+K     I +G
Sbjct  72   ELQRKKRVASYKVYTVEGKMKGSLRKSLKWVKNTYTQIVHG  112



>ref|NP_001142901.1| uncharacterized protein LOC100275329 [Zea mays]
 gb|ACG27414.1| hypothetical protein [Zea mays]
Length=117

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+A+Y  +  EGK+K + R+SFKWIK +  ++ YG
Sbjct  75   DMERKRRVAAYKAYGVEGKMKGSFRKSFKWIKDRYLNLVYG  115



>ref|XP_006604736.1| PREDICTED: uncharacterized protein LOC100807345 [Glycine max]
Length=90

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KRKKRIA Y  +  EGKVK+T+++  +WIK K + I +G
Sbjct  49   EAKRKKRIAKYKVYGVEGKVKATLKKGLRWIKKKCSQIAHG  89



>ref|XP_006451506.1| hypothetical protein CICLE_v10009884mg [Citrus clementina]
 gb|ESR64746.1| hypothetical protein CICLE_v10009884mg [Citrus clementina]
Length=130

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK + ++SF+WIK + + + +G
Sbjct  88   ELQRKKRVASYKVYTVEGKVKGSFKKSFRWIKDRCSRMVHG  128



>ref|XP_003558099.1| PREDICTED: uncharacterized protein LOC100839633 [Brachypodium 
distachyon]
Length=113

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KR++R+ASY  ++ EGKVK++ R  F+WIK K   + +G
Sbjct  73   EVKRRRRVASYKAYSVEGKVKASFRRGFRWIKDKCTGLIHG  113



>ref|XP_009382510.1| PREDICTED: uncharacterized protein LOC103970456 [Musa acuminata 
subsp. malaccensis]
Length=146

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E KR++R+ASY  +  EGKVK++ R+ F+WIK K +++ +G
Sbjct  105  EAKRRRRVASYKAYAVEGKVKASFRKGFRWIKVKCSELVHG  145



>ref|NP_177416.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51864.1|AC010926_27 unknown protein; 33231-33614 [Arabidopsis thaliana]
 dbj|BAC42413.1| unknown protein [Arabidopsis thaliana]
 gb|ABD59130.1| At1g72720 [Arabidopsis thaliana]
 gb|AEE35364.1| uncharacterized protein AT1G72720 [Arabidopsis thaliana]
Length=127

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASYN +  EG+VK ++++SFKW K   ++  YG
Sbjct  85   EIQRKKRVASYNVYGVEGRVKGSMKKSFKWFKETCSNAVYG  125



>ref|XP_006426586.1| hypothetical protein CICLE_v10026799mg [Citrus clementina]
 gb|ESR39826.1| hypothetical protein CICLE_v10026799mg [Citrus clementina]
 gb|KDO65155.1| hypothetical protein CISIN_1g033649mg [Citrus sinensis]
Length=114

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGK+K ++R+S KW+K     I +G
Sbjct  72   ELQRKKRVASYKVYTVEGKMKGSLRKSLKWVKNTYTQIVHG  112



>gb|EMT32572.1| hypothetical protein F775_29998 [Aegilops tauschii]
Length=120

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+A+Y  +  EGKVK + R+SF+WIK +   + YG
Sbjct  78   DMERKRRVAAYKAYAMEGKVKGSFRKSFRWIKDRYLHLVYG  118



>gb|AFW83054.1| hypothetical protein ZEAMMB73_749542 [Zea mays]
Length=119

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+A+Y  +  EGK+K + R+SFKWIK +  ++ YG
Sbjct  77   DMERKRRVAAYKAYGVEGKMKGSFRKSFKWIKDRYLNLVYG  117



>emb|CDM82593.1| unnamed protein product [Triticum aestivum]
Length=120

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            +M+RK+R+A+Y  +  EGKVK + R+SF+WIK +   + YG
Sbjct  78   DMERKRRVAAYKAYAMEGKVKGSFRKSFRWIKDRYLHLVYG  118



>ref|XP_006475485.1| PREDICTED: uncharacterized protein LOC102618796 [Citrus sinensis]
 gb|KDO53215.1| hypothetical protein CISIN_1g032975mg [Citrus sinensis]
Length=130

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +T EGKVK + ++SF+WIK + + + +G
Sbjct  88   ELQRKKRVASYKVYTVEGKVKGSFKKSFRWIKDRCSRMVHG  128



>ref|XP_009334737.1| PREDICTED: uncharacterized protein LOC103927523 [Pyrus x bretschneideri]
Length=128

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRY  120
            E++RKKR+ASY  ++ EGK+K + R+SF+W+K K   + Y
Sbjct  86   ELQRKKRVASYKMYSVEGKMKGSFRKSFRWLKDKYTQVLY  125



>ref|XP_006302957.1| hypothetical protein CARUB_v10021141mg [Capsella rubella]
 gb|EOA35855.1| hypothetical protein CARUB_v10021141mg [Capsella rubella]
Length=130

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+A+YN +  EG+VK ++++SFKW K   ++  YG
Sbjct  88   EIQRKKRVAAYNVYGVEGRVKGSMKKSFKWFKETCSNAVYG  128



>ref|XP_001772171.1| predicted protein [Physcomitrella patens]
 gb|EDQ62984.1| predicted protein, partial [Physcomitrella patens]
Length=57

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+A Y  FT E KVK +VR   +WIK K  ++RYG
Sbjct  17   ETRRKKRVARYKVFTVERKVKESVRSGCRWIKNKYIEVRYG  57



>ref|XP_009105933.1| PREDICTED: uncharacterized protein LOC103831776 [Brassica rapa]
Length=131

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+A YN +  EGKVK ++++SFKW K   ++  YG
Sbjct  89   EIQRKKRVAGYNVYGVEGKVKGSMKKSFKWFKETCSNAVYG  129



>ref|XP_004498869.1| PREDICTED: uncharacterized protein LOC101498614 [Cicer arietinum]
Length=102

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RKKR+ASY  ++ EGKVK ++++SFKW+K +   + YG
Sbjct  61   EFQRKKRVASYKMYSVEGKVKGSLKKSFKWLKDRYLYVVYG  101



>ref|XP_010548664.1| PREDICTED: uncharacterized protein LOC104820019 [Tarenaya hassleriana]
Length=120

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTK  102
            +++RKKR+ASY  +T EGK+K + R+SFKWIK +
Sbjct  79   DLRRKKRVASYRAYTVEGKLKGSFRKSFKWIKDR  112



>ref|XP_010555044.1| PREDICTED: uncharacterized protein LOC104824634 [Tarenaya hassleriana]
Length=103

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKL  105
            E++RKKR+ASY  ++ EGKVK   R+SF W+K +L
Sbjct  69   EIQRKKRVASYKMYSVEGKVKGPFRKSFPWLKQRL  103



>gb|KJB54405.1| hypothetical protein B456_009G032700 [Gossypium raimondii]
Length=124

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EG+VK ++++SF+W+K +   I YG
Sbjct  80   ELQRKKRVASYKVYDVEGRVKGSLKKSFRWLKDRYTRIVYG  120



>ref|XP_008338712.1| PREDICTED: uncharacterized protein LOC103401770 [Malus domestica]
Length=126

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+A Y  +T E K+K ++R+SFKWIK     + YG
Sbjct  84   ELQRKKRVAGYKVYTAEEKMKGSLRKSFKWIKNTCTQVVYG  124



>ref|XP_010925470.1| PREDICTED: uncharacterized protein LOC105047996 [Elaeis guineensis]
Length=121

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+  Y  +  EGK+K ++R+SF+WIK +   + YG
Sbjct  79   ELQRKKRVVGYKAYAVEGKMKGSLRKSFRWIKERYTQVVYG  119



>ref|XP_010428169.1| PREDICTED: uncharacterized protein LOC104712878 [Camelina sativa]
Length=130

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+A+YN +  EG+VK ++++SFKW K   ++  YG
Sbjct  88   EIQRKKRVAAYNVYGVEGRVKGSMKKSFKWFKETCSNAVYG  128



>emb|CDO98797.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E+KRK+RIASY  +  EGK+K++VR++F+W+K K +   +G
Sbjct  83   EVKRKQRIASYKAYAVEGKIKASVRKTFRWMKNKYSYFVHG  123



>ref|XP_010262040.1| PREDICTED: uncharacterized protein LOC104600664 [Nelumbo nucifera]
Length=115

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E++RKKR+ASY  +  EGK+K ++R+SF+W+K +   + +G
Sbjct  73   ELQRKKRVASYKVYAMEGKMKGSLRKSFRWLKDRYTQVVHG  113



>ref|XP_006351591.1| PREDICTED: uncharacterized protein LOC102597557 [Solanum tuberosum]
Length=107

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EMKRKKRIASYNTFTTEGKVKSTVRESFKWIKTKLNDIRYG  123
            E +RK+R+ASY  ++ EGKVK ++R S +W K K   + YG
Sbjct  65   EFQRKRRVASYKVYSVEGKVKGSLRRSLRWFKDKYTQVLYG  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560109397860